BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF050F15

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004304330.1|  PREDICTED: caffeic acid 3-O-methyltransferase      281   1e-90   Fragaria vesca subsp. vesca
gb|KDP29212.1|  hypothetical protein JCGZ_16601                         280   4e-90   Jatropha curcas
ref|XP_008442758.1|  PREDICTED: caffeic acid 3-O-methyltransferase      276   1e-88   Cucumis melo [Oriental melon]
ref|XP_007027514.1|  O-methyltransferase family protein                 275   2e-88   
gb|KJB62321.1|  hypothetical protein B456_009G411600                    269   1e-87   Gossypium raimondii
gb|KJB62324.1|  hypothetical protein B456_009G411600                    270   2e-87   Gossypium raimondii
ref|XP_008361606.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    270   2e-87   
gb|KJB62322.1|  hypothetical protein B456_009G411600                    269   2e-87   Gossypium raimondii
ref|XP_011101458.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    272   3e-87   Sesamum indicum [beniseed]
ref|XP_009341082.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    272   7e-87   Pyrus x bretschneideri [bai li]
gb|KGN59032.1|  hypothetical protein Csa_3G747630                       271   1e-86   Cucumis sativus [cucumbers]
ref|XP_007202084.1|  hypothetical protein PRUPE_ppa007420mg             270   2e-86   Prunus persica
gb|KJB62323.1|  hypothetical protein B456_009G411600                    270   2e-86   Gossypium raimondii
ref|XP_004137858.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    271   3e-86   
gb|KJB62320.1|  hypothetical protein B456_009G411600                    270   4e-86   Gossypium raimondii
gb|KHG05883.1|  Caffeic acid 3-O-methyltransferase                      269   6e-86   Gossypium arboreum [tree cotton]
ref|XP_008361604.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    265   3e-85   
ref|XP_009341081.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    266   8e-85   Pyrus x bretschneideri [bai li]
ref|XP_006367254.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    266   1e-84   Solanum tuberosum [potatoes]
ref|XP_004488687.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    265   2e-84   Cicer arietinum [garbanzo]
ref|XP_008241354.1|  PREDICTED: caffeic acid 3-O-methyltransferase      265   2e-84   Prunus mume [ume]
emb|CAN65776.1|  hypothetical protein VITISV_030414                     264   5e-84   Vitis vinifera
ref|XP_002264566.1|  PREDICTED: caffeic acid 3-O-methyltransferase      264   7e-84   Vitis vinifera
ref|XP_006428524.1|  hypothetical protein CICLE_v10013655mg             260   1e-83   
ref|XP_006367255.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    263   1e-83   Solanum tuberosum [potatoes]
gb|AFK33955.1|  unknown                                                 254   3e-82   Medicago truncatula
ref|XP_010050337.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    259   4e-82   Eucalyptus grandis [rose gum]
ref|XP_002519426.1|  o-methyltransferase, putative                      258   1e-81   Ricinus communis
gb|KEH38506.1|  caffeic acid O-methyltransferase                        258   2e-81   Medicago truncatula
ref|XP_006381360.1|  hypothetical protein POPTR_0006s12160g             254   2e-81   
ref|XP_006594705.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    255   2e-81   Glycine max [soybeans]
ref|XP_010312333.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    257   3e-81   Solanum lycopersicum
ref|XP_011018830.1|  PREDICTED: caffeic acid 3-O-methyltransferase      256   7e-81   Populus euphratica
ref|XP_006594704.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    256   7e-81   
ref|XP_010267318.1|  PREDICTED: caffeic acid 3-O-methyltransferase      256   1e-80   Nelumbo nucifera [Indian lotus]
