BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF050G12

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFK44603.1|  unknown                                                 265   5e-87   Lotus japonicus
gb|AFW83711.1|  putative casein kinase family protein                   265   8e-87   
ref|XP_008656801.1|  PREDICTED: casein kinase I isoform delta-like      264   3e-86   
ref|NP_001168804.1|  uncharacterized protein LOC100382605               264   1e-85   
gb|EYU28389.1|  hypothetical protein MIMGU_mgv1a007204mg                270   3e-85   Erythranthe guttata [common monkey flower]
ref|XP_011078008.1|  PREDICTED: casein kinase I isoform delta-like      271   6e-85   Sesamum indicum [beniseed]
emb|CDP03143.1|  unnamed protein product                                271   6e-85   Coffea canephora [robusta coffee]
ref|XP_009764702.1|  PREDICTED: casein kinase I isoform delta-like      270   1e-84   Nicotiana sylvestris
dbj|BAD45136.1|  putative protein kinase ADK1                           261   2e-84   Oryza sativa Japonica Group [Japonica rice]
gb|KJB83052.1|  hypothetical protein B456_013G227100                    264   2e-84   Gossypium raimondii
ref|XP_004507951.1|  PREDICTED: casein kinase I isoform delta-lik...    268   3e-84   Cicer arietinum [garbanzo]
ref|XP_003542336.1|  PREDICTED: casein kinase I isoform delta-lik...    268   3e-84   Glycine max [soybeans]
ref|XP_004507950.1|  PREDICTED: casein kinase I isoform delta-lik...    269   3e-84   
gb|KEH32501.1|  casein kinase I-like protein                            268   4e-84   Medicago truncatula
gb|KDP33855.1|  hypothetical protein JCGZ_07426                         269   4e-84   Jatropha curcas
ref|XP_010696534.1|  PREDICTED: casein kinase I isoform delta-like      269   4e-84   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO53222.1|  hypothetical protein CISIN_1g011819mg                   266   4e-84   Citrus sinensis [apfelsine]
gb|KJB54402.1|  hypothetical protein B456_009G032600                    263   4e-84   Gossypium raimondii
gb|EAY75552.1|  hypothetical protein OsI_03457                          268   4e-84   Oryza sativa Indica Group [Indian rice]
ref|XP_003549210.1|  PREDICTED: casein kinase I isoform delta-lik...    268   4e-84   Glycine max [soybeans]
gb|KJB83051.1|  hypothetical protein B456_013G227100                    264   5e-84   Gossypium raimondii
ref|XP_006597822.1|  PREDICTED: casein kinase I isoform delta-lik...    263   5e-84   
pdb|3SV0|A  Chain A, Crystal Structure Of Casein Kinase-1 Like Pr...    269   5e-84   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644592.1|  PREDICTED: casein kinase I isoform delta-lik...    266   5e-84   Oryza brachyantha
ref|XP_002456234.1|  hypothetical protein SORBIDRAFT_03g032560          268   5e-84   Sorghum bicolor [broomcorn]
ref|XP_007154635.1|  hypothetical protein PHAVU_003G135100g             268   5e-84   Phaseolus vulgaris [French bean]
ref|XP_006451505.1|  hypothetical protein CICLE_v10008160mg             268   5e-84   Citrus clementina [clementine]
ref|XP_002309212.1|  casein kinase family protein                       268   6e-84   Populus trichocarpa [western balsam poplar]
ref|XP_010924973.1|  PREDICTED: casein kinase I isoform delta-lik...    266   6e-84   
gb|EMT18264.1|  Casein kinase I isoform delta-like protein              268   6e-84   
dbj|BAB92346.1|  casein kinase I-like                                   268   6e-84   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007024533.1|  Casein kinase 1-like protein 2                     268   6e-84   Theobroma cacao [chocolate]
ref|XP_011003341.1|  PREDICTED: casein kinase I isoform delta-like      268   7e-84   Populus euphratica
ref|XP_004157925.1|  PREDICTED: casein kinase I isoform delta-like      268   7e-84   
emb|CDM83770.1|  unnamed protein product                                268   7e-84   Triticum aestivum [Canadian hard winter wheat]
gb|EAZ13276.1|  hypothetical protein OsJ_03201                          268   7e-84   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644591.1|  PREDICTED: casein kinase I isoform delta-lik...    268   8e-84   Oryza brachyantha
ref|XP_004141059.1|  PREDICTED: casein kinase I isoform delta-like      268   8e-84   
ref|XP_004287578.1|  PREDICTED: casein kinase I isoform delta-like      268   8e-84   Fragaria vesca subsp. vesca
ref|XP_008459457.1|  PREDICTED: casein kinase I isoform delta-like      268   9e-84   Cucumis melo [Oriental melon]
gb|KDP40745.1|  hypothetical protein JCGZ_24744                         268   9e-84   Jatropha curcas
ref|XP_009597979.1|  PREDICTED: casein kinase I isoform delta-like      268   1e-83   Nicotiana tomentosiformis
emb|CCM43976.1|  Caesin kinase I isoform delta like protein             268   1e-83   Cucumis sativus [cucumbers]
ref|XP_004969708.1|  PREDICTED: casein kinase I isoform delta-like      268   1e-83   Setaria italica
ref|XP_010232213.1|  PREDICTED: casein kinase I-like                    268   1e-83   Brachypodium distachyon [annual false brome]
gb|KJB54401.1|  hypothetical protein B456_009G032600                    266   1e-83   Gossypium raimondii
ref|XP_002521378.1|  casein kinase, putative                            267   1e-83   
ref|XP_007012783.1|  Casein kinase 1-like protein 2 isoform 1           267   1e-83   
ref|XP_009410794.1|  PREDICTED: casein kinase I-like                    267   1e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395821.1|  PREDICTED: casein kinase I-like isoform X2         267   1e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007012784.1|  Casein kinase 1 isoform 2                          267   1e-83   
ref|XP_008242376.1|  PREDICTED: casein kinase I isoform delta-like      267   2e-83   Prunus mume [ume]
ref|XP_010924972.1|  PREDICTED: casein kinase I isoform delta-lik...    267   2e-83   Elaeis guineensis
gb|KHG23724.1|  hypothetical protein F383_04752                         267   2e-83   Gossypium arboreum [tree cotton]
gb|KJB83050.1|  hypothetical protein B456_013G227100                    266   2e-83   Gossypium raimondii
ref|XP_011013818.1|  PREDICTED: casein kinase I isoform delta-like      267   2e-83   Populus euphratica
ref|XP_008806949.1|  PREDICTED: casein kinase I isoform delta-lik...    267   2e-83   Phoenix dactylifera
ref|XP_006371997.1|  casein kinase family protein                       267   2e-83   
gb|KJB83053.1|  hypothetical protein B456_013G227100                    266   2e-83   Gossypium raimondii
gb|KHN28842.1|  Casein kinase I isoform delta-like                      266   2e-83   Glycine soja [wild soybean]
ref|XP_010262044.1|  PREDICTED: casein kinase I isoform delta-like      266   2e-83   Nelumbo nucifera [Indian lotus]
ref|XP_003546462.1|  PREDICTED: casein kinase I isoform delta-lik...    266   3e-83   Glycine max [soybeans]
gb|KJB54404.1|  hypothetical protein B456_009G032600                    265   3e-83   Gossypium raimondii
ref|XP_011079987.1|  PREDICTED: casein kinase I-like                    266   3e-83   Sesamum indicum [beniseed]
ref|XP_002277513.2|  PREDICTED: casein kinase I isoform delta-like      266   4e-83   Vitis vinifera
gb|KJB54403.1|  hypothetical protein B456_009G032600                    266   4e-83   Gossypium raimondii
gb|AFW79363.1|  putative casein kinase family protein                   255   4e-83   
ref|XP_009361635.1|  PREDICTED: casein kinase I isoform delta-like      266   5e-83   Pyrus x bretschneideri [bai li]
gb|KHG04851.1|  hypothetical protein F383_30273                         266   5e-83   Gossypium arboreum [tree cotton]
gb|KHG04850.1|  hypothetical protein F383_30273                         266   5e-83   Gossypium arboreum [tree cotton]
ref|XP_009415492.1|  PREDICTED: casein kinase I-like                    266   5e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004243748.1|  PREDICTED: casein kinase I isoform delta-like      266   6e-83   Solanum lycopersicum
ref|XP_008338713.1|  PREDICTED: casein kinase I isoform alpha-like      257   6e-83   
ref|XP_008352372.1|  PREDICTED: casein kinase I isoform delta-like      265   6e-83   
ref|XP_008337722.1|  PREDICTED: casein kinase I isoform delta-like      265   6e-83   
ref|XP_010242267.1|  PREDICTED: casein kinase I isoform delta-like      266   6e-83   Nelumbo nucifera [Indian lotus]
ref|XP_010925467.1|  PREDICTED: casein kinase I isoform delta-lik...    265   8e-83   
ref|XP_006357711.1|  PREDICTED: casein kinase I isoform delta-like      265   8e-83   Solanum tuberosum [potatoes]
ref|XP_010090074.1|  Casein kinase I isoform delta-like protein         265   9e-83   Morus notabilis
ref|XP_002281345.2|  PREDICTED: casein kinase I isoform delta-like      265   1e-82   Vitis vinifera
ref|XP_006853888.1|  hypothetical protein AMTR_s00036p00147120          265   1e-82   Amborella trichopoda
ref|XP_004239254.1|  PREDICTED: casein kinase I isoform delta-like      265   1e-82   Solanum lycopersicum
ref|XP_010925469.1|  PREDICTED: casein kinase I isoform delta-lik...    265   1e-82   
ref|XP_010685356.1|  PREDICTED: casein kinase I isoform delta-like      264   1e-82   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006338113.1|  PREDICTED: casein kinase I isoform delta-like      265   2e-82   Solanum tuberosum [potatoes]
ref|XP_008813454.1|  PREDICTED: casein kinase I isoform delta-like      265   2e-82   Phoenix dactylifera
ref|XP_009606359.1|  PREDICTED: casein kinase I isoform delta-like      264   2e-82   Nicotiana tomentosiformis
gb|KJB56939.1|  hypothetical protein B456_009G142600                    264   2e-82   Gossypium raimondii
ref|XP_004151319.1|  PREDICTED: casein kinase I isoform delta-like      264   2e-82   Cucumis sativus [cucumbers]
ref|NP_001043372.1|  Os01g0570500                                       264   2e-82   
emb|CDO97889.1|  unnamed protein product                                264   2e-82   Coffea canephora [robusta coffee]
gb|EEC70925.1|  hypothetical protein OsI_02496                          264   3e-82   Oryza sativa Indica Group [Indian rice]
gb|KHG11372.1|  hypothetical protein F383_02311                         263   3e-82   Gossypium arboreum [tree cotton]
ref|XP_008447619.1|  PREDICTED: casein kinase I isoform delta-like      264   3e-82   Cucumis melo [Oriental melon]
gb|EYU45867.1|  hypothetical protein MIMGU_mgv1a005939mg                263   4e-82   Erythranthe guttata [common monkey flower]
ref|XP_010049456.1|  PREDICTED: casein kinase I isoform delta-like      263   5e-82   Eucalyptus grandis [rose gum]
ref|XP_006342964.1|  PREDICTED: casein kinase I isoform delta-like      263   5e-82   Solanum tuberosum [potatoes]
ref|XP_008793211.1|  PREDICTED: casein kinase I isoform delta-lik...    260   5e-82   
ref|XP_004235583.1|  PREDICTED: casein kinase I isoform delta-like      263   5e-82   Solanum lycopersicum
ref|XP_007138711.1|  hypothetical protein PHAVU_009G230800g             263   5e-82   Phaseolus vulgaris [French bean]
gb|KHN35865.1|  Casein kinase I isoform delta-like                      261   9e-82   Glycine soja [wild soybean]
ref|XP_006597037.1|  PREDICTED: uncharacterized protein LOC100795...    262   1e-81   Glycine max [soybeans]
ref|XP_002299898.2|  hypothetical protein POPTR_0001s20450g             262   1e-81   
gb|KDO65165.1|  hypothetical protein CISIN_1g010674mg                   260   1e-81   Citrus sinensis [apfelsine]
ref|XP_009409360.1|  PREDICTED: casein kinase I-like                    262   1e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW69786.1|  hypothetical protein EUGRSUZ_F03150                     258   1e-81   Eucalyptus grandis [rose gum]
ref|XP_003533767.1|  PREDICTED: casein kinase I isoform delta-like      261   1e-81   Glycine max [soybeans]
gb|KHN30066.1|  Casein kinase I isoform delta-like                      262   1e-81   Glycine soja [wild soybean]
ref|XP_003543581.1|  PREDICTED: casein kinase I isoform delta-lik...    262   2e-81   Glycine max [soybeans]
ref|XP_002864491.1|  hypothetical protein ARALYDRAFT_918863             261   2e-81   Arabidopsis lyrata subsp. lyrata
ref|XP_011009743.1|  PREDICTED: casein kinase I isoform delta-lik...    259   2e-81   Populus euphratica
gb|EYU21357.1|  hypothetical protein MIMGU_mgv1a023567mg                257   2e-81   Erythranthe guttata [common monkey flower]
gb|EPS64220.1|  hypothetical protein M569_10560                         261   2e-81   Genlisea aurea
ref|XP_011009742.1|  PREDICTED: casein kinase I isoform delta-lik...    261   2e-81   Populus euphratica
ref|XP_010909190.1|  PREDICTED: casein kinase I isoform delta-like      262   2e-81   Elaeis guineensis
gb|EEC79796.1|  hypothetical protein OsI_21224                          261   2e-81   Oryza sativa Indica Group [Indian rice]
ref|XP_010474302.1|  PREDICTED: casein kinase I isoform delta-like      253   2e-81   Camelina sativa [gold-of-pleasure]
ref|NP_001056503.1|  Os05g0593800                                       261   2e-81   
ref|XP_006465998.1|  PREDICTED: casein kinase I isoform delta-like      261   2e-81   Citrus sinensis [apfelsine]
ref|XP_008228258.1|  PREDICTED: casein kinase I isoform delta-like      261   2e-81   Prunus mume [ume]
ref|XP_007217223.1|  hypothetical protein PRUPE_ppa005139mg             261   2e-81   Prunus persica
ref|XP_008391353.1|  PREDICTED: casein kinase I isoform delta-like      261   3e-81   Malus domestica [apple tree]
ref|XP_006426585.1|  hypothetical protein CICLE_v10025527mg             261   3e-81   Citrus clementina [clementine]
ref|XP_009372402.1|  PREDICTED: casein kinase I isoform delta-like      261   3e-81   Pyrus x bretschneideri [bai li]
ref|XP_006413231.1|  hypothetical protein EUTSA_v10025148mg             261   3e-81   Eutrema salsugineum [saltwater cress]
ref|XP_006385411.1|  hypothetical protein POPTR_0003s04170g             261   3e-81   
ref|XP_006413230.1|  hypothetical protein EUTSA_v10025148mg             261   3e-81   Eutrema salsugineum [saltwater cress]
ref|XP_003567780.1|  PREDICTED: casein kinase I-like                    261   4e-81   Brachypodium distachyon [annual false brome]
ref|XP_009387717.1|  PREDICTED: casein kinase I-like                    261   4e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004960994.1|  PREDICTED: casein kinase I isoform delta-lik...    258   4e-81   Setaria italica
gb|KFK29120.1|  hypothetical protein AALP_AA7G091500                    260   5e-81   Arabis alpina [alpine rockcress]
ref|XP_010539397.1|  PREDICTED: casein kinase I isoform delta-like      260   5e-81   Tarenaya hassleriana [spider flower]
gb|KDO65158.1|  hypothetical protein CISIN_1g010674mg                   261   6e-81   Citrus sinensis [apfelsine]
ref|XP_009795173.1|  PREDICTED: casein kinase I isoform delta-like      260   6e-81   Nicotiana sylvestris
ref|XP_004303659.1|  PREDICTED: casein kinase I                         260   6e-81   Fragaria vesca subsp. vesca
ref|XP_001784922.1|  predicted protein                                  255   7e-81   
ref|XP_010062655.1|  PREDICTED: casein kinase I isoform delta-lik...    260   8e-81   Eucalyptus grandis [rose gum]
ref|XP_003597565.1|  Casein kinase I isoform delta-like protein         260   8e-81   Medicago truncatula
ref|XP_001774847.1|  predicted protein                                  255   9e-81   
ref|XP_006390631.1|  hypothetical protein EUTSA_v10018502mg             255   9e-81   
ref|XP_009631851.1|  PREDICTED: casein kinase I isoform delta-like      260   9e-81   Nicotiana tomentosiformis
gb|KCW69785.1|  hypothetical protein EUGRSUZ_F03150                     259   9e-81   Eucalyptus grandis [rose gum]
ref|XP_006654877.1|  PREDICTED: casein kinase I isoform delta-like      260   9e-81   Oryza brachyantha
ref|XP_010536868.1|  PREDICTED: casein kinase I isoform delta-like      259   9e-81   Tarenaya hassleriana [spider flower]
ref|XP_008793210.1|  PREDICTED: casein kinase I isoform delta-lik...    258   9e-81   Phoenix dactylifera
ref|XP_006282246.1|  hypothetical protein CARUB_v10028520mg             259   1e-80   Capsella rubella
ref|XP_008793206.1|  PREDICTED: casein kinase I isoform delta-lik...    260   1e-80   Phoenix dactylifera
ref|XP_002441634.1|  hypothetical protein SORBIDRAFT_09g030690          260   1e-80   Sorghum bicolor [broomcorn]
ref|XP_009335830.1|  PREDICTED: casein kinase I isoform delta-like      260   1e-80   Pyrus x bretschneideri [bai li]
ref|XP_011009775.1|  PREDICTED: casein kinase I isoform delta-lik...    259   1e-80   Populus euphratica