ref|XP_006381361.1|  hypothetical protein POPTR_0006s12160g             254   4e-80   
ref|XP_011098295.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    251   3e-79   Sesamum indicum [beniseed]
ref|XP_007149437.1|  hypothetical protein PHAVU_005G070300g             251   8e-79   Phaseolus vulgaris [French bean]
ref|XP_006291371.1|  hypothetical protein CARUB_v10017511mg             250   2e-78   Capsella rubella
ref|XP_006598126.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    249   2e-78   Glycine max [soybeans]
ref|XP_010504072.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    249   5e-78   Camelina sativa [gold-of-pleasure]
ref|XP_006403721.1|  hypothetical protein EUTSA_v10010488mg             248   1e-77   Eutrema salsugineum [saltwater cress]
ref|XP_010426946.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    248   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_006391885.1|  hypothetical protein EUTSA_v10023542mg             248   1e-77   Eutrema salsugineum [saltwater cress]
ref|XP_010098845.1|  Caffeic acid 3-O-methyltransferase                 247   2e-77   Morus notabilis
ref|XP_009617330.1|  PREDICTED: flavone 3'-O-methyltransferase 1        247   2e-77   Nicotiana tomentosiformis
ref|NP_190882.1|  putative O-diphenol-O-methyl transferase              247   3e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515802.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    246   3e-77   Camelina sativa [gold-of-pleasure]
ref|XP_009774776.1|  PREDICTED: caffeic acid 3-O-methyltransferase      240   4e-76   Nicotiana sylvestris
emb|CDX76223.1|  BnaA04g04870D                                          240   6e-76   
ref|XP_010546519.1|  PREDICTED: flavone 3'-O-methyltransferase 1        241   4e-75   Tarenaya hassleriana [spider flower]
ref|XP_009139429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      240   1e-74   Brassica rapa
emb|CDX95399.1|  BnaC04g27590D                                          238   5e-74   
gb|KFK34550.1|  hypothetical protein AALP_AA5G160800                    238   1e-73   Arabis alpina [alpine rockcress]
ref|XP_011101457.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    235   1e-72   
ref|XP_010271244.1|  PREDICTED: uncharacterized protein LOC104607...    229   2e-72   Nelumbo nucifera [Indian lotus]
ref|XP_010271241.1|  PREDICTED: uncharacterized protein LOC104607...    229   8e-72   Nelumbo nucifera [Indian lotus]
gb|AAP03058.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    220   7e-67   Limonium latifolium
gb|KHN47498.1|  Caffeic acid 3-O-methyltransferase                      217   7e-66   Glycine soja [wild soybean]
ref|XP_004502926.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    215   5e-65   Cicer arietinum [garbanzo]
ref|XP_003602597.1|  Caffeic acid 3-O-methyltransferase                 204   1e-60   
gb|KDO38249.1|  hypothetical protein CISIN_1g043063mg                   200   6e-60   Citrus sinensis [apfelsine]
gb|AFK47565.1|  unknown                                                 196   3e-59   Medicago truncatula
gb|AAP03054.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    194   4e-59   Limonium latifolium
gb|AAP03053.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    194   8e-59   Limonium latifolium
emb|CAB65279.1|  O-diphenol-O-methyl transferase                        199   9e-59   Medicago sativa subsp. x varia
ref|XP_006423903.1|  hypothetical protein CICLE_v10029876mg             197   1e-58   
ref|XP_003602596.1|  Caffeic acid 3-O-methyltransferase                 195   2e-58   
gb|KDO41959.1|  hypothetical protein CISIN_1g021707mg                   196   3e-58   Citrus sinensis [apfelsine]
gb|AGW45465.1|  beta-alanine n-methyltransferase                        191   1e-57   Reaumuria trigyna