gb|KCW53570.1|  hypothetical protein EUGRSUZ_J02844                     256   1e-80   Eucalyptus grandis [rose gum]
ref|XP_004960993.1|  PREDICTED: casein kinase I isoform delta-lik...    259   1e-80   Setaria italica
ref|XP_011009776.1|  PREDICTED: casein kinase I isoform delta-lik...    259   1e-80   Populus euphratica
ref|NP_194340.1|  casein kinase 1                                       259   1e-80   Arabidopsis thaliana [mouse-ear cress]
gb|KJB06826.1|  hypothetical protein B456_001G013300                    259   1e-80   Gossypium raimondii
gb|KJB06829.1|  hypothetical protein B456_001G013300                    256   1e-80   Gossypium raimondii
gb|ACT34059.1|  putative protein kinase                                 259   1e-80   Aegilops tauschii
gb|ABK24232.1|  unknown                                                 259   2e-80   Picea sitchensis
ref|XP_010537581.1|  PREDICTED: casein kinase I                         259   2e-80   Tarenaya hassleriana [spider flower]
gb|KJB06827.1|  hypothetical protein B456_001G013300                    259   2e-80   Gossypium raimondii
gb|AFV33949.1|  casein kinase I                                         259   2e-80   Gossypium hirsutum [American cotton]
ref|XP_002972659.1|  hypothetical protein SELMODRAFT_231975             254   2e-80   
ref|XP_010483192.1|  PREDICTED: casein kinase I isoform delta-like      258   2e-80   Camelina sativa [gold-of-pleasure]
ref|NP_680447.1|  casein kinase I-like 12                               258   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443365.1|  PREDICTED: casein kinase I isoform delta-like      258   2e-80   Camelina sativa [gold-of-pleasure]
gb|EPS64405.1|  hypothetical protein M569_10374                         253   2e-80   Genlisea aurea
ref|XP_009798249.1|  PREDICTED: casein kinase I-like isoform X1         259   2e-80   Nicotiana sylvestris
emb|CDM83167.1|  unnamed protein product                                258   3e-80   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006286042.1|  hypothetical protein CARUB_v10007571mg             258   3e-80   Capsella rubella
gb|KFK27260.1|  hypothetical protein AALP_AA8G358800                    258   3e-80   Arabis alpina [alpine rockcress]
gb|KHG18061.1|  hypothetical protein F383_22405                         258   3e-80   Gossypium arboreum [tree cotton]
ref|XP_006390630.1|  hypothetical protein EUTSA_v10018502mg             255   3e-80   
ref|XP_002988150.1|  hypothetical protein SELMODRAFT_127114             254   4e-80   
gb|KJB06830.1|  hypothetical protein B456_001G013300                    258   4e-80   Gossypium raimondii
ref|XP_006357391.1|  PREDICTED: casein kinase I isoform delta-like      258   4e-80   Solanum tuberosum [potatoes]
ref|XP_004486851.1|  PREDICTED: casein kinase I isoform delta-like      258   4e-80   Cicer arietinum [garbanzo]
ref|XP_009105937.1|  PREDICTED: casein kinase I isoform delta-lik...    258   5e-80   Brassica rapa
gb|KHN11262.1|  Casein kinase I isoform delta-like                      258   5e-80   Glycine soja [wild soybean]
ref|XP_002867580.1|  hypothetical protein ARALYDRAFT_492204             257   5e-80   
ref|XP_009105934.1|  PREDICTED: casein kinase I isoform delta-lik...    258   5e-80   
ref|XP_010448325.1|  PREDICTED: casein kinase I isoform delta-like      257   6e-80   Camelina sativa [gold-of-pleasure]
ref|XP_009400542.1|  PREDICTED: casein kinase I isoform delta-lik...    255   6e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010438803.1|  PREDICTED: casein kinase I isoform delta-like      257   6e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010433551.1|  PREDICTED: casein kinase I isoform delta-like      257   6e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006585502.1|  PREDICTED: casein kinase I isoform delta-lik...    258   6e-80   Glycine max [soybeans]
ref|XP_006585503.1|  PREDICTED: casein kinase I isoform delta-lik...    258   6e-80   Glycine max [soybeans]
emb|CDX72938.1|  BnaC06g33860D                                          258   6e-80   
ref|NP_177415.1|  casein kinase 1-like protein 2                        258   7e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010033765.1|  PREDICTED: casein kinase I isoform delta-like      258   8e-80   Eucalyptus grandis [rose gum]
ref|XP_008650083.1|  PREDICTED: casein kinase I isoform delta-like      258   8e-80   
ref|XP_009349379.1|  PREDICTED: casein kinase I isoform delta-like      257   8e-80   Pyrus x bretschneideri [bai li]
gb|KHN39324.1|  Casein kinase I isoform delta-like                      257   9e-80   Glycine soja [wild soybean]
ref|XP_002887448.1|  hypothetical protein ARALYDRAFT_476408             257   9e-80   
ref|XP_006401255.1|  hypothetical protein EUTSA_v10013573mg             254   1e-79   
ref|XP_010451725.1|  PREDICTED: casein kinase I isoform delta-like      256   1e-79   Camelina sativa [gold-of-pleasure]
gb|ABR18116.1|  unknown                                                 257   1e-79   Picea sitchensis
ref|XP_006390629.1|  hypothetical protein EUTSA_v10018502mg             257   1e-79   Eutrema salsugineum [saltwater cress]
gb|KDO65159.1|  hypothetical protein CISIN_1g010674mg                   257   1e-79   Citrus sinensis [apfelsine]
ref|XP_008656114.1|  PREDICTED: casein kinase I isoform delta-lik...    254   1e-79   Zea mays [maize]
ref|XP_003627159.1|  Casein kinase I isoform delta-like protein         257   1e-79   Medicago truncatula
gb|ACJ85725.1|  unknown                                                 257   2e-79   Medicago truncatula
ref|XP_003627160.1|  Casein kinase I isoform delta-like protein         254   2e-79   
ref|XP_004241866.1|  PREDICTED: casein kinase I-like                    256   2e-79   Solanum lycopersicum
ref|XP_006401254.1|  hypothetical protein EUTSA_v10013573mg             255   2e-79   Eutrema salsugineum [saltwater cress]
ref|NP_001242599.1|  uncharacterized protein LOC100795570               256   2e-79   Glycine max [soybeans]
ref|XP_009395780.1|  PREDICTED: casein kinase I-like                    256   4e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010531866.1|  PREDICTED: casein kinase I isoform delta-like      255   4e-79   Tarenaya hassleriana [spider flower]
ref|XP_008656113.1|  PREDICTED: casein kinase I isoform delta-lik...    255   6e-79   Zea mays [maize]
gb|KDO65156.1|  hypothetical protein CISIN_1g010674mg                   255   9e-79   Citrus sinensis [apfelsine]
ref|XP_009400540.1|  PREDICTED: casein kinase I-like isoform X1         255   9e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004510406.1|  PREDICTED: casein kinase I isoform delta-like      255   1e-78   Cicer arietinum [garbanzo]
ref|XP_006302226.1|  hypothetical protein CARUB_v10020246mg             254   1e-78   Capsella rubella
gb|AAA50233.1|  casein kinase I-like protein; similar to the rat ...    252   1e-78   Arabidopsis thaliana [mouse-ear cress]
emb|CDY49859.1|  BnaA02g16080D                                          254   1e-78   Brassica napus [oilseed rape]
ref|XP_010428166.1|  PREDICTED: casein kinase I-like                    254   2e-78   Camelina sativa [gold-of-pleasure]
emb|CDX94377.1|  BnaC01g18070D                                          253   2e-78   
ref|XP_009139890.1|  PREDICTED: casein kinase I isoform delta-like      253   2e-78   Brassica rapa
gb|KFK41692.1|  hypothetical protein AALP_AA2G160600                    253   2e-78   Arabis alpina [alpine rockcress]
ref|XP_010416034.1|  PREDICTED: casein kinase I isoform delta-like      253   3e-78   Camelina sativa [gold-of-pleasure]
ref|XP_007135523.1|  hypothetical protein PHAVU_010G136500g             253   6e-78   Phaseolus vulgaris [French bean]
ref|XP_004969013.1|  PREDICTED: casein kinase I isoform delta-like      253   6e-78   Setaria italica
ref|XP_009407307.1|  PREDICTED: casein kinase I-like isoform X2         253   7e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394112.1|  PREDICTED: casein kinase I-like                    252   1e-77   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY11892.1|  BnaC03g13180D                                          251   1e-77   Brassica napus [oilseed rape]
ref|XP_009127947.1|  PREDICTED: casein kinase I isoform delta-like      251   2e-77   Brassica rapa
emb|CDX88601.1|  BnaA03g10480D                                          249   5e-77   
ref|XP_001774851.1|  predicted protein                                  246   6e-77   
ref|XP_009132156.1|  PREDICTED: casein kinase I isoform delta-like      249   7e-77   Brassica rapa
ref|XP_009126906.1|  PREDICTED: casein kinase I isoform delta-lik...    248   1e-76   
emb|CDY20695.1|  BnaA02g08350D                                          248   1e-76   Brassica napus [oilseed rape]
emb|CDY32908.1|  BnaC02g11920D                                          248   1e-76   Brassica napus [oilseed rape]
ref|XP_009126905.1|  PREDICTED: casein kinase I isoform delta-lik...    248   2e-76   Brassica rapa
ref|XP_007201986.1|  hypothetical protein PRUPE_ppa004932mg             248   5e-76   
ref|XP_003057018.1|  predicted protein                                  242   7e-76   Micromonas pusilla CCMP1545
ref|XP_001416096.1|  predicted protein                                  240   2e-75   Ostreococcus lucimarinus CCE9901
ref|XP_002455818.1|  hypothetical protein SORBIDRAFT_03g025700          245   5e-75   Sorghum bicolor [broomcorn]
ref|XP_002502415.1|  predicted protein                                  242   7e-75   Micromonas commoda
emb|CDY38255.1|  BnaA10g11030D                                          243   9e-75   Brassica napus [oilseed rape]
ref|XP_009120217.1|  PREDICTED: casein kinase I isoform delta-like      243   1e-74   Brassica rapa
gb|KFK40308.1|  hypothetical protein AALP_AA3G358100                    243   1e-74   Arabis alpina [alpine rockcress]
emb|CEG01144.1|  Serine/threonine-protein kinase, active site           241   2e-74   Ostreococcus tauri
ref|NP_179537.1|  casein kinase I-like 5                                242   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883988.1|  hypothetical protein ARALYDRAFT_899935             242   3e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_003595230.1|  Casein kinase I isoform delta-like protein         243   3e-74   Medicago truncatula
emb|CDY54387.1|  BnaC09g53710D                                          241   8e-74   Brassica napus [oilseed rape]
ref|XP_009112605.1|  PREDICTED: casein kinase I isoform delta-like      240   1e-73   Brassica rapa
ref|XP_005837939.1|  hypothetical protein GUITHDRAFT_92876              236   1e-73   Guillardia theta CCMP2712
ref|XP_002981109.1|  hypothetical protein SELMODRAFT_113824             238   4e-73   
ref|XP_002982581.1|  hypothetical protein SELMODRAFT_116791             237   5e-73   
ref|XP_009768908.1|  PREDICTED: casein kinase I isoform delta-like      230   7e-73   Nicotiana sylvestris
ref|XP_010415390.1|  PREDICTED: casein kinase I-like                    238   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010489492.1|  PREDICTED: casein kinase I-like                    238   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010467893.1|  PREDICTED: casein kinase I-like                    238   1e-72   Camelina sativa [gold-of-pleasure]
ref|XP_006409051.1|  hypothetical protein EUTSA_v10022691mg             235   2e-72   
gb|KIZ00217.1|  Casein kinase I isoform delta                           235   3e-72   Monoraphidium neglectum
ref|XP_006296706.1|  hypothetical protein CARUB_v10013750mg             237   3e-72   Capsella rubella
ref|XP_006409052.1|  hypothetical protein EUTSA_v10022691mg             236   5e-72   
ref|XP_005651142.1|  ser/thr kinase                                     233   5e-72   Coccomyxa subellipsoidea C-169
ref|XP_004513434.1|  PREDICTED: casein kinase I isoform delta-like      236   2e-71   Cicer arietinum [garbanzo]
ref|XP_007513942.1|  predicted protein                                  234   2e-71   Bathycoccus prasinos
ref|XP_001693999.1|  ser/thr kinase                                     230   1e-70   Chlamydomonas reinhardtii
gb|KDO53216.1|  hypothetical protein CISIN_1g011819mg                   233   2e-70   Citrus sinensis [apfelsine]
ref|XP_002956390.1|  serine/threonine kinase                            229   2e-70   Volvox carteri f. nagariensis
ref|XP_002184539.1|  predicted protein                                  228   3e-70   Phaeodactylum tricornutum CCAP 1055/1
gb|EDM06923.1|  casein kinase 1, delta, isoform CRA_f                   222   7e-70   Rattus norvegicus [brown rat]
ref|XP_005844274.1|  hypothetical protein CHLNCDRAFT_32696              228   7e-70   Chlorella variabilis
ref|XP_006286829.1|  hypothetical protein CARUB_v10003777mg             227   8e-70   
ref|XP_010526388.1|  PREDICTED: casein kinase I                         230   8e-70   Tarenaya hassleriana [spider flower]
ref|XP_002295127.1|  hypothetical protein THAPSDRAFT_14638              226   1e-69   Thalassiosira pseudonana CCMP1335
gb|EMS68429.1|  ATP-dependent zinc metalloprotease FTSH 5, mitoch...    240   1e-69   Triticum urartu
emb|CDW71339.1|  casein kinase                                          226   2e-69   Stylonychia lemnae
ref|XP_011397037.1|  Casein kinase I isoform delta-like protein         228   2e-69   Auxenochlorella protothecoides
gb|KFV53203.1|  Casein kinase I isoform epsilon                         222   1e-68   Gavia stellata
ref|XP_002182304.1|  predicted protein                                  227   2e-68   Phaeodactylum tricornutum CCAP 1055/1
emb|CBJ25928.1|  Casein kinase (serine/threonine/tyrosine protein...    229   2e-68   Ectocarpus siliculosus
ref|XP_009809825.1|  PREDICTED: casein kinase I isoform epsilon-like    222   2e-68   Gavia stellata
gb|EJK46125.1|  hypothetical protein THAOC_35228                        228   2e-68   Thalassiosira oceanica
ref|XP_005681126.1|  PREDICTED: casein kinase I isoform epsilon-l...    221   3e-68   
ref|XP_002872415.1|  predicted protein                                  222   5e-68   Arabidopsis lyrata subsp. lyrata
ref|XP_002687979.1|  PREDICTED: casein kinase I isoform delta           221   5e-68   
emb|CDS03428.1|  Putative Casein kinase I                               225   6e-68   
gb|EYU32565.1|  hypothetical protein MIMGU_mgv1a0129212mg               216   9e-68   
gb|AII16522.1|  casein kinase I epsilon                                 221   1e-67   
ref|XP_009250468.1|  PREDICTED: casein kinase I isoform delta iso...    221   1e-67   
gb|ABV21579.1|  casein kinase I delta                                   221   1e-67   
ref|XP_002964626.1|  hypothetical protein SELMODRAFT_81432              221   2e-67   
ref|XP_007908489.1|  PREDICTED: casein kinase I isoform epsilon         224   2e-67   
pdb|3UYS|A  Chain A, Crystal Structure Of Apo Human Ck1d                220   2e-67   
gb|AAB47968.1|  dual specificity kinase 1                               221   2e-67   
pdb|4JJR|A  Chain A, A P21 Crystal Form Of Mammalian Casein Kinas...    220   2e-67   
tpg|DAA29136.1|  TPA: casein kinase 1 epsilon                           221   2e-67   
ref|XP_008565111.1|  PREDICTED: casein kinase I isoform epsilon i...    221   2e-67   
pdb|4HNI|A  Chain A, Crystal Structure Of Ck1e In Complex With Pf...    220   2e-67   
pdb|1CKJ|A  Chain A, Casein Kinase I Delta Truncation Mutant Cont...    221   2e-67   
ref|XP_003772355.1|  PREDICTED: casein kinase I isoform epsilon         223   3e-67   
ref|XP_002125832.2|  PREDICTED: casein kinase I isoform delta-like      231   3e-67   
ref|XP_010729078.1|  PREDICTED: casein kinase I isoform epsilon-like    223   3e-67   
ref|XP_009663624.1|  PREDICTED: casein kinase I isoform epsilon         223   3e-67   
ref|XP_008295008.1|  PREDICTED: casein kinase I isoform epsilon-like    223   3e-67   
ref|XP_008312966.1|  PREDICTED: casein kinase I isoform epsilon-like    223   3e-67   
ref|XP_002768537.1|  Casein kinase I, putative                          220   4e-67   
ref|XP_003961565.1|  PREDICTED: casein kinase I isoform epsilon-like    223   4e-67   
ref|XP_001113761.1|  PREDICTED: casein kinase I isoform delta-like      220   4e-67   
ref|XP_005448080.1|  PREDICTED: casein kinase I isoform epsilon-l...    223   4e-67   
ref|XP_006305308.1|  hypothetical protein CARUB_v10009684mg             221   4e-67   
ref|NP_001084228.1|  casein kinase 1, epsilon                           223   4e-67   
ref|XP_009060168.1|  hypothetical protein LOTGIDRAFT_205749             220   4e-67   
gb|AAH44700.1|  CkIdelta protein                                        221   4e-67   
ref|XP_010843406.1|  PREDICTED: casein kinase I isoform epsilon i...    219   5e-67   
ref|XP_004071842.1|  PREDICTED: casein kinase I isoform epsilon i...    223   5e-67   
ref|XP_008460652.1|  PREDICTED: casein kinase I-like isoform X2         222   5e-67   
ref|XP_005016001.1|  PREDICTED: casein kinase I isoform epsilon         223   5e-67   
ref|XP_002989516.1|  hypothetical protein SELMODRAFT_235810             220   5e-67   
ref|XP_008494331.1|  PREDICTED: casein kinase I isoform epsilon         223   5e-67   
ref|XP_006807372.1|  PREDICTED: casein kinase I isoform epsilon-l...    223   5e-67   
gb|ETE72828.1|  Casein kinase I isoform epsilon                         223   5e-67   
ref|NP_001011137.1|  casein kinase I isoform epsilon                    223   5e-67   
gb|AAP87440.1|  casein kinase 1 epsilon                                 223   5e-67   
ref|XP_010895021.1|  PREDICTED: casein kinase I isoform epsilon         223   5e-67   
ref|XP_007069158.1|  PREDICTED: casein kinase I isoform epsilon         223   5e-67   
ref|XP_001746525.1|  hypothetical protein                               220   5e-67   
ref|XP_005302552.1|  PREDICTED: LOW QUALITY PROTEIN: casein kinas...    223   5e-67   
ref|XP_011476808.1|  PREDICTED: casein kinase I isoform epsilon i...    223   5e-67   
ref|XP_005011618.1|  PREDICTED: casein kinase I isoform delta iso...    221   5e-67   
ref|XP_008434487.1|  PREDICTED: casein kinase I isoform epsilon-l...    223   5e-67   
ref|XP_010222459.1|  PREDICTED: casein kinase I isoform epsilon         223   5e-67   
ref|XP_007540216.1|  PREDICTED: casein kinase I isoform epsilon-l...    223   5e-67   
ref|XP_009981374.1|  PREDICTED: casein kinase I isoform epsilon         223   5e-67   
ref|XP_004695572.1|  PREDICTED: casein kinase I isoform delta           220   5e-67   
ref|XP_009900790.1|  PREDICTED: casein kinase I isoform epsilon         223   6e-67   
ref|XP_008413765.1|  PREDICTED: casein kinase I isoform epsilon         223   6e-67   
ref|XP_006029915.1|  PREDICTED: casein kinase I isoform epsilon i...    223   6e-67   
ref|XP_003227197.1|  PREDICTED: casein kinase I isoform epsilon         223   6e-67   
ref|XP_007560283.1|  PREDICTED: casein kinase I isoform epsilon         223   6e-67   
ref|XP_005816998.1|  PREDICTED: casein kinase I isoform epsilon-like    223   6e-67   
ref|XP_009330923.1|  PREDICTED: casein kinase I isoform epsilon         223   6e-67   
ref|XP_006029917.1|  PREDICTED: casein kinase I isoform epsilon i...    223   6e-67   
emb|CAF90192.1|  unnamed protein product                                223   6e-67   
gb|AAP47012.1|  casein kinase I epsilon                                 223   6e-67   
ref|XP_009566715.1|  PREDICTED: casein kinase I isoform epsilon         223   6e-67   
ref|XP_003964448.1|  PREDICTED: casein kinase I isoform epsilon-like    223   6e-67   
ref|XP_008071348.1|  PREDICTED: casein kinase I isoform epsilon i...    219   6e-67   
ref|XP_007540214.1|  PREDICTED: casein kinase I isoform epsilon-l...    223   6e-67   
ref|XP_004563122.1|  PREDICTED: casein kinase I isoform epsilon-like    223   6e-67   
ref|XP_005803388.1|  PREDICTED: casein kinase I isoform epsilon-like    223   6e-67   
ref|XP_005737991.1|  PREDICTED: casein kinase I isoform epsilon-like    223   6e-67   
ref|XP_003443159.1|  PREDICTED: casein kinase I isoform epsilon-like    223   6e-67   
ref|XP_005039794.1|  PREDICTED: casein kinase I isoform epsilon i...    223   6e-67   
ref|XP_008328512.1|  PREDICTED: casein kinase I isoform epsilon         223   6e-67   
ref|XP_010308309.1|  PREDICTED: casein kinase I isoform epsilon         223   6e-67   
ref|XP_010291439.1|  PREDICTED: casein kinase I isoform epsilon         223   6e-67   
ref|XP_008294592.1|  PREDICTED: casein kinase I isoform epsilon         223   6e-67   
ref|XP_003964352.1|  PREDICTED: casein kinase I isoform delta-B-like    219   7e-67   
ref|XP_007111788.1|  PREDICTED: casein kinase I isoform epsilon i...    219   7e-67   
ref|XP_010086106.1|  PREDICTED: LOW QUALITY PROTEIN: casein kinas...    223   7e-67   
ref|XP_010566423.1|  PREDICTED: casein kinase I isoform delta iso...    221   7e-67   
ref|XP_008434486.1|  PREDICTED: casein kinase I isoform epsilon-l...    223   7e-67   
ref|XP_009484649.1|  PREDICTED: casein kinase I isoform epsilon         223   7e-67   
ref|XP_010129331.1|  PREDICTED: casein kinase I isoform epsilon         223   7e-67   
ref|XP_008939813.1|  PREDICTED: casein kinase I isoform epsilon         223   7e-67   
ref|XP_010408882.1|  PREDICTED: casein kinase I isoform epsilon         223   7e-67   
ref|NP_989708.3|  casein kinase I isoform epsilon                       222   7e-67   
ref|XP_006119016.1|  PREDICTED: casein kinase I isoform epsilon i...    223   7e-67   
emb|CDH48632.1|  casein kinase i                                        222   7e-67   
ref|XP_010906780.1|  PREDICTED: casein kinase I-like isoform X3         222   8e-67   
ref|XP_010001904.1|  PREDICTED: casein kinase I isoform epsilon         222   8e-67   
ref|XP_010746310.1|  PREDICTED: casein kinase I isoform epsilon         222   8e-67   
ref|XP_009436674.1|  PREDICTED: casein kinase I isoform epsilon i...    220   9e-67   
ref|XP_005934455.1|  PREDICTED: casein kinase I isoform epsilon-l...    222   9e-67   
ref|XP_006886186.1|  PREDICTED: casein kinase I isoform delta iso...    223   9e-67   
emb|CDQ75112.1|  unnamed protein product                                222   9e-67   
ref|XP_008438506.1|  PREDICTED: casein kinase I isoform delta-lik...    220   1e-66   
ref|XP_004557609.1|  PREDICTED: casein kinase I isoform epsilon-l...    222   1e-66   
ref|XP_004861085.1|  PREDICTED: casein kinase I isoform delta iso...    222   1e-66   
ref|XP_003589958.1|  Casein kinase I isoform delta-like protein         218   1e-66   
ref|XP_007189109.1|  PREDICTED: casein kinase I isoform epsilon i...    222   1e-66   
gb|EFB26732.1|  hypothetical protein PANDA_002512                       222   1e-66   
ref|XP_006869543.1|  PREDICTED: casein kinase I isoform delta iso...    222   1e-66   
ref|XP_004621117.1|  PREDICTED: casein kinase I isoform delta iso...    222   1e-66   
ref|XP_004404515.1|  PREDICTED: casein kinase I isoform delta           222   1e-66   
gb|KJB09990.1|  hypothetical protein B456_001G179300                    218   1e-66   
ref|XP_008565109.1|  PREDICTED: casein kinase I isoform epsilon i...    222   1e-66   
ref|XP_008826343.1|  PREDICTED: casein kinase I isoform delta iso...    222   1e-66   
ref|XP_006102486.1|  PREDICTED: casein kinase I isoform epsilon i...    222   1e-66   
gb|EWM23331.1|  Protein kinase, ATP binding site                        221   1e-66   
ref|XP_010893852.1|  PREDICTED: casein kinase I isoform epsilon-like    222   1e-66   
ref|XP_008959351.1|  PREDICTED: casein kinase I isoform delta iso...    221   1e-66   
ref|XP_006886187.1|  PREDICTED: casein kinase I isoform delta iso...    222   1e-66   
ref|NP_113805.1|  casein kinase I isoform epsilon                       222   1e-66   
gb|EDL04651.1|  casein kinase 1, epsilon, isoform CRA_b                 222   1e-66   
emb|CDQ75971.1|  unnamed protein product                                222   1e-66   
ref|NP_001268517.1|  casein kinase 1, epsilon                           222   1e-66   
ref|XP_004466285.1|  PREDICTED: casein kinase I isoform epsilon i...    222   1e-66   
ref|XP_003428756.1|  PREDICTED: LOW QUALITY PROTEIN: casein kinas...    222   1e-66   
ref|XP_008460651.1|  PREDICTED: casein kinase I-like isoform X1         223   1e-66   
ref|XP_008849484.1|  PREDICTED: casein kinase I isoform epsilon i...    222   1e-66   
ref|XP_004279531.1|  PREDICTED: casein kinase I isoform epsilon         222   1e-66   
ref|XP_011217131.1|  PREDICTED: casein kinase I isoform epsilon i...    222   1e-66   
ref|XP_004147150.1|  PREDICTED: casein kinase I isoform delta-like      223   1e-66   
ref|XP_007454085.1|  PREDICTED: casein kinase I isoform epsilon i...    222   1e-66   
ref|XP_004743291.1|  PREDICTED: casein kinase I isoform epsilon i...    222   1e-66   
ref|XP_009277679.1|  PREDICTED: casein kinase I isoform delta iso...    220   1e-66   
ref|XP_011371958.1|  PREDICTED: casein kinase I isoform delta iso...    222   1e-66   
ref|XP_004410828.1|  PREDICTED: casein kinase I isoform epsilon         222   1e-66   
gb|KIY99580.1|  hypothetical protein MNEG_8384                          223   1e-66   
ref|XP_850168.1|  PREDICTED: casein kinase I isoform epsilon isof...    222   1e-66   
ref|XP_006979210.1|  PREDICTED: casein kinase I isoform epsilon         222   1e-66   
ref|XP_006890186.1|  PREDICTED: casein kinase I isoform epsilon         222   1e-66   
ref|XP_004700308.1|  PREDICTED: casein kinase I isoform epsilon         222   1e-66   
ref|XP_003419814.1|  PREDICTED: casein kinase I isoform epsilon         222   1e-66   
pdb|4TW9|A  Chain A, Difluoro-dioxolo-benzoimidazol-benzamides As...    218   1e-66   
ref|XP_006865250.1|  PREDICTED: casein kinase I isoform epsilon i...    222   1e-66   
ref|NP_955877.1|  casein kinase I isoform delta-A                       221   1e-66   
ref|XP_004883528.1|  PREDICTED: casein kinase I isoform epsilon i...    222   1e-66   
ref|XP_003470539.1|  PREDICTED: casein kinase I isoform epsilon i...    222   1e-66   
ref|NP_038795.3|  casein kinase I isoform epsilon isoform a             221   1e-66   
ref|XP_004437909.1|  PREDICTED: casein kinase I isoform epsilon         221   1e-66   
gb|AAX42423.1|  casein kinase 1 delta                                   221   1e-66   
ref|NP_620690.1|  casein kinase I isoform delta isoform 1               221   1e-66   
ref|XP_008565108.1|  PREDICTED: casein kinase I isoform epsilon i...    221   1e-66   
gb|AAQ02477.1|  casein kinase 1, delta                                  221   1e-66   
ref|XP_006886188.1|  PREDICTED: casein kinase I isoform delta iso...    221   1e-66   
ref|XP_007939854.1|  PREDICTED: casein kinase I isoform epsilon         221   1e-66   
ref|XP_008071336.1|  PREDICTED: casein kinase I isoform epsilon i...    221   1e-66   
ref|XP_011282520.1|  PREDICTED: casein kinase I isoform epsilon i...    221   1e-66   
dbj|BAD97218.1|  casein kinase 1 epsilon variant                        221   1e-66   
ref|XP_007524517.1|  PREDICTED: casein kinase I isoform delta iso...    222   1e-66   
ref|NP_001884.2|  casein kinase I isoform delta isoform 1               221   1e-66   
ref|XP_007519381.1|  PREDICTED: casein kinase I isoform epsilon i...    221   2e-66   
ref|XP_005322313.1|  PREDICTED: casein kinase I isoform epsilon         221   2e-66   
ref|XP_005955737.1|  PREDICTED: casein kinase I isoform epsilon         223   2e-66   
ref|XP_008826333.1|  PREDICTED: casein kinase I isoform delta iso...    222   2e-66   
ref|XP_009436666.1|  PREDICTED: casein kinase I isoform epsilon i...    221   2e-66   
ref|XP_004650366.1|  PREDICTED: casein kinase I isoform epsilon         221   2e-66   
ref|XP_010611312.1|  PREDICTED: casein kinase I isoform epsilon i...    220   2e-66   
ref|XP_005407267.1|  PREDICTED: casein kinase I isoform delta iso...    222   2e-66   
gb|ELK10231.1|  Casein kinase I isoform epsilon                         222   2e-66   
ref|NP_001885.1|  casein kinase I isoform epsilon                       221   2e-66   
ref|XP_004675720.1|  PREDICTED: casein kinase I isoform epsilon         221   2e-66   
emb|CAG31382.1|  hypothetical protein RCJMB04_5k10                      221   2e-66   
emb|CDQ74366.1|  unnamed protein product                                221   2e-66   
ref|XP_004463738.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
ref|XP_003126072.1|  PREDICTED: casein kinase I isoform epsilon i...    221   2e-66   
ref|XP_005256394.1|  PREDICTED: casein kinase I isoform delta iso...    222   2e-66   
ref|XP_006155415.1|  PREDICTED: casein kinase I isoform epsilon i...    221   2e-66   
ref|XP_005350963.1|  PREDICTED: casein kinase I isoform delta iso...    222   2e-66   
gb|AAC50807.1|  casein kinase I delta                                   221   2e-66   
ref|NP_563695.2|  dual specificity kinase 1                             223   2e-66   
ref|XP_008255269.1|  PREDICTED: casein kinase I isoform epsilon i...    221   2e-66   
ref|XP_004463736.1|  PREDICTED: casein kinase I isoform delta iso...    222   2e-66   
ref|XP_003783254.1|  PREDICTED: casein kinase I isoform epsilon         221   2e-66   
ref|XP_010814770.1|  PREDICTED: casein kinase I isoform delta iso...    222   2e-66   
ref|NP_620693.1|  casein kinase I isoform delta isoform 2               221   2e-66   
ref|XP_004432942.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
ref|XP_007454086.1|  PREDICTED: casein kinase I isoform epsilon i...    221   2e-66   
ref|XP_006869542.1|  PREDICTED: casein kinase I isoform delta iso...    222   2e-66   
ref|XP_004743290.1|  PREDICTED: casein kinase I isoform epsilon i...    221   2e-66   
ref|XP_004432941.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
ref|XP_008826352.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
ref|XP_005003901.1|  PREDICTED: casein kinase I isoform epsilon i...    221   2e-66   
ref|XP_004655097.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
gb|EFX89962.1|  hypothetical protein DAPPUDRAFT_232195                  220   2e-66   
ref|XP_011371959.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
ref|NP_082150.1|  casein kinase I isoform delta isoform 2               221   2e-66   
ref|XP_005768399.1|  hypothetical protein EMIHUDRAFT_356218             218   2e-66   
ref|XP_007189103.1|  PREDICTED: casein kinase I isoform epsilon i...    220   2e-66   
gb|AAQ02559.1|  casein kinase 1, epsilon                                221   2e-66   
ref|XP_004463737.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
ref|XP_007111787.1|  PREDICTED: casein kinase I isoform epsilon i...    220   2e-66   
ref|XP_004861084.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
ref|XP_008011540.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
ref|XP_007957746.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
ref|XP_006987703.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
ref|XP_010341772.1|  PREDICTED: casein kinase I isoform epsilon i...    221   2e-66   
gb|KHG21090.1|  hypothetical protein F383_27358                         222   2e-66   
ref|XP_010958610.1|  PREDICTED: LOW QUALITY PROTEIN: casein kinas...    221   2e-66   
ref|XP_007462355.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
ref|XP_008996204.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
ref|NP_001270905.1|  uncharacterized protein LOC101926774               221   2e-66   
ref|NP_001133856.1|  Casein kinase I isoform epsilon                    221   2e-66   
dbj|BAB23405.1|  unnamed protein product                                221   2e-66   
ref|XP_010903971.1|  PREDICTED: casein kinase I isoform delta-B-like    221   2e-66   
gb|KJB42310.1|  hypothetical protein B456_007G147800                    222   2e-66   
ref|XP_010993806.1|  PREDICTED: casein kinase I isoform delta           221   2e-66   
gb|ABV71923.1|  casein kinase I epsilon                                 221   2e-66   
sp|Q5BP74.2|KC1D_XENLA  RecName: Full=Casein kinase I isoform del...    221   2e-66   
ref|XP_008255271.1|  PREDICTED: casein kinase I isoform epsilon i...    220   2e-66   
ref|XP_005164045.1|  PREDICTED: casein kinase I isoform delta-A i...    221   2e-66   
ref|XP_010749361.1|  PREDICTED: casein kinase I isoform delta-like      221   2e-66   
ref|XP_006636954.1|  PREDICTED: casein kinase I homolog 1-like          223   2e-66   
ref|XP_001845143.1|  discs overgrown protein kinase                     221   2e-66   
ref|XP_008413305.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
ref|XP_005001536.1|  PREDICTED: casein kinase I isoform delta iso...    221   2e-66   
ref|XP_007111786.1|  PREDICTED: casein kinase I isoform epsilon i...    221   2e-66   
ref|XP_008849485.1|  PREDICTED: casein kinase I isoform epsilon i...    219   2e-66   
ref|XP_006071407.1|  PREDICTED: casein kinase I isoform epsilon i...    219   2e-66   
ref|XP_005655567.1|  PREDICTED: casein kinase I isoform epsilon i...    219   2e-66   
ref|XP_004743292.1|  PREDICTED: casein kinase I isoform epsilon i...    219   2e-66   
ref|XP_010843405.1|  PREDICTED: casein kinase I isoform epsilon i...    219   2e-66   
ref|XP_004589562.1|  PREDICTED: casein kinase I isoform epsilon         221   2e-66   