ref|XP_006436414.1|  hypothetical protein CICLE_v10033543mg             194   2e-57   Citrus clementina [clementine]
ref|XP_006485837.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    195   2e-57   Citrus sinensis [apfelsine]
ref|XP_003602595.1|  Caffeic acid 3-O-methyltransferase                 196   2e-57   Medicago truncatula
ref|XP_009382782.1|  PREDICTED: caffeic acid 3-O-methyltransferase      195   5e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006451708.1|  hypothetical protein CICLE_v10010561mg             192   9e-57   
ref|XP_006485822.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    190   4e-56   
ref|XP_010683979.1|  PREDICTED: caffeic acid 3-O-methyltransferase      188   3e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010935842.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    184   5e-53   
ref|XP_010935841.1|  PREDICTED: quercetin 3-O-methyltransferase 1...    183   3e-52   Elaeis guineensis
dbj|BAJ96291.1|  predicted protein                                      178   1e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004954455.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    177   3e-50   Setaria italica
ref|XP_002453074.1|  hypothetical protein SORBIDRAFT_04g037820          174   5e-49   Sorghum bicolor [broomcorn]
ref|NP_001149617.1|  LOC100283243                                       170   1e-47   
gb|ACN25427.1|  unknown                                                 170   2e-47   Zea mays [maize]
gb|EEC74273.1|  hypothetical protein OsI_09508                          167   9e-47   Oryza sativa Indica Group [Indian rice]
ref|NP_001048569.1|  Os02g0823400                                       167   2e-46   
ref|XP_008387516.1|  PREDICTED: caffeic acid 3-O-methyltransferase      165   3e-46   
gb|KCW89310.1|  hypothetical protein EUGRSUZ_A01600                     163   1e-45   Eucalyptus grandis [rose gum]
ref|XP_003572969.1|  PREDICTED: caffeic acid 3-O-methyltransferase      160   7e-44   Brachypodium distachyon [annual false brome]
gb|KDO38695.1|  hypothetical protein CISIN_1g037818mg                   155   1e-43   Citrus sinensis [apfelsine]
ref|XP_010275846.1|  PREDICTED: uncharacterized protein LOC104610771    153   5e-42   
gb|AES72848.2|  caffeic acid O-methyltransferase                        153   2e-41   Medicago truncatula
ref|XP_006425490.1|  hypothetical protein CICLE_v10027189mg             150   2e-40   
gb|KCW89309.1|  hypothetical protein EUGRSUZ_A01600                     146   1e-38   Eucalyptus grandis [rose gum]
gb|KDO39806.1|  hypothetical protein CISIN_1g025363mg                   134   5e-35   Citrus sinensis [apfelsine]
ref|XP_011101495.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    125   3e-33   
ref|XP_006838729.1|  hypothetical protein AMTR_s00002p00253410          128   1e-31   Amborella trichopoda
ref|XP_006649184.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    119   8e-29   
ref|XP_010243879.1|  PREDICTED: uncharacterized protein LOC104587837    107   5e-26   Nelumbo nucifera [Indian lotus]
ref|XP_002963872.1|  caffeic acid O-methyltransferase                   107   4e-24   Selaginella moellendorffii
ref|XP_002988275.1|  caffeic acid O-methyltransferase                   106   5e-24   Selaginella moellendorffii
ref|XP_002986521.1|  hypothetical protein SELMODRAFT_124205             102   4e-23   
ref|XP_002986612.1|  hypothetical protein SELMODRAFT_124122             102   7e-23   
ref|XP_002965284.1|  hypothetical protein SELMODRAFT_83100              101   1e-22   
gb|ADE88153.1|  caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-...    101   4e-22   Selaginella moellendorffii
gb|AFM73596.1|  caffeate O-methyltransferase                            100   9e-22   Populus simonii
gb|KDO54338.1|  hypothetical protein CISIN_1g032721mg                 95.9    2e-21   Citrus sinensis [apfelsine]
ref|XP_006280681.1|  hypothetical protein CARUB_v10026645mg           98.6    3e-21   Capsella rubella
gb|AFK40372.1|  unknown                                               97.8    7e-21   Lotus japonicus
ref|XP_010241050.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  97.8    8e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010027213.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  93.6    1e-20   Eucalyptus grandis [rose gum]
ref|XP_006451875.1|  hypothetical protein CICLE_v10010158mg           95.5    1e-20   Citrus clementina [clementine]
ref|XP_006432602.1|  hypothetical protein CICLE_v10002505mg           95.1    2e-20   
gb|AAB96879.1|  O-methyltransferase 1                                 96.7    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200227.1|  caffeic acid/5-hydroxyferulic acid O-methyltran...  96.7    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|ABU53653.1|  caffeic acid O-3-methyltransferase                    96.3    3e-20   Populus deltoides
ref|XP_002864309.1|  O-methyltransferase 1                            96.3    3e-20   
prf||1906376A  O-methyltransferase                                    95.9    3e-20
gb|AAF60951.1|  O-methyltransferase                                   95.9    3e-20   Populus trichocarpa x Populus deltoides
dbj|BAD83867.1|  Caffeic acid O-methyltransferase                     95.9    4e-20   Iris x hollandica [Dutch iris]
ref|XP_007136428.1|  hypothetical protein PHAVU_009G044400g           95.9    4e-20   Phaseolus vulgaris [French bean]
gb|AFK39562.1|  unknown                                               95.1    6e-20   Lotus japonicus
ref|XP_002317838.1|  Chain A family protein                           94.7    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_011043758.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  94.4    1e-19   Populus euphratica
gb|AFZ78575.1|  caffeic acid O-methyltransferase                      94.4    1e-19   Populus tomentosa [Chinese white poplar]
sp|Q00763.1|COMT1_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...  94.4    1e-19   Populus tremuloides
gb|AEV93478.1|  caffeic acid O-methyltransferase                      94.4    1e-19   Caragana korshinskii
gb|AFK45226.1|  unknown                                               94.0    1e-19   Lotus japonicus
ref|XP_003621323.1|  Isoliquiritigenin 2'-O-methyltransferase         94.0    2e-19   Medicago truncatula
gb|ACY06328.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...  94.0    2e-19   Medicago sativa [alfalfa]
gb|AER35881.1|  S-adenosyl-L-methionine:flavonoid O-methyltransfe...  93.6    2e-19   Ginkgo biloba [ginkgo]
gb|KHF97637.1|  Caffeic acid 3-O-methyltransferase                    92.8    3e-19   Gossypium arboreum [tree cotton]
gb|KHF97352.1|  Caffeic acid 3-O-methyltransferase                    92.8    3e-19   Gossypium arboreum [tree cotton]
sp|Q8W013.1|COMT1_CATRO  RecName: Full=Caffeic acid 3-O-methyltra...  92.8    4e-19   Catharanthus roseus [chatas]
gb|ABO41840.1|  putative caffeic acid methyltransferase               92.8    4e-19   Gossypium arboreum [tree cotton]
ref|XP_006401613.1|  hypothetical protein EUTSA_v10013897mg           92.8    4e-19   Eutrema salsugineum [saltwater cress]
dbj|BAJ34520.1|  unnamed protein product                              92.8    5e-19   Eutrema halophilum
gb|AAF63200.1|  caffeic acid O-3-methyltransferase                    92.4    5e-19   Populus tomentosa [Chinese white poplar]
sp|P28002.1|COMT1_MEDSA  RecName: Full=Caffeic acid 3-O-methyltra...  92.4    5e-19   Medicago sativa [alfalfa]