>gb|AFK44603.1| unknown [Lotus japonicus]
Length=158

 Score =   265 bits (678),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|AFW83711.1| putative casein kinase family protein [Zea mays]
Length=163

 Score =   265 bits (677),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_008656801.1| PREDICTED: casein kinase I isoform delta-like [Zea mays]
 gb|AFW83712.1| putative casein kinase family protein [Zea mays]
Length=172

 Score =   264 bits (675),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|NP_001168804.1| uncharacterized protein LOC100382605 [Zea mays]
 gb|ACN30740.1| unknown [Zea mays]
Length=208

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|EYU28389.1| hypothetical protein MIMGU_mgv1a007204mg [Erythranthe guttata]
Length=415

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_011078008.1| PREDICTED: casein kinase I isoform delta-like [Sesamum indicum]
Length=474

 Score =   271 bits (692),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>emb|CDP03143.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   271 bits (692),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009764702.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana sylvestris]
Length=471

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>dbj|BAD45136.1| putative protein kinase ADK1 [Oryza sativa Japonica Group]
Length=228

 Score =   261 bits (667),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KJB83052.1| hypothetical protein B456_013G227100 [Gossypium raimondii]
Length=310

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNV+VMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVMVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +F+MGLG
Sbjct  121  SKSFLHRDIKPDNFIMGLG  139



>ref|XP_004507951.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Cicer 
arietinum]
Length=454

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_003542336.1| PREDICTED: casein kinase I isoform delta-like isoform 1 [Glycine 
max]
 gb|KHN06627.1| Casein kinase I isoform delta-like [Glycine soja]
Length=454

 Score =   268 bits (686),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_004507950.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Cicer 
arietinum]
Length=471

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KEH32501.1| casein kinase I-like protein [Medicago truncatula]
Length=454

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KDP33855.1| hypothetical protein JCGZ_07426 [Jatropha curcas]
Length=477

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_010696534.1| PREDICTED: casein kinase I isoform delta-like [Beta vulgaris 
subsp. vulgaris]
 gb|ABM55249.1| casein kinase [Beta vulgaris]
Length=473

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRK SLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KDO53222.1| hypothetical protein CISIN_1g011819mg [Citrus sinensis]
Length=407

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KJB54402.1| hypothetical protein B456_009G032600 [Gossypium raimondii]
Length=311

 Score =   263 bits (673),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>gb|EAY75552.1| hypothetical protein OsI_03457 [Oryza sativa Indica Group]
Length=472

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_003549210.1| PREDICTED: casein kinase I isoform delta-like isoform 1 [Glycine 
max]
Length=454

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KJB83051.1| hypothetical protein B456_013G227100 [Gossypium raimondii]
Length=335

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNV+VMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVMVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +F+MGLG
Sbjct  121  SKSFLHRDIKPDNFIMGLG  139



>ref|XP_006597822.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Glycine 
max]
Length=312

 Score =   263 bits (673),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIP+VRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPDVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>pdb|3SV0|A Chain A, Crystal Structure Of Casein Kinase-1 Like Protein In 
Plant
Length=483

 Score =   269 bits (687),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_006644592.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Oryza 
brachyantha]
Length=387

 Score =   266 bits (679),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_002456234.1| hypothetical protein SORBIDRAFT_03g032560 [Sorghum bicolor]
 gb|EES01354.1| hypothetical protein SORBIDRAFT_03g032560 [Sorghum bicolor]
Length=470

 Score =   268 bits (686),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_007154635.1| hypothetical protein PHAVU_003G135100g [Phaseolus vulgaris]
 gb|ESW26629.1| hypothetical protein PHAVU_003G135100g [Phaseolus vulgaris]
Length=455

 Score =   268 bits (684),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_006451505.1| hypothetical protein CICLE_v10008160mg [Citrus clementina]
 ref|XP_006475484.1| PREDICTED: casein kinase I isoform delta-like [Citrus sinensis]
 gb|ESR64745.1| hypothetical protein CICLE_v10008160mg [Citrus clementina]
 gb|KDO53217.1| hypothetical protein CISIN_1g011819mg [Citrus sinensis]
Length=477

 Score =   268 bits (686),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_002309212.1| casein kinase family protein [Populus trichocarpa]
 gb|EEE92735.1| casein kinase family protein [Populus trichocarpa]
Length=475

 Score =   268 bits (686),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_010924973.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Elaeis 
guineensis]
Length=397

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNAQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|EMT18264.1| Casein kinase I isoform delta-like protein [Aegilops tauschii]
Length=472

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>dbj|BAB92346.1| casein kinase I-like [Oryza sativa Japonica Group]
Length=472

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_007024533.1| Casein kinase 1-like protein 2 [Theobroma cacao]
 gb|EOY27155.1| Casein kinase 1-like protein 2 [Theobroma cacao]
Length=477

 Score =   268 bits (686),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_011003341.1| PREDICTED: casein kinase I isoform delta-like [Populus euphratica]
Length=475

 Score =   268 bits (685),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_004157925.1| PREDICTED: casein kinase I isoform delta-like [Cucumis sativus]
Length=480

 Score =   268 bits (686),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>emb|CDM83770.1| unnamed protein product [Triticum aestivum]
Length=472

 Score =   268 bits (685),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|EAZ13276.1| hypothetical protein OsJ_03201 [Oryza sativa Japonica Group]
Length=472

 Score =   268 bits (685),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_006644591.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Oryza 
brachyantha]
Length=472

 Score =   268 bits (685),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_004141059.1| PREDICTED: casein kinase I isoform delta-like [Cucumis sativus]
 gb|KGN60529.1| hypothetical protein Csa_2G000380 [Cucumis sativus]
Length=479

 Score =   268 bits (685),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_004287578.1| PREDICTED: casein kinase I isoform delta-like [Fragaria vesca 
subsp. vesca]
Length=471

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGN++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_008459457.1| PREDICTED: casein kinase I isoform delta-like [Cucumis melo]
Length=477

 Score =   268 bits (685),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KDP40745.1| hypothetical protein JCGZ_24744 [Jatropha curcas]
Length=472

 Score =   268 bits (684),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009597979.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana tomentosiformis]
Length=471

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGIPNVRWFGVEGNYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>emb|CCM43976.1| Caesin kinase I isoform delta like protein [Cucumis sativus]
Length=479

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_004969708.1| PREDICTED: casein kinase I isoform delta-like [Setaria italica]
Length=471

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_010232213.1| PREDICTED: casein kinase I-like [Brachypodium distachyon]
Length=471

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESK+YRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKIYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KJB54401.1| hypothetical protein B456_009G032600 [Gossypium raimondii]
Length=418

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_002521378.1| casein kinase, putative [Ricinus communis]
 gb|EEF41046.1| casein kinase, putative [Ricinus communis]
Length=472

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_007012783.1| Casein kinase 1-like protein 2 isoform 1 [Theobroma cacao]
 gb|EOY30402.1| Casein kinase 1-like protein 2 isoform 1 [Theobroma cacao]
Length=470

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGAEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009410794.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009395821.1| PREDICTED: casein kinase I-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +F+MGLG
Sbjct  121  SKSFLHRDIKPDNFIMGLG  139



>ref|XP_007012784.1| Casein kinase 1 isoform 2 [Theobroma cacao]
 gb|EOY30403.1| Casein kinase 1 isoform 2 [Theobroma cacao]
Length=463

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGAEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_008242376.1| PREDICTED: casein kinase I isoform delta-like [Prunus mume]
Length=470

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M  RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMISRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  AKSFLHRDIKPDNFLMGLG  139



>ref|XP_010924972.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Elaeis 
guineensis]
Length=476

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNAQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KHG23724.1| hypothetical protein F383_04752 [Gossypium arboreum]
Length=465

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNV+VMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVMVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +F+MGLG
Sbjct  121  SKSFLHRDIKPDNFIMGLG  139



>gb|KJB83050.1| hypothetical protein B456_013G227100 [Gossypium raimondii]
Length=465

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNV+VMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVMVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +F+MGLG
Sbjct  121  SKSFLHRDIKPDNFIMGLG  139



>ref|XP_011013818.1| PREDICTED: casein kinase I isoform delta-like [Populus euphratica]
Length=474

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN+KTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENIKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_008806949.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008806957.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008806963.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008806971.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
Length=474

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNAQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_006371997.1| casein kinase family protein [Populus trichocarpa]
 gb|ERP49794.1| casein kinase family protein [Populus trichocarpa]
Length=475

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN+KTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENIKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KJB83053.1| hypothetical protein B456_013G227100 [Gossypium raimondii]
Length=444

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNV+VMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVMVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +F+MGLG
Sbjct  121  SKSFLHRDIKPDNFIMGLG  139