sp|Q43046.1|COMT1_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...  92.4    5e-19   Populus sieboldii x Populus grandidentata
gb|ABO41845.1|  putative caffeic acid methyltransferase               92.4    6e-19   Gossypium hirsutum [American cotton]
gb|ACN41351.2|  putative caffeic acid O-methyltransferase             92.4    6e-19   Betula pendula [white birch]
gb|AAD29845.1|AF064697_1  O-methyltransferase                         92.4    6e-19   Thalictrum tuberosum
ref|XP_003602396.1|  Caffeic acid O-methyltransferase                 92.4    6e-19   Medicago truncatula
gb|AFK39235.1|  unknown                                               92.4    6e-19   Medicago truncatula
dbj|BAO79380.1|  5-hydroxyconiferylaldehyde O-methyltransferase       92.0    7e-19   Anthriscus sylvestris
ref|XP_001762717.1|  predicted protein                                92.0    8e-19   
gb|ACT32028.1|  caffeic acid O-methyltransferase 1                    92.0    8e-19   Gossypium hirsutum [American cotton]
gb|KHG13754.1|  Caffeic acid 3-O-methyltransferase                    92.4    8e-19   Gossypium arboreum [tree cotton]
ref|XP_002971011.1|  hypothetical protein SELMODRAFT_94918            92.0    8e-19   
gb|AIJ28474.1|  O-methyltransferase                                   92.0    8e-19   Vaccinium corymbosum [American blueberry]
gb|ABO41834.1|  putative caffeic acid methyltransferase               92.0    8e-19   Gossypium raimondii
dbj|BAA13683.1|  O-methyltransferase                                  92.0    9e-19   Glycyrrhiza echinata [hedgehog licorice]
ref|XP_009352092.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  91.3    9e-19   Pyrus x bretschneideri [bai li]
gb|KJB16304.1|  hypothetical protein B456_002G222400                  92.0    1e-18   Gossypium raimondii
gb|AGG91492.1|  caffeic acid 3-O-methyltransferase                    91.7    1e-18   Betula platyphylla [Asian white birch]
prf||2119166A  caffeic acid O-methyltransferase                       91.7    1e-18
ref|XP_006441597.1|  hypothetical protein CICLE_v10023355mg           89.7    1e-18   
ref|XP_002962074.1|  hypothetical protein SELMODRAFT_76630            92.0    1e-18   
gb|KDP30064.1|  hypothetical protein JCGZ_18389                       91.7    1e-18   Jatropha curcas
gb|ACD56610.1|  putative caffeic acid protein                         91.3    1e-18   Gossypioides kirkii
ref|NP_001242325.1|  uncharacterized protein LOC100805999             91.3    1e-18   
gb|KHN23296.1|  Caffeic acid 3-O-methyltransferase                    91.3    2e-18   Glycine soja [wild soybean]
gb|ACT87981.1|  caffeic acid O-methyltransferase                      91.3    2e-18   Jatropha curcas
ref|XP_003634161.1|  PREDICTED: caffeic acid 3-O-methyltransferase    91.3    2e-18   Vitis vinifera
sp|Q6T1F5.1|COMT1_AMMMJ  RecName: Full=Caffeic acid 3-O-methyltra...  91.3    2e-18   Ammi majus [ameo mayor]
ref|XP_004502769.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  91.3    2e-18   Cicer arietinum [garbanzo]
ref|XP_002525818.1|  o-methyltransferase, putative                    91.3    2e-18   Ricinus communis
gb|AAD29841.1|AF064693_1  catechol O-methyltransferase                90.9    2e-18   Thalictrum tuberosum
gb|AAF28353.1|AF220491_1  O-methyltransferase                         90.9    2e-18   Fragaria x ananassa
gb|ACT32029.1|  caffeic acid O-methyltransferase 2                    90.9    2e-18   Gossypium hirsutum [American cotton]
ref|XP_002864307.1|  O-methyltransferase 1                            90.9    2e-18   Arabidopsis lyrata subsp. lyrata
gb|AAD29844.1|AF064696_1  catechol O-methyltransferase                90.9    2e-18   Thalictrum tuberosum
gb|AHM25237.1|  noraucuparin O-methyltransferase                      90.9    2e-18   Sorbus aucuparia [European mountain ash]