>gb|KHN28842.1| Casein kinase I isoform delta-like [Glycine soja]
Length=456

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIP+VRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPDVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_010262044.1| PREDICTED: casein kinase I isoform delta-like [Nelumbo nucifera]
Length=475

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_003546462.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Glycine 
max]
Length=456

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIP+VRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPDVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KJB54404.1| hypothetical protein B456_009G032600 [Gossypium raimondii]
Length=410

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_011079987.1| PREDICTED: casein kinase I-like [Sesamum indicum]
Length=461

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_002277513.2| PREDICTED: casein kinase I isoform delta-like [Vitis vinifera]
 emb|CBI35912.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KJB54403.1| hypothetical protein B456_009G032600 [Gossypium raimondii]
Length=460

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>gb|AFW79363.1| putative casein kinase family protein [Zea mays]
Length=146

 Score =   255 bits (651),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GN++R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNRFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVEF H
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009361635.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
Length=466

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRIL 
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILA  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M  RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMISRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KHG04851.1| hypothetical protein F383_30273 [Gossypium arboreum]
Length=467

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKY+LGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGNKYKLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEF H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFAH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KHG04850.1| hypothetical protein F383_30273 [Gossypium arboreum]
Length=480

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKY+LGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGNKYKLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEF H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFAH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009415492.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
Length=493

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN+KTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENIKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +F+MGLG
Sbjct  121  SKSFLHRDIKPDNFIMGLG  139



>ref|XP_004243748.1| PREDICTED: casein kinase I isoform delta-like [Solanum lycopersicum]
Length=472

 Score =   266 bits (679),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN KTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENNKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_008338713.1| PREDICTED: casein kinase I isoform alpha-like [Malus domestica]
Length=208

 Score =   257 bits (656),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG ++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  3    MEPRVGGRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  62

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNVRW+G EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  63   GGTGVPNVRWYGTEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  122

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  123  SKSFLHRDIKPDNFLMGLG  141



>ref|XP_008352372.1| PREDICTED: casein kinase I isoform delta-like [Malus domestica]
Length=459

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN KTKHPQLLYESKLYRIL 
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENAKTKHPQLLYESKLYRILS  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M  RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMISRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_008337722.1| PREDICTED: casein kinase I isoform delta-like [Malus domestica]
Length=459

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN KTKHPQLLYESKLYRIL 
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENAKTKHPQLLYESKLYRILS  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M  RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMISRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_010242267.1| PREDICTED: casein kinase I isoform delta-like [Nelumbo nucifera]
Length=476

 Score =   266 bits (679),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  AKSFLHRDIKPDNFLMGLG  139



>ref|XP_010925467.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010925468.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Elaeis 
guineensis]
Length=474

 Score =   265 bits (678),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +K FLHR+ +P +FLMGLG
Sbjct  121  AKYFLHRDIKPDNFLMGLG  139



>ref|XP_006357711.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum]
Length=472

 Score =   265 bits (678),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN KTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENNKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_010090074.1| Casein kinase I isoform delta-like protein [Morus notabilis]
 gb|EXB38871.1| Casein kinase I isoform delta-like protein [Morus notabilis]
Length=475

 Score =   265 bits (678),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG K+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGGKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_002281345.2| PREDICTED: casein kinase I isoform delta-like [Vitis vinifera]
 emb|CAN80417.1| hypothetical protein VITISV_024542 [Vitis vinifera]
 emb|CBI27888.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_006853888.1| hypothetical protein AMTR_s00036p00147120 [Amborella trichopoda]
 gb|ERN15355.1| hypothetical protein AMTR_s00036p00147120 [Amborella trichopoda]
Length=476

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SK FLHR+ +P +FLMGLG
Sbjct  121  SKCFLHRDIKPDNFLMGLG  139



>ref|XP_004239254.1| PREDICTED: casein kinase I isoform delta-like [Solanum lycopersicum]
Length=469

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    METRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRW+GVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGIPNVRWYGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_010925469.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Elaeis 
guineensis]
Length=470

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +K FLHR+ +P +FLMGLG
Sbjct  121  AKYFLHRDIKPDNFLMGLG  139



>ref|XP_010685356.1| PREDICTED: casein kinase I isoform delta-like [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLV+DLLGPSLEDLFNFCSRK SLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKFSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_006338113.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum]
Length=468

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    METRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRW+GVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGIPNVRWYGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_008813454.1| PREDICTED: casein kinase I isoform delta-like [Phoenix dactylifera]
Length=479

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN QTNEEV IKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNTQTNEEVGIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009606359.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana tomentosiformis]
Length=471

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNKYRLGRKIGSGSFGEIYLGTNIQTNEE+AIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MESRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEELAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KJB56939.1| hypothetical protein B456_009G142600 [Gossypium raimondii]
Length=475

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKY+LGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGNKYKLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFG+EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEF H
Sbjct  61   GGTGIPNVRWFGIEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFSH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_004151319.1| PREDICTED: casein kinase I isoform delta-like [Cucumis sativus]
 ref|XP_004154790.1| PREDICTED: casein kinase I isoform delta-like [Cucumis sativus]
 gb|KGN59801.1| hypothetical protein Csa_3G847620 [Cucumis sativus]
Length=471

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK++LGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFKLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|NP_001043372.1| Os01g0570500 [Oryza sativa Japonica Group]
 dbj|BAD45137.1| putative protein kinase ADK1 [Oryza sativa Japonica Group]
 dbj|BAF05286.1| Os01g0570500 [Oryza sativa Japonica Group]
 dbj|BAG99373.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54833.1| hypothetical protein OsJ_02280 [Oryza sativa Japonica Group]
Length=472

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>emb|CDO97889.1| unnamed protein product [Coffea canephora]
Length=467

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGI NVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGISNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|EEC70925.1| hypothetical protein OsI_02496 [Oryza sativa Indica Group]
Length=472

 Score =   264 bits (674),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KHG11372.1| hypothetical protein F383_02311 [Gossypium arboreum]
Length=459

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_008447619.1| PREDICTED: casein kinase I isoform delta-like [Cucumis melo]
Length=470

 Score =   264 bits (674),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK++LGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFKLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|EYU45867.1| hypothetical protein MIMGU_mgv1a005939mg [Erythranthe guttata]
Length=464

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCS KLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSSKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_010049456.1| PREDICTED: casein kinase I isoform delta-like [Eucalyptus grandis]
 gb|KCW82052.1| hypothetical protein EUGRSUZ_C03421 [Eucalyptus grandis]
Length=475

 Score =   263 bits (673),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +F+MGLG
Sbjct  121  SKSFLHRDIKPDNFVMGLG  139



>ref|XP_006342964.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum]
Length=471

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  AKSFLHRDIKPDNFLMGLG  139



>ref|XP_008793211.1| PREDICTED: casein kinase I isoform delta-like isoform X3 [Phoenix 
dactylifera]
Length=381

 Score =   260 bits (665),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVE DYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLM+A+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGVESDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMIADQMINRVEFLH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +K FLHR+ +P +FLMGLG
Sbjct  121  AKYFLHRDIKPDNFLMGLG  139



>ref|XP_004235583.1| PREDICTED: casein kinase I isoform delta-like [Solanum lycopersicum]
Length=470

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  AKSFLHRDIKPDNFLMGLG  139



>ref|XP_007138711.1| hypothetical protein PHAVU_009G230800g [Phaseolus vulgaris]
 gb|ESW10705.1| hypothetical protein PHAVU_009G230800g [Phaseolus vulgaris]
Length=456

 Score =   263 bits (671),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQ NEEVA+KLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQNNEEVAVKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIP+VRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPDVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  CKSFLHRDIKPDNFLMGLG  139



>gb|KHN35865.1| Casein kinase I isoform delta-like [Glycine soja]
Length=443

 Score =   261 bits (668),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNNQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIP+VRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPDVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGL  612
            SKSFLHR+ +P +FLMGL
Sbjct  121  SKSFLHRDIKPDNFLMGL  138



>ref|XP_006597037.1| PREDICTED: uncharacterized protein LOC100795570 isoform X1 [Glycine 
max]
Length=471

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRKIGSGSFGEIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVANKFRLGRKIGSGSFGEIYLGTNTQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFG+EGDYNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGIEGDYNVLVMDLLGPSLEDLFNFCTRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_002299898.2| hypothetical protein POPTR_0001s20450g [Populus trichocarpa]
 gb|EEE84703.2| hypothetical protein POPTR_0001s20450g [Populus trichocarpa]
Length=470

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLG NIQTNEEVAIKLENVKT+HPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGANIQTNEEVAIKLENVKTRHPQLLYESKLYKMLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KDO65165.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=404

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL YE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLQYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009409360.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
Length=470

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLG+N+Q+NEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGSNVQSNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFG+EGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE+VH
Sbjct  61   GGTGIPNVRWFGIEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KCW69786.1| hypothetical protein EUGRSUZ_F03150 [Eucalyptus grandis]
Length=359

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE VKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLETVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            G TGIPNVRWFG+EGDYNVLVMDLLGPSLEDLFNFCSRK SLKTVLMLA+ M +R+EFVH
Sbjct  61   GATGIPNVRWFGIEGDYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMMNRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_003533767.1| PREDICTED: casein kinase I isoform delta-like [Glycine max]
Length=456

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/138 (90%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNNQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIP+VRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPDVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGL  612
            SKSFLHR+ +P +FLMGL
Sbjct  121  SKSFLHRDIKPDNFLMGL  138



>gb|KHN30066.1| Casein kinase I isoform delta-like [Glycine soja]
Length=472

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRKIGSGSFGEIYLGTN QTNEEVA+KLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVANKFRLGRKIGSGSFGEIYLGTNTQTNEEVAVKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCTRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_003543581.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Glycine 
max]
 ref|XP_006595083.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Glycine 
max]
Length=472

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRKIGSGSFGEIYLGTN QTNEEVA+KLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVANKFRLGRKIGSGSFGEIYLGTNTQTNEEVAVKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCTRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_002864491.1| hypothetical protein ARALYDRAFT_918863 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40750.1| hypothetical protein ARALYDRAFT_918863 [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_011009743.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Populus 
euphratica]
Length=398

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKT+HPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTRHPQLLYESKLYKMLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCNRKLSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|EYU21357.1| hypothetical protein MIMGU_mgv1a023567mg, partial [Erythranthe 
guttata]
Length=319

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL+YESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLVYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDL NFCSRKLSLKTVLMLAE M +RVE++H
Sbjct  61   GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLSNFCSRKLSLKTVLMLAEQMINRVEYIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|EPS64220.1| hypothetical protein M569_10560 [Genlisea aurea]
Length=444

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIP VRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGIPGVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_011009742.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Populus 
euphratica]
Length=464

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKT+HPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTRHPQLLYESKLYKMLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCNRKLSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_010909190.1| PREDICTED: casein kinase I isoform delta-like [Elaeis guineensis]
Length=479

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRK+GSGSFGEIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKVGSGSFGEIYLGTNTQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGI NVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGILNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|EEC79796.1| hypothetical protein OsI_21224 [Oryza sativa Indica Group]
Length=473

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNKFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_010474302.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=196

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLG+KIG GSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGKKIGGGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  QKSFLHRDIKPDNFLMGLG  139



>ref|NP_001056503.1| Os05g0593800 [Oryza sativa Japonica Group]
 gb|AAT44307.1| putative protein kinase ADK1 [Oryza sativa Japonica Group]
 dbj|BAF18417.1| Os05g0593800 [Oryza sativa Japonica Group]
 dbj|BAG99503.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64906.1| hypothetical protein OsJ_19766 [Oryza sativa Japonica Group]
Length=473

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNKFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_006465998.1| PREDICTED: casein kinase I isoform delta-like [Citrus sinensis]
 gb|KDO65157.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=474

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL YE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLQYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_008228258.1| PREDICTED: casein kinase I isoform delta-like [Prunus mume]
Length=475

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG ++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGGRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGTEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_007217223.1| hypothetical protein PRUPE_ppa005139mg [Prunus persica]
 gb|EMJ18422.1| hypothetical protein PRUPE_ppa005139mg [Prunus persica]
Length=475

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG ++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGGRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGTEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_008391353.1| PREDICTED: casein kinase I isoform delta-like [Malus domestica]
Length=477

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG ++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  3    MEPRVGGRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  62

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  63   GGTGVPNVRWFGTEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  122

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  123  SKSFLHRDIKPDNFLMGLG  141



>ref|XP_006426585.1| hypothetical protein CICLE_v10025527mg [Citrus clementina]
 gb|ESR39825.1| hypothetical protein CICLE_v10025527mg [Citrus clementina]
Length=474

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL YE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLQYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009372402.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
 ref|XP_009340677.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
Length=477

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG ++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  3    MEPRVGGRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  62

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  63   GGTGVPNVRWFGTEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  122

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  123  SKSFLHRDIKPDNFLMGLG  141



>ref|XP_006413231.1| hypothetical protein EUTSA_v10025148mg [Eutrema salsugineum]
 gb|ESQ54684.1| hypothetical protein EUTSA_v10025148mg [Eutrema salsugineum]
Length=461

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MESRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_006385411.1| hypothetical protein POPTR_0003s04170g [Populus trichocarpa]
 gb|ERP63208.1| hypothetical protein POPTR_0003s04170g [Populus trichocarpa]
Length=464

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKT+HPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTRHPQLLYESKLYKMLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCNRKLSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_006413230.1| hypothetical protein EUTSA_v10025148mg [Eutrema salsugineum]
 gb|ESQ54683.1| hypothetical protein EUTSA_v10025148mg [Eutrema salsugineum]
Length=460

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MESRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_003567780.1| PREDICTED: casein kinase I-like [Brachypodium distachyon]
Length=473

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNKFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009387717.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
 ref|XP_009387718.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+W+GVEGDYNVLV+DLLGPSLEDLF+FCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWYGVEGDYNVLVIDLLGPSLEDLFSFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FL+GLG
Sbjct  121  SKSFLHRDIKPDNFLVGLG  139



>ref|XP_004960994.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Setaria 
italica]
Length=394

 Score =   258 bits (660),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GN++R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNRFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KFK29120.1| hypothetical protein AALP_AA7G091500 [Arabis alpina]
Length=458

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLETVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE+ H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_010539397.1| PREDICTED: casein kinase I isoform delta-like [Tarenaya hassleriana]
Length=455

 Score =   260 bits (664),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN+QTNEEVAIK ENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVAIKFENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PN +WFGVEGDYNVL MDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEFVH
Sbjct  61   GGTGVPNAKWFGVEGDYNVLAMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>gb|KDO65158.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=504

 Score =   261 bits (668),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL YE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLQYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009795173.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana sylvestris]
Length=472

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN+QTNEEV +KLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVGVKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  AKSFLHRDIKPDNFLMGLG  139



>ref|XP_004303659.1| PREDICTED: casein kinase I [Fragaria vesca subsp. vesca]
Length=473

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG ++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGGRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWFGTEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_001784922.1| predicted protein [Physcomitrella patens]
 gb|EDQ50269.1| predicted protein [Physcomitrella patens]
Length=316

 Score =   255 bits (652),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEV IKLE++KTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVGIKLESIKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFG+EGDYNVLV+DLLGPSLEDLFNFCSRK SLKTVLMLA+ + +RVE+VH
Sbjct  61   GGTGIPNIRWFGIEGDYNVLVLDLLGPSLEDLFNFCSRKFSLKTVLMLADQLINRVEYVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  AKSFLHRDIKPDNFLMGLG  139



>ref|XP_010062655.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Eucalyptus 
grandis]
Length=474

 Score =   260 bits (665),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE VKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLETVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            G TGIPNVRWFG+EGDYNVLVMDLLGPSLEDLFNFCSRK SLKTVLMLA+ M +R+EFVH
Sbjct  61   GATGIPNVRWFGIEGDYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMMNRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_003597565.1| Casein kinase I isoform delta-like protein [Medicago truncatula]
 gb|AES67816.1| casein kinase I-like protein [Medicago truncatula]
Length=475

 Score =   260 bits (664),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN+KTKHPQLLYESKLY++LQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENIKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEG+YNVLVMDLLGPSLEDLF+FCSRKLSLKTVLMLA+ M +RVE++H
Sbjct  61   GGTGIPNVRWFGVEGEYNVLVMDLLGPSLEDLFSFCSRKLSLKTVLMLADQMINRVEYIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_001774847.1| predicted protein [Physcomitrella patens]
 gb|EDQ60388.1| predicted protein [Physcomitrella patens]
Length=323

 Score =   255 bits (652),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTN+QTNEEV IKLE++KTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNVQTNEEVGIKLESIKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFG+EGDYNVLV+DLLGPSLEDLFNFCSRK SLKTVLMLA+ + +RVE+VH
Sbjct  61   GGTGIPNIRWFGIEGDYNVLVLDLLGPSLEDLFNFCSRKFSLKTVLMLADQLINRVEYVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  AKSFLHRDIKPDNFLMGLG  139



>ref|XP_006390631.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
 gb|ESQ27917.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
Length=316

 Score =   255 bits (651),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  QKSFLHRDIKPDNFLMGLG  139



>ref|XP_009631851.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana tomentosiformis]
Length=472

 Score =   260 bits (664),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTN+QTNEEV +KLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVGVKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  AKSFLHRDIKPDNFLMGLG  139



>gb|KCW69785.1| hypothetical protein EUGRSUZ_F03150 [Eucalyptus grandis]
Length=433

 Score =   259 bits (661),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE VKTKHPQL+YESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLETVKTKHPQLMYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            G TGIPNVRWFG+EGDYNVLVMDLLGPSLEDLFNFCSRK SLKTVLMLA+ M +R+EFVH
Sbjct  61   GATGIPNVRWFGIEGDYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMMNRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_006654877.1| PREDICTED: casein kinase I isoform delta-like [Oryza brachyantha]
Length=468

 Score =   260 bits (664),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNKFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  AKSFLHRDIKPDNFLMGLG  139



>ref|XP_010536868.1| PREDICTED: casein kinase I isoform delta-like [Tarenaya hassleriana]
Length=448

 Score =   259 bits (662),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEE+AIK ENVKT+HPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEIAIKFENVKTRHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGVPNIKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_008793210.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Phoenix 
dactylifera]
Length=394

 Score =   258 bits (658),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVE DYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLM+A+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGVESDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMIADQMINRVEFLH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +K FLHR+ +P +FLMGLG
Sbjct  121  AKYFLHRDIKPDNFLMGLG  139



>ref|XP_006282246.1| hypothetical protein CARUB_v10028520mg [Capsella rubella]
 gb|EOA15144.1| hypothetical protein CARUB_v10028520mg [Capsella rubella]
Length=435

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE  H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVELFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_008793206.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008793207.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008793208.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Phoenix 
dactylifera]
Length=475

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVE DYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLM+A+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGVESDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMIADQMINRVEFLH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +K FLHR+ +P +FLMGLG
Sbjct  121  AKYFLHRDIKPDNFLMGLG  139



>ref|XP_002441634.1| hypothetical protein SORBIDRAFT_09g030690 [Sorghum bicolor]
 gb|EES20064.1| hypothetical protein SORBIDRAFT_09g030690 [Sorghum bicolor]
Length=474

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GN++R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNRFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009335830.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
Length=476

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG ++RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  3    MEPRVGGRFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  62

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNVRW+G EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  63   GGTGVPNVRWYGTEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  122

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  123  SKSFLHRDIKPDNFLMGLG  141



>ref|XP_011009775.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Populus 
euphratica]
Length=470

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLG NIQTNEEVAIKLENVKT+HPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGANIQTNEEVAIKLENVKTRHPQLLYESKLYKMLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KCW53570.1| hypothetical protein EUGRSUZ_J02844 [Eucalyptus grandis]
Length=365

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE VKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTHVQTNEEVAIKLEPVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGIPNVRWFGAEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_004960993.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Setaria 
italica]
Length=474

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 135/139 (97%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GN++R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNRFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_011009776.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Populus 
euphratica]
Length=470

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLG NIQTNEEVAIKLENVKT+HPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGANIQTNEEVAIKLENVKTRHPQLLYESKLYKMLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|NP_194340.1| casein kinase 1 [Arabidopsis thaliana]
 sp|P42158.2|KC1D_ARATH RecName: Full=Casein kinase I isoform delta-like; Short=CKI-delta 
[Arabidopsis thaliana]
 emb|CAB39675.1| Col-0 casein kinase I-like protein [Arabidopsis thaliana]
 emb|CAB79465.1| Col-0 casein kinase I-like protein [Arabidopsis thaliana]
 gb|AAK92719.1| putative Col-0 casein kinase I [Arabidopsis thaliana]
 gb|AAM14238.1| putative Col-0 casein kinase I [Arabidopsis thaliana]
 gb|AAY24532.1| casein kinase 1-like protein 1 [Arabidopsis thaliana]
 gb|AEE85157.1| casein kinase 1 [Arabidopsis thaliana]
Length=450

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNI TNEE+AIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>gb|KJB06826.1| hypothetical protein B456_001G013300 [Gossypium raimondii]
Length=459

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEP VGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPCVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SK+FLHR+ +P +FLMGLG
Sbjct  121  SKAFLHRDIKPDNFLMGLG  139



>gb|KJB06829.1| hypothetical protein B456_001G013300 [Gossypium raimondii]
Length=365

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEP VGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPCVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SK+FLHR+ +P +FLMGLG
Sbjct  121  SKAFLHRDIKPDNFLMGLG  139



>gb|ACT34059.1| putative protein kinase [Aegilops tauschii]
Length=474

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNKCRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|ABK24232.1| unknown [Picea sitchensis]
Length=481

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQ+NEEVAIKLENVKTKHPQL+YE+KLYR+LQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQSNEEVAIKLENVKTKHPQLVYEAKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGI NVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGIANVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            S+ FLHR+ +P +FLMGLG
Sbjct  121  SRCFLHRDVKPDNFLMGLG  139



>ref|XP_010537581.1| PREDICTED: casein kinase I [Tarenaya hassleriana]
 ref|XP_010537582.1| PREDICTED: casein kinase I [Tarenaya hassleriana]
Length=463

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNE+VAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEDVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGIPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KJB06827.1| hypothetical protein B456_001G013300 [Gossypium raimondii]
Length=463

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEP VGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPCVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SK+FLHR+ +P +FLMGLG
Sbjct  121  SKAFLHRDIKPDNFLMGLG  139



>gb|AFV33949.1| casein kinase I [Gossypium hirsutum]
Length=463

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEP VGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPCVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SK+FLHR+ +P +FLMGLG
Sbjct  121  SKAFLHRDIKPDNFLMGLG  139



>ref|XP_002972659.1| hypothetical protein SELMODRAFT_231975 [Selaginella moellendorffii]
 gb|EFJ25880.1| hypothetical protein SELMODRAFT_231975 [Selaginella moellendorffii]
Length=315

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFG+EGDYN LV+DLLGPSLEDLFNFC+RK SLKTVLMLA+ + +RVE+VH
Sbjct  61   GGTGIPNIRWFGIEGDYNGLVLDLLGPSLEDLFNFCNRKFSLKTVLMLADQLINRVEYVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_010483192.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=437

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNKYRLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  3    MESRVGNKYRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  62

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  63   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  122

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  123  SKSFLHRDLKPDNFLMGLG  141



>ref|NP_680447.1| casein kinase I-like 12 [Arabidopsis thaliana]
 gb|AAL49861.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14260.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43502.1| putative Col-0 casein kinase I-like protein [Arabidopsis thaliana]
 gb|AAY24545.1| casein kinase 1-like protein 12 [Arabidopsis thaliana]
 gb|AED96834.1| casein kinase I-like 12 [Arabidopsis thaliana]
Length=435

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PN++WFGVEGDYN LVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE+ H
Sbjct  61   GGTGVPNIKWFGVEGDYNTLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_010443365.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
 ref|XP_010443366.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=438

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNKYRLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  3    MESRVGNKYRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  62

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  63   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  122

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  123  SKSFLHRDLKPDNFLMGLG  141



>gb|EPS64405.1| hypothetical protein M569_10374, partial [Genlisea aurea]
Length=303

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLG+KIGSGSFGEIYLGTNIQTNEEVAIKLE+ KT+HPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGKKIGSGSFGEIYLGTNIQTNEEVAIKLESAKTRHPQLLYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GG GIPNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVE++H
Sbjct  61   GGNGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEYIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009798249.1| PREDICTED: casein kinase I-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009798250.1| PREDICTED: casein kinase I-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009798251.1| PREDICTED: casein kinase I-like isoform X2 [Nicotiana sylvestris]
 ref|XP_009798252.1| PREDICTED: casein kinase I-like isoform X3 [Nicotiana sylvestris]
 ref|XP_009798253.1| PREDICTED: casein kinase I-like isoform X3 [Nicotiana sylvestris]
Length=466

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLG N+QTNEEVAIKLENVKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGANVQTNEEVAIKLENVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN++WFGVEGDYN LVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNLKWFGVEGDYNALVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  AKSFLHRDIKPDNFLMGLG  139



>emb|CDM83167.1| unnamed protein product [Triticum aestivum]
Length=467

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEPRVGNKYRLGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGI NV+WFGVEGDYNVLVMD+LGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGISNVKWFGVEGDYNVLVMDVLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_006286042.1| hypothetical protein CARUB_v10007571mg [Capsella rubella]
 gb|EOA18940.1| hypothetical protein CARUB_v10007571mg [Capsella rubella]
Length=453

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGTNI TNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MESRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>gb|KFK27260.1| hypothetical protein AALP_AA8G358800 [Arabis alpina]
Length=432

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVK+KHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKSKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE+ H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>gb|KHG18061.1| hypothetical protein F383_22405 [Gossypium arboreum]
Length=463

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEP VGNK+RLGRKIGSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPCVGNKFRLGRKIGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SK+FLHR+ +P +FLMGLG
Sbjct  121  SKAFLHRDIKPDNFLMGLG  139



>ref|XP_006390630.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
 gb|ESQ27916.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
Length=348

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  QKSFLHRDIKPDNFLMGLG  139



>ref|XP_002988150.1| hypothetical protein SELMODRAFT_127114 [Selaginella moellendorffii]
 gb|EFJ10942.1| hypothetical protein SELMODRAFT_127114 [Selaginella moellendorffii]
Length=345

 Score =   254 bits (650),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFG+EGDYN LV+DLLGPSLEDLFNFC+RK SLKTVLMLA+ + +RVE+VH
Sbjct  61   GGTGIPNIRWFGIEGDYNGLVLDLLGPSLEDLFNFCNRKFSLKTVLMLADQLINRVEYVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KJB06830.1| hypothetical protein B456_001G013300 [Gossypium raimondii]
Length=467

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEP VGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPCVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SK+FLHR+ +P +FLMGLG
Sbjct  121  SKAFLHRDIKPDNFLMGLG  139



>ref|XP_006357391.1| PREDICTED: casein kinase I isoform delta-like [Solanum tuberosum]
Length=467

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLG N+QTNEEVAIKLENVKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGGNVQTNEEVAIKLENVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRK+SLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGVPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKMSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  AKSFLHRDIKPDNFLMGLG  139



>ref|XP_004486851.1| PREDICTED: casein kinase I isoform delta-like [Cicer arietinum]
Length=480

 Score =   258 bits (660),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+ NK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLEN+KTKHPQLLYESKLY++LQ
Sbjct  1    MEPRIANKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENIKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEG+YNVLVMDLLGPSLEDLF+FCSRKLSLKTVLMLA+ M +RVE++H
Sbjct  61   GGTGIPNVRWFGVEGEYNVLVMDLLGPSLEDLFSFCSRKLSLKTVLMLADQMINRVEYIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009105937.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Brassica 
rapa]
 emb|CDX96430.1| BnaA07g30410D [Brassica napus]
Length=465

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+G EGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNVKWYGTEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  QKSFLHRDIKPDNFLMGLG  139



>gb|KHN11262.1| Casein kinase I isoform delta-like [Glycine soja]
Length=476

 Score =   258 bits (659),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVA+KLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAVKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GG GIPNV+W+GVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGNGIPNVKWYGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMLNRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_002867580.1| hypothetical protein ARALYDRAFT_492204 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43839.1| hypothetical protein ARALYDRAFT_492204 [Arabidopsis lyrata subsp. 
lyrata]
Length=454

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNI TNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE+ H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_009105934.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Brassica 
rapa]
 ref|XP_009105935.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Brassica 
rapa]
 ref|XP_009105936.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Brassica 
rapa]
Length=467

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+G EGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNVKWYGTEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  QKSFLHRDIKPDNFLMGLG  139



>ref|XP_010448325.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=453

 Score =   257 bits (657),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNI TNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE  H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVELFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_009400542.1| PREDICTED: casein kinase I isoform delta-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=379

 Score =   255 bits (651),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRK+GSGSFGEI+LGTNIQTNEEVAIKLENVKTKHPQLLYESK+Y+ILQ
Sbjct  1    MEPRVANKFRLGRKVGSGSFGEIFLGTNIQTNEEVAIKLENVKTKHPQLLYESKVYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLVMDLLGPSLEDLFNFC+RK SLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNMRWFGVEGDYNVLVMDLLGPSLEDLFNFCNRKFSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SK FLHR+ +P +FLMGLG
Sbjct  121  SKCFLHRDIKPDNFLMGLG  139



>ref|XP_010438803.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=453

 Score =   257 bits (657),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNI TNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE  H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVELFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_010433551.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=453

 Score =   257 bits (657),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNI TNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE  H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVELFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_006585502.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Glycine 
max]
Length=478

 Score =   258 bits (659),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVA+KLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAVKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GG GIPNV+W+GVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGNGIPNVKWYGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMLNRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_006585503.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Glycine 
max]
Length=476

 Score =   258 bits (659),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVA+KLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAVKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GG GIPNV+W+GVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGNGIPNVKWYGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMLNRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>emb|CDX72938.1| BnaC06g33860D [Brassica napus]
Length=473

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+G EGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNVKWYGTEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  QKSFLHRDIKPDNFLMGLG  139



>ref|NP_177415.1| casein kinase 1-like protein 2 [Arabidopsis thaliana]
 gb|AAG51841.1|AC010926_4 putative casein kinase I; 37964-34339 [Arabidopsis thaliana]
 gb|AAL24332.1| putative casein kinase I [Arabidopsis thaliana]
 gb|AAQ55279.1| At1g72710 [Arabidopsis thaliana]
 gb|AAY24533.1| casein kinase 1-like protein 2 [Arabidopsis thaliana]
 gb|AEE35363.1| casein kinase 1-like protein 2 [Arabidopsis thaliana]
Length=465

 Score =   258 bits (658),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  QKSFLHRDIKPDNFLMGLG  139



>ref|XP_010033765.1| PREDICTED: casein kinase I isoform delta-like [Eucalyptus grandis]
 gb|KCW53569.1| hypothetical protein EUGRSUZ_J02844 [Eucalyptus grandis]
Length=475