ref|XP_008775842.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  90.9    2e-18   Phoenix dactylifera
ref|XP_003526767.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  90.9    2e-18   Glycine max [soybeans]
gb|ABI54119.1|  caffeic acid O-methyltransferase                      90.5    2e-18   Malus domestica [apple tree]
gb|KFK27028.1|  hypothetical protein AALP_AA8G324800                  90.5    3e-18   Arabis alpina [alpine rockcress]
ref|XP_010671332.1|  PREDICTED: caffeic acid 3-O-methyltransferase    90.5    3e-18   Beta vulgaris subsp. vulgaris [field beet]
gb|ABO41846.1|  putative caffeic acid methyltransferase               90.5    3e-18   Gossypium hirsutum [American cotton]
sp|Q8GU25.1|COMT1_ROSCH  RecName: Full=Caffeic acid 3-O-methyltra...  90.5    3e-18   Rosa chinensis [China rose]
dbj|BAC78827.1|  caffeic acid O-methyltransferase                     90.5    3e-18   Rosa chinensis var. spontanea
emb|CDY70033.1|  BnaCnng66420D                                        89.4    3e-18   Brassica napus [oilseed rape]
ref|XP_008788729.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  90.5    3e-18   Phoenix dactylifera
ref|XP_007032646.1|  Caffeic acid 3-O-methyltransferase 1             90.1    4e-18   
gb|AAD29843.1|AF064695_1  catechol O-methyltransferase                90.1    4e-18   Thalictrum tuberosum
ref|NP_001240003.1|  uncharacterized protein LOC100780100             90.1    4e-18   Glycine max [soybeans]
gb|EPS67212.1|  hypothetical protein M569_07558                       90.1    4e-18   Genlisea aurea
gb|AAD29842.1|AF064694_1  catechol O-methyltransferase                89.7    5e-18   Thalictrum tuberosum
ref|NP_001289246.1|  caffeic acid 3-O-methyltransferase               89.7    5e-18   Pyrus x bretschneideri [bai li]
sp|P46484.1|COMT1_EUCGU  RecName: Full=Caffeic acid 3-O-methyltra...  89.4    6e-18   Eucalyptus gunnii
ref|XP_006478241.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  90.1    7e-18   
gb|AGR85824.1|  caffeic acid O-methyltransferase                      89.0    7e-18   Hibiscus cannabinus [bimli-jute]
gb|KHG13289.1|  Caffeic acid 3-O-methyltransferase                    89.4    8e-18   Gossypium arboreum [tree cotton]
ref|XP_004307899.1|  PREDICTED: caffeic acid 3-O-methyltransferase    89.4    8e-18   Fragaria vesca subsp. vesca
gb|AGJ84131.1|  putative caffeic acid O-methyltransferase             89.0    9e-18   Hibiscus cannabinus [bimli-jute]
gb|ADB82906.1|  caffeic O-methyltransferase1                          89.0    9e-18   Eucalyptus camaldulensis
gb|KDO39208.1|  hypothetical protein CISIN_1g041308mg                 87.8    1e-17   Citrus sinensis [apfelsine]
gb|ABO41852.1|  putative caffeic acid methyltransferase               89.0    1e-17   Gossypium hirsutum [American cotton]
ref|XP_010048429.1|  PREDICTED: caffeic acid 3-O-methyltransferase    89.0    1e-17   Eucalyptus grandis [rose gum]
gb|ACY66932.1|  caffeic O-methyltransferase 1                         89.0    1e-17   Eucalyptus camaldulensis
gb|KHN23295.1|  Caffeic acid 3-O-methyltransferase                    88.6    1e-17   Glycine soja [wild soybean]
ref|XP_008376825.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  88.6    1e-17   
ref|XP_003528001.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  88.6    1e-17   Glycine max [soybeans]
gb|KJB23956.1|  hypothetical protein B456_004G125600                  87.8    1e-17   Gossypium raimondii
gb|KJB23955.1|  hypothetical protein B456_004G125600                  88.2    1e-17   Gossypium raimondii
ref|XP_008362805.1|  PREDICTED: caffeic acid 3-O-methyltransferase    88.6    1e-17   
gb|KDP35860.1|  hypothetical protein JCGZ_10599                       88.6    1e-17   Jatropha curcas