 Score =   258 bits (658),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE VKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTHVQTNEEVAIKLEPVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFG EGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGIPNVRWFGAEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_008650083.1| PREDICTED: casein kinase I isoform delta-like [Zea mays]
Length=474

 Score =   258 bits (658),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GN++R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNRFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVEF H
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009349379.1| PREDICTED: casein kinase I isoform delta-like [Pyrus x bretschneideri]
Length=459

 Score =   257 bits (657),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEI+LGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRIL 
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIHLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILS  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            G TGIPNVRWFGVEG YNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLA+ M  RVEFVH
Sbjct  61   GATGIPNVRWFGVEGGYNVLVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQMISRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KHN39324.1| Casein kinase I isoform delta-like [Glycine soja]
Length=474

 Score =   257 bits (657),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVA+KLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAVKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GG GIPNV+W+GVEG+YNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGNGIPNVKWYGVEGEYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMLNRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_002887448.1| hypothetical protein ARALYDRAFT_476408 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63707.1| hypothetical protein ARALYDRAFT_476408 [Arabidopsis lyrata subsp. 
lyrata]
Length=465

 Score =   257 bits (657),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  QKSFLHRDIKPDNFLMGLG  139



>ref|XP_006401255.1| hypothetical protein EUTSA_v10013573mg [Eutrema salsugineum]
 gb|ESQ42708.1| hypothetical protein EUTSA_v10013573mg [Eutrema salsugineum]
Length=367

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE+ H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_010451725.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=438

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVG+KYRLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  3    MESRVGSKYRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  62

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  63   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  122

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  123  SKSFLHRDLKPDNFLMGLG  141



>gb|ABR18116.1| unknown [Picea sitchensis]
Length=479

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNKYRLGRKIGSGSFGEIYLGTN+QTNEEVAIKLE+V+TKHPQLLYESKLYRILQ
Sbjct  1    METRVGNKYRLGRKIGSGSFGEIYLGTNVQTNEEVAIKLESVRTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFGVEG+YNVLVMDLLGPSLEDLFNFCSRK SLKTVLMLA+ M +R+E+VH
Sbjct  61   GGTGIPNIRWFGVEGEYNVLVMDLLGPSLEDLFNFCSRKFSLKTVLMLADQMINRIEYVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_006390629.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
 gb|ESQ27915.1| hypothetical protein EUTSA_v10018502mg [Eutrema salsugineum]
Length=466

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  QKSFLHRDIKPDNFLMGLG  139



>gb|KDO65159.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=475

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 134/140 (96%), Gaps = 1/140 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQL YE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLQYEAKLYKILQ  60

Query  379  GG-TGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFV  555
            GG TGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFV
Sbjct  61   GGSTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFV  120

Query  556  HSKSFLHREYQP*HFLMGLG  615
            HSKSFLHR+ +P +FLMGLG
Sbjct  121  HSKSFLHRDIKPDNFLMGLG  140



>ref|XP_008656114.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Zea 
mays]
 gb|AFW81338.1| putative casein kinase family protein [Zea mays]
Length=393

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GN++R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNRFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+ C+RKLSLKTVLM+A+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSCCNRKLSLKTVLMIADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_003627159.1| Casein kinase I isoform delta-like protein [Medicago truncatula]
 gb|AET01635.1| casein kinase I-like protein [Medicago truncatula]
Length=474

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+W GVEG+YN+LVMDLLGPSLEDLFNFC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWSGVEGEYNILVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  TKSFLHRDIKPDNFLMGLG  139



>gb|ACJ85725.1| unknown [Medicago truncatula]
 gb|AFK40133.1| unknown [Medicago truncatula]
Length=474

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+W GVEG+YN+LVMDLLGPSLEDLFNFC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWSGVEGEYNILVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  TKSFLHRDIKPDNFLMGLG  139



>ref|XP_003627160.1| Casein kinase I isoform delta-like protein [Medicago truncatula]
 gb|AET01636.1| casein kinase I-like protein [Medicago truncatula]
Length=408

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+W GVEG+YN+LVMDLLGPSLEDLFNFC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVKWSGVEGEYNILVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  TKSFLHRDIKPDNFLMGLG  139



>ref|XP_004241866.1| PREDICTED: casein kinase I-like [Solanum lycopersicum]
Length=467

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLG N+QTNEEVAIKLENVKTKHPQLLYE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGGNVQTNEEVAIKLENVKTKHPQLLYEAKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PN++WFGVEGDYNVLVMDLLGPSLEDLFNFC+RK+SLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGVPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCNRKMSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  AKSFLHRDIKPDNFLMGLG  139



>ref|XP_006401254.1| hypothetical protein EUTSA_v10013573mg [Eutrema salsugineum]
 gb|ESQ42707.1| hypothetical protein EUTSA_v10013573mg [Eutrema salsugineum]
Length=438

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE+ H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|NP_001242599.1| uncharacterized protein LOC100795570 [Glycine max]
 gb|ACU21096.1| unknown [Glycine max]
Length=471

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRKIGSGS  EIYLGTN QTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVANKFRLGRKIGSGSSCEIYLGTNTQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFG+EGDYNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLA+ M +RVEF+H
Sbjct  61   GGTGIPNVRWFGIEGDYNVLVMDLLGPSLEDLFNFCTRKLSLKTVLMLADQMINRVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_009395780.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+W+GVEG+YNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF+H
Sbjct  61   GGTGIPNVKWYGVEGEYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFMH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_010531866.1| PREDICTED: casein kinase I isoform delta-like [Tarenaya hassleriana]
Length=462

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIG+GSFG+IY+GTNIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGAGSFGDIYIGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKT LMLA+ M +R+E VH
Sbjct  61   GGTGIPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTALMLADQMINRIEIVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_008656113.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Zea 
mays]
 gb|AFW81339.1| putative casein kinase family protein [Zea mays]
Length=475

 Score =   255 bits (652),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GN++R+GRK+GSGSFGEIYLGTN+QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRIGNRFRVGRKLGSGSFGEIYLGTNVQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+ C+RKLSLKTVLM+A+ M +RVEFVH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSCCNRKLSLKTVLMIADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>gb|KDO65156.1| hypothetical protein CISIN_1g010674mg [Citrus sinensis]
Length=473

 Score =   255 bits (651),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 133/139 (96%), Gaps = 1/139 (1%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKL NVKTKHPQL YE+KLY+ILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKL-NVKTKHPQLQYEAKLYKILQ  59

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  60   GGTGIPNLRWFGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  119

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  120  SKSFLHRDIKPDNFLMGLG  138



>ref|XP_009400540.1| PREDICTED: casein kinase I-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=471

 Score =   255 bits (651),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRK+GSGSFGEI+LGTNIQTNEEVAIKLENVKTKHPQLLYESK+Y+ILQ
Sbjct  1    MEPRVANKFRLGRKVGSGSFGEIFLGTNIQTNEEVAIKLENVKTKHPQLLYESKVYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RWFGVEGDYNVLVMDLLGPSLEDLFNFC+RK SLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNMRWFGVEGDYNVLVMDLLGPSLEDLFNFCNRKFSLKTVLMLADHMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SK FLHR+ +P +FLMGLG
Sbjct  121  SKCFLHRDIKPDNFLMGLG  139



>ref|XP_004510406.1| PREDICTED: casein kinase I isoform delta-like [Cicer arietinum]
Length=474

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGTNIQTNEEV IKLENVKTKHPQLLYE+KLY++LQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVGIKLENVKTKHPQLLYEAKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN++W GVEG+YNVLVMDLLGPSLEDLFNFC+RKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNIKWSGVEGEYNVLVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_006302226.1| hypothetical protein CARUB_v10020246mg [Capsella rubella]
 gb|EOA35124.1| hypothetical protein CARUB_v10020246mg [Capsella rubella]
Length=466

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLG+KIG GSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGKKIGGGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  QKSFLHRDIKPDNFLMGLG  139



>gb|AAA50233.1| casein kinase I-like protein; similar to the rat delta isoform 
of casein kinase I, Swiss-Prot Accession Number Q06486 [Arabidopsis 
thaliana]
Length=387

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGTNI TNEE+AIKLENVKTKH QLLYESKLYRILQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHQQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +  +FLMGLG
Sbjct  121  SKSFLHRDLKQTNFLMGLG  139



>emb|CDY49859.1| BnaA02g16080D [Brassica napus]
Length=465

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTDIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PN++W+GVEG+YNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNIKWYGVEGEYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             +SFLHR+ +P +FLMGLG
Sbjct  121  QRSFLHRDIKPDNFLMGLG  139



>ref|XP_010428166.1| PREDICTED: casein kinase I-like [Camelina sativa]
 ref|XP_010428167.1| PREDICTED: casein kinase I-like [Camelina sativa]
 ref|XP_010428168.1| PREDICTED: casein kinase I-like [Camelina sativa]
Length=460

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLG+KIG GSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGKKIGGGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  QKSFLHRDIKPDNFLMGLG  139



>emb|CDX94377.1| BnaC01g18070D [Brassica napus]
Length=460

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    MESRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_009139890.1| PREDICTED: casein kinase I isoform delta-like [Brassica rapa]
Length=460

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    MESRVGNKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVEF H
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>gb|KFK41692.1| hypothetical protein AALP_AA2G160600 [Arabis alpina]
Length=461

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEP VGNK+RLGRKIG GSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPLVGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  QKSFLHRDIKPDNFLMGLG  139



>ref|XP_010416034.1| PREDICTED: casein kinase I isoform delta-like [Camelina sativa]
Length=465

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLG+KIG GSFGEIYLGTNIQTNEEVAIKLE+VKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGKKIGGGSFGEIYLGTNIQTNEEVAIKLESVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+W+GVEGDYNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNVKWYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  QKSFLHRDIKPDNFLMGLG  139



>ref|XP_007135523.1| hypothetical protein PHAVU_010G136500g [Phaseolus vulgaris]
 gb|ESW07517.1| hypothetical protein PHAVU_010G136500g [Phaseolus vulgaris]
Length=479

 Score =   253 bits (646),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGTN QTNEEVAIKLE+VKTKHPQLLYESKLY+ILQ
Sbjct  1    METRVGNKFRLGRKIGSGSFGEIYLGTNFQTNEEVAIKLESVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GG GIPNV+W+GVEG+YN+LVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +RVEFVH
Sbjct  61   GGNGIPNVKWYGVEGEYNILVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>ref|XP_004969013.1| PREDICTED: casein kinase I isoform delta-like [Setaria italica]
Length=469

 Score =   253 bits (645),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRK+GSGSFGEIYLGT++QTNEEVAIKLE+VKTKHPQLLYESKLYRILQ
Sbjct  1    MEPRVANKFRLGRKLGSGSFGEIYLGTHVQTNEEVAIKLESVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+WFGVEGDYNVLVMDLLGPSLEDLF+FC+RKLSLKTVLMLA+ M +RVE+VH
Sbjct  61   GGTGIPNVKWFGVEGDYNVLVMDLLGPSLEDLFSFCNRKLSLKTVLMLADQMINRVEYVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  IKSFLHRDIKPDNFLMGLG  139



>ref|XP_009407307.1| PREDICTED: casein kinase I-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   253 bits (645),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVG+K+RLGRKIGSGSFGEIYLG NIQTNEEVAIKLENVKTKHPQLLYESKLY+ILQ
Sbjct  1    MEPRVGDKFRLGRKIGSGSFGEIYLGINIQTNEEVAIKLENVKTKHPQLLYESKLYKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRW+G+EG+YNVLVMDLLGPSLEDLFNFC RK SLKTVLMLA+ M +RVEFVH
Sbjct  61   GGTGIPNVRWYGIEGEYNVLVMDLLGPSLEDLFNFCGRKFSLKTVLMLADQMINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SK FLHR+ +P +FLMGLG
Sbjct  121  SKYFLHRDIKPDNFLMGLG  139



>ref|XP_009394112.1| PREDICTED: casein kinase I-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHP+LLYESKLYRILQ
Sbjct  1    MEPRVENKFRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPRLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNV+ FGVEGD+NVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLA+   +RVEFVH
Sbjct  61   GGTGIPNVKRFGVEGDHNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLADQTINRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDIKPDNFLMGLG  139



>emb|CDY11892.1| BnaC03g13180D [Brassica napus]
Length=430

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEI+LGT++QTNEEVAIKLEN KTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIHLGTHLQTNEEVAIKLENAKTKHPQLLYESKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE+ H
Sbjct  61   GGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_009127947.1| PREDICTED: casein kinase I isoform delta-like [Brassica rapa]
Length=465

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKTKHPQLLYESKLY++LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTDIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PN++W+GVEG+YNVLV+DLLGPSLEDLFNFCSRKLSLKTVLMLA+ M +R+EFVH
Sbjct  61   GGTGVPNIKWYGVEGEYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             +SFLHR+ +P + LMGLG
Sbjct  121  QRSFLHRDIKPVNSLMGLG  139



>emb|CDX88601.1| BnaA03g10480D [Brassica napus]
Length=430

 Score =   249 bits (636),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEI+LGT++QTNEEVAIKLEN KTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIHLGTHLQTNEEVAIKLENAKTKHPQLLYESKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE+ H
Sbjct  61   GGTGVPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_001774851.1| predicted protein [Physcomitrella patens]
 gb|EDQ60392.1| predicted protein [Physcomitrella patens]
Length=324

 Score =   246 bits (627),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNKYRLGRKIGSGSFGEIYLGTN+ T+EEV IKLE++K KHPQLLYESKLYRILQ
Sbjct  1    MEPRVGNKYRLGRKIGSGSFGEIYLGTNLVTHEEVGIKLESIKAKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RW+G+EGDYNV+V+DLLGPSLEDLFNFCSRK SLKTVLMLA+ + +RVE+VH
Sbjct  61   GGTGIPNIRWYGIEGDYNVMVLDLLGPSLEDLFNFCSRKFSLKTVLMLADQLINRVEYVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSFLHR+ +P +FLMGLG
Sbjct  121  AKSFLHRDIKPDNFLMGLG  139



>ref|XP_009132156.1| PREDICTED: casein kinase I isoform delta-like [Brassica rapa]
Length=430

 Score =   249 bits (635),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEI+LGT++QTNEEVAIKLEN KTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIHLGTHLQTNEEVAIKLENAKTKHPQLLYESKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE+ H
Sbjct  61   GGTGVPNLKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_009126906.1| PREDICTED: casein kinase I isoform delta-like isoform X2 [Brassica 
rapa]
Length=418

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGT+IQT+EEVAIKLEN KTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIYLGTHIQTHEEVAIKLENAKTKHPQLLYESKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEG+YNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLA+ M  RVE+ H
Sbjct  61   GGTGVPNVKWFGVEGEYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMITRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>emb|CDY20695.1| BnaA02g08350D [Brassica napus]
Length=418

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGT+IQT+EEVAIKLEN KTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIYLGTHIQTHEEVAIKLENAKTKHPQLLYESKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEG+YNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLA+ M  RVE+ H
Sbjct  61   GGTGVPNVKWFGVEGEYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMITRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>emb|CDY32908.1| BnaC02g11920D [Brassica napus]
Length=419

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGT+IQT+EEVAIKLEN KTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIYLGTHIQTHEEVAIKLENAKTKHPQLLYESKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEG+YNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLA+ M  RVE+ H
Sbjct  61   GGTGVPNVKWFGVEGEYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMITRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_009126905.1| PREDICTED: casein kinase I isoform delta-like isoform X1 [Brassica 
rapa]
Length=442