emb|CDY43839.1|  BnaC03g14720D                                        88.6    1e-17   Brassica napus [oilseed rape]
gb|KJB23957.1|  hypothetical protein B456_004G125600                  88.2    1e-17   Gossypium raimondii
ref|XP_006478243.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  87.0    1e-17   
ref|XP_010934913.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  88.6    1e-17   Elaeis guineensis
ref|XP_010934914.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  88.6    1e-17   Elaeis guineensis
dbj|BAO79382.1|  hypothetical plant O-methyltransferase               88.6    1e-17   Anthriscus sylvestris
ref|XP_008376828.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  88.2    2e-17   Malus domestica [apple tree]
gb|KCW89068.1|  hypothetical protein EUGRSUZ_A01397                   89.0    2e-17   Eucalyptus grandis [rose gum]
ref|XP_008462913.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1  88.2    2e-17   Cucumis melo [Oriental melon]
ref|XP_009132451.1|  PREDICTED: flavone 3'-O-methyltransferase 1      88.2    2e-17   Brassica rapa
gb|AAV36348.1|  caffeate O-methyltransferase                          86.3    2e-17   Pinus taeda
ref|XP_010482824.1|  PREDICTED: flavone 3'-O-methyltransferase 1      87.8    2e-17   Camelina sativa [gold-of-pleasure]
gb|ABG27066.1|  caffeic acid O-methyltransferase                      87.8    2e-17   Boehmeria nivea [Chinese silk-plant]
ref|XP_009418616.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  87.8    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008234634.1|  PREDICTED: caffeic acid 3-O-methyltransferase    87.8    2e-17   Prunus mume [ume]
gb|KJB23954.1|  hypothetical protein B456_004G125600                  87.8    2e-17   Gossypium raimondii
ref|XP_009119948.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  87.8    2e-17   Brassica rapa
gb|AEO14871.1|  caffeic acid O-methyltransferase                      87.8    3e-17   Salvia miltiorrhiza [Chinese salvia]
dbj|BAE94400.1|  Caffeic acid 3-O-methyltransferase                   87.8    3e-17   Ipomoea nil [qian niu]
gb|AEI54336.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...  87.8    3e-17   Glycine max [soybeans]
dbj|BAE94403.1|  Caffeic acid 3-O-methyltransferase                   87.8    3e-17   Ipomoea nil [qian niu]
gb|AEO14870.1|  caffeic acid O-methyltransferase                      87.8    3e-17   Salvia miltiorrhiza [Chinese salvia]
gb|AAP03055.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...  86.7    3e-17   Limonium latifolium
ref|XP_010103059.1|  Caffeic acid 3-O-methyltransferase               87.0    3e-17   
ref|XP_010446534.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  87.4    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010442991.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  87.4    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_007015113.1|  Caffeic acid 3-O-methyltransferase 1 isoform 1   88.2    4e-17   
gb|AFO69477.1|  caffeic acid O-methyltransferase                      87.4    4e-17   Sorghum bicolor [broomcorn]
gb|AAO43609.1|  caffeic acid O-methyltransferase                      87.4    4e-17   Sorghum bicolor [broomcorn]
ref|XP_007015114.1|  Caffeic acid 3-O-methyltransferase 1 isoform 2   88.2    4e-17   
dbj|BAD18975.1|  phloroglucinol O-methyltransferase                   87.4    4e-17   Rosa chinensis var. spontanea
sp|Q8LL87.1|COMT1_COFCA  RecName: Full=Caffeic acid 3-O-methyltra...  87.0    4e-17   Coffea canephora [robusta coffee]
gb|KJB52493.1|  hypothetical protein B456_008G264900                  86.7    4e-17   Gossypium raimondii
gb|AAN03726.1|  caffeic acid O-methyltransferase                      87.0    4e-17   Coffea canephora [robusta coffee]
gb|AAY86361.1|  caffeic acid O-methyltransferase                      87.0    4e-17   Acacia