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIYLGT+IQT+EEVAIKLEN KTKHPQLLYESKLYR+LQ
Sbjct  1    MEARVGNKFRLGRKIGSGSFGEIYLGTHIQTHEEVAIKLENAKTKHPQLLYESKLYRLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNV+WFGVEG+YNVLV+DLLGPSLEDLFNFCSRKLSLK+VLMLA+ M  RVE+ H
Sbjct  61   GGTGVPNVKWFGVEGEYNVLVIDLLGPSLEDLFNFCSRKLSLKSVLMLADQMITRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_007201986.1| hypothetical protein PRUPE_ppa004932mg [Prunus persica]
 gb|EMJ03185.1| hypothetical protein PRUPE_ppa004932mg [Prunus persica]
Length=485

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 131/154 (85%), Gaps = 15/154 (10%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGE---------------IYLGTNIQTNEEVAIKLENVKTK  333
            MEPRVGNK+RLGRKIGSGSF                 IY+ TNIQTNEEVAIKLENVKTK
Sbjct  1    MEPRVGNKFRLGRKIGSGSFERSISLVPFLHLLSYLFIYICTNIQTNEEVAIKLENVKTK  60

Query  334  HPQLLYESKLYRILQGGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTV  513
            HPQLLYESKLYRILQGGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTV
Sbjct  61   HPQLLYESKLYRILQGGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTV  120

Query  514  LMLAESMXHRVEFVHSKSFLHREYQP*HFLMGLG  615
            LMLA+ M  RVEFVH+KSFLHR+ +P +FLMGLG
Sbjct  121  LMLADQMISRVEFVHAKSFLHRDIKPDNFLMGLG  154



>ref|XP_003057018.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58663.1| predicted protein [Micromonas pusilla CCMP1545]
Length=293

 Score =   242 bits (617),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            +E RVGNKYRLGRKIGSGSFG+IYLGT+IQT EEV IKLE+VKTKHPQLLYESKLY+ILQ
Sbjct  5    LELRVGNKYRLGRKIGSGSFGDIYLGTHIQTGEEVGIKLESVKTKHPQLLYESKLYKILQ  64

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYN++V+DLLGPSLEDLFNFC+RKLSLKTVLMLA+ +  R+E+VH
Sbjct  65   GGTGIPNVRWFGVEGDYNIMVLDLLGPSLEDLFNFCNRKLSLKTVLMLADQLVSRIEYVH  124

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSF+HR+ +P +FLMGLG
Sbjct  125  SKSFIHRDIKPDNFLMGLG  143



>ref|XP_001416096.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94388.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=295

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            +E RVGNKYRLGRKIGSGSFG+IYLGT+I+TNEEV IKLE+ KTKHPQLLYES+LY+ILQ
Sbjct  7    LELRVGNKYRLGRKIGSGSFGDIYLGTHIKTNEEVGIKLESCKTKHPQLLYESRLYKILQ  66

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNVRW+GVEGDYN++VMDLLGPSLEDLFNFC+RKLSLKTVLMLA+ +  R+E+VH
Sbjct  67   GGTGVPNVRWYGVEGDYNIMVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQLVSRIEYVH  126

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSF+HR+ +P +FLMGLG
Sbjct  127  SKSFIHRDIKPDNFLMGLG  145



>ref|XP_002455818.1| hypothetical protein SORBIDRAFT_03g025700 [Sorghum bicolor]
 gb|EES00938.1| hypothetical protein SORBIDRAFT_03g025700 [Sorghum bicolor]
Length=470

 Score =   245 bits (625),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRV NK+RLGRK+GSGSFGEI+LGT++QTNE+VAIKLEN+KTKHPQLLYE+KLYRILQ
Sbjct  1    MEPRVANKFRLGRKLGSGSFGEIFLGTHVQTNEQVAIKLENMKTKHPQLLYEAKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN++WFGVEGDYNVLVMDLLGPSLE+LF+FC+RKLSLKTVLMLA+ + +R+E+VH
Sbjct  61   GGTGIPNIKWFGVEGDYNVLVMDLLGPSLEELFSFCNRKLSLKTVLMLADQLINRIEYVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMGLG
Sbjct  121  MKSFLHRDIKPDNFLMGLG  139



>ref|XP_002502415.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63673.1| predicted protein [Micromonas sp. RCC299]
Length=389

 Score =   242 bits (618),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            +E RVGNKYRLGRKIGSGSFG+IYLGT+IQT EEV IKLE+VKTKHPQLLYESKLY+ILQ
Sbjct  5    LELRVGNKYRLGRKIGSGSFGDIYLGTHIQTGEEVGIKLESVKTKHPQLLYESKLYKILQ  64

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPNVRWFGVEGDYN++V+DLLGPSLEDLFNFC+RKLSLKTVLMLA+ +  R+E+VH
Sbjct  65   GGTGIPNVRWFGVEGDYNIMVLDLLGPSLEDLFNFCNRKLSLKTVLMLADQLVSRIEYVH  124

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSF+HR+ +P +FLMGLG
Sbjct  125  SKSFIHRDIKPDNFLMGLG  143



>emb|CDY38255.1| BnaA10g11030D [Brassica napus]
Length=430

 Score =   243 bits (621),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME  VG K+RLGRKIGSGSFGEI+LGT+IQTNEEVAIKLEN KTKHPQLLYESKLY++LQ
Sbjct  1    MEHLVGKKFRLGRKIGSGSFGEIHLGTHIQTNEEVAIKLENAKTKHPQLLYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE+ H
Sbjct  61   GGTGVPNIKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_009120217.1| PREDICTED: casein kinase I isoform delta-like [Brassica rapa]
Length=433

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME  VG K+RLGRKIGSGSFGEI+LGT+IQTNEEVAIKLEN KTKHPQLLYESKLY++LQ
Sbjct  1    MEHLVGKKFRLGRKIGSGSFGEIHLGTHIQTNEEVAIKLENAKTKHPQLLYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PN++WFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE+ H
Sbjct  61   GGTGVPNIKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>gb|KFK40308.1| hypothetical protein AALP_AA3G358100 [Arabis alpina]
Length=417

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR+GNK+RLGRKIGSGSFGEIYLGT+IQTNEEVAIKLENVKT HPQL YES++YR+LQ
Sbjct  1    MEPRIGNKFRLGRKIGSGSFGEIYLGTDIQTNEEVAIKLENVKTPHPQLSYESRIYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN++W+GVEGDYNVLVMDLLGPSLEDLF++C+RK +LKTVLMLA+ M +R+E++H
Sbjct  61   GGTGIPNMKWYGVEGDYNVLVMDLLGPSLEDLFSYCNRKFTLKTVLMLADQMINRLEYIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKS+LHR+ +P +FLMGLG
Sbjct  121  SKSYLHRDIKPDNFLMGLG  139



>emb|CEG01144.1| Serine/threonine-protein kinase, active site [Ostreococcus tauri]
Length=390

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            +E RVGNKYRLGRKIGSGSFG+IYLGT+I+TNEEV IKLE+ KTKHPQLLYE++LY+ILQ
Sbjct  8    LELRVGNKYRLGRKIGSGSFGDIYLGTHIKTNEEVGIKLESCKTKHPQLLYETRLYKILQ  67

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PNVRW+G+EGDYN++VMDLLGPSLEDLFNFC+RKLSLKTVLMLA+ +  R+E+VH
Sbjct  68   GGTGVPNVRWYGIEGDYNIMVMDLLGPSLEDLFNFCNRKLSLKTVLMLADQLVSRIEYVH  127

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSF+HR+ +P +FLMGLG
Sbjct  128  SKSFIHRDIKPDNFLMGLG  146



>ref|NP_179537.1| casein kinase I-like 5 [Arabidopsis thaliana]
 gb|AAD10146.1| putative casein kinase I [Arabidopsis thaliana]
 gb|AAM20688.1| putative casein kinase I [Arabidopsis thaliana]
 gb|AAM64335.1| putative casein kinase I [Arabidopsis thaliana]
 gb|AAP31924.1| At2g19470 [Arabidopsis thaliana]
 gb|AAY24534.1| casein kinase 1-like protein 5 [Arabidopsis thaliana]
 gb|AEC06884.1| casein kinase I-like 5 [Arabidopsis thaliana]
Length=433

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE+VKT HPQL YES++YR+LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTDVQTNEEVAIKLESVKTAHPQLSYESRIYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN++W+GVEGDYNVLVMDLLGPSLEDLF++C R+ SLKTVLMLA+ M +R+EF+H
Sbjct  61   GGTGIPNMKWYGVEGDYNVLVMDLLGPSLEDLFSYCKRQFSLKTVLMLADQMINRLEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKS+LHR+ +P +FLMGLG
Sbjct  121  SKSYLHRDIKPDNFLMGLG  139



>ref|XP_002883988.1| hypothetical protein ARALYDRAFT_899935 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60247.1| hypothetical protein ARALYDRAFT_899935 [Arabidopsis lyrata subsp. 
lyrata]
Length=434

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPRVGNK+RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE+VKT HPQL YES++YR+LQ
Sbjct  1    MEPRVGNKFRLGRKIGSGSFGEIYLGTDVQTNEEVAIKLESVKTAHPQLSYESRIYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN++W+GVEGDYNVLVMDLLGPSLEDLF +C RK SLKTVLMLA+ M +R+EF+H
Sbjct  61   GGTGIPNMKWYGVEGDYNVLVMDLLGPSLEDLFGYCHRKFSLKTVLMLADQMINRLEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKS+LHR+ +P +FLMGLG
Sbjct  121  SKSYLHRDIKPDNFLMGLG  139



>ref|XP_003595230.1| Casein kinase I isoform delta-like protein [Medicago truncatula]
 gb|ABN09106.1| Protein kinase [Medicago truncatula]
 gb|AES65481.1| casein kinase I-like protein [Medicago truncatula]
Length=471

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/139 (83%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+R+GRKIGSGSFGEIYLGTNI TNE+VAIKLENV+TK+PQLLYESKLYR+LQ
Sbjct  1    MERRVGNKFRVGRKIGSGSFGEIYLGTNIVTNEDVAIKLENVRTKNPQLLYESKLYRMLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            G  GIPN++WFGVEGDYNVLVMDLLGPSLE++FNFCSRKLSLKTVLMLAE M  RVEFVH
Sbjct  61   GEPGIPNIKWFGVEGDYNVLVMDLLGPSLEEMFNFCSRKLSLKTVLMLAEQMIKRVEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKS LHR+ +P +FLMGLG
Sbjct  121  SKSLLHRDIKPDNFLMGLG  139



>emb|CDY54387.1| BnaC09g53710D [Brassica napus]
Length=433

 Score =   241 bits (614),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME  VG K+RLGRKIGSGSFGEI+LGT+IQTNEEVAIKLEN KTKHPQLLYESKLY++LQ
Sbjct  1    MEHLVGKKFRLGRKIGSGSFGEIHLGTHIQTNEEVAIKLENAKTKHPQLLYESKLYKLLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTG+PN++WFGVE DYNVLVMDLLGPSLEDLFNFCSRKLSLK+VLMLA+ M +RVE+ H
Sbjct  61   GGTGVPNIKWFGVESDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSFLHR+ +P +FLMGLG
Sbjct  121  SKSFLHRDLKPDNFLMGLG  139



>ref|XP_009112605.1| PREDICTED: casein kinase I isoform delta-like [Brassica rapa]
Length=437

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            MEPR GN++RLGRKIGSGSFGEIYLGT++QTNEEVAIKLE+VKT HPQL YES++YR++Q
Sbjct  1    MEPRFGNRFRLGRKIGSGSFGEIYLGTDVQTNEEVAIKLESVKTAHPQLSYESRIYRVVQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN++WFG EGDYNVLVMDLLGPSLEDLF +CSRK +LKTVLMLA+ M +R+EF+H
Sbjct  61   GGTGIPNIKWFGAEGDYNVLVMDLLGPSLEDLFGYCSRKFTLKTVLMLADQMINRLEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKS+LHR+ +P +FLMGLG
Sbjct  121  SKSYLHRDIKPDNFLMGLG  139



>ref|XP_005837939.1| hypothetical protein GUITHDRAFT_92876 [Guillardia theta CCMP2712]
 gb|EKX50959.1| hypothetical protein GUITHDRAFT_92876 [Guillardia theta CCMP2712]
Length=306

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNKYR+GRKIGSGSFG+I+LGTNI T+EEVAIKLE+VK+KHPQLLYESK+ +ILQ
Sbjct  1    MELRVGNKYRIGRKIGSGSFGDIFLGTNISTSEEVAIKLESVKSKHPQLLYESKVLKILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GG G+P+VRW+GVEGDYNV+V+DLLGPSLEDLFNFCSRK SLKTVLMLAE M  R+EFVH
Sbjct  61   GGVGLPSVRWYGVEGDYNVMVIDLLGPSLEDLFNFCSRKFSLKTVLMLAEQMLSRIEFVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            SKSF+HR+ +P +FLMGLG
Sbjct  121  SKSFIHRDIKPDNFLMGLG  139



>ref|XP_002981109.1| hypothetical protein SELMODRAFT_113824 [Selaginella moellendorffii]
 gb|EFJ17810.1| hypothetical protein SELMODRAFT_113824 [Selaginella moellendorffii]
Length=379

 Score =   238 bits (606),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIY G + QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MERRVGNKFRLGRKIGSGSFGEIYHGVHTQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RW+GVEGD+NV+V++LLGPSLEDLFNFC RK SLKTVLMLA+ + +RVE VH
Sbjct  61   GGTGIPNIRWYGVEGDFNVMVIELLGPSLEDLFNFCGRKFSLKTVLMLADQLVNRVELVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSF+HR+ +P +FLMGLG
Sbjct  121  AKSFIHRDIKPDNFLMGLG  139



>ref|XP_002982581.1| hypothetical protein SELMODRAFT_116791 [Selaginella moellendorffii]
 gb|EFJ16334.1| hypothetical protein SELMODRAFT_116791 [Selaginella moellendorffii]
Length=379

 Score =   237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RVGNK+RLGRKIGSGSFGEIY G + QTNEEVAIKLENVKTKHPQLLYESKLYRILQ
Sbjct  1    MERRVGNKFRLGRKIGSGSFGEIYHGVHTQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN+RW+GVEGD+NV+V++LLGPSLEDLFNFC RK SLKTVLMLA+ + +RVE VH
Sbjct  61   GGTGIPNIRWYGVEGDFNVMVIELLGPSLEDLFNFCGRKFSLKTVLMLADQLVNRVELVH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
            +KSF+HR+ +P +FLMGLG
Sbjct  121  AKSFIHRDIKPDNFLMGLG  139



>ref|XP_009768908.1| PREDICTED: casein kinase I isoform delta-like [Nicotiana sylvestris]
Length=168

 Score =   230 bits (586),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +1

Query  199  MEPRVGNKYRLGRKIGSGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYRILQ  378
            ME RV N YRL RKIGSGSF EIY GTNI+TNE+VAIKLENV+TKHPQLLYESKLYR+LQ
Sbjct  1    METRVVNGYRLDRKIGSGSFSEIYHGTNIRTNEKVAIKLENVETKHPQLLYESKLYRVLQ  60

Query  379  GGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKTVLMLAESMXHRVEFVH  558
            GGTGIPN RWFGVEGDYNVLVMDLLGP+LE L NFCSRKLSLKTVLMLA+ M + VEF+H
Sbjct  61   GGTGIPNARWFGVEGDYNVLVMDLLGPNLEFLLNFCSRKLSLKTVLMLADQMINCVEFIH  120

Query  559  SKSFLHREYQP*HFLMGLG  615
             KSFLHR+ +P +FLMG G
Sbjct  121  CKSFLHRDIKPDNFLMGFG  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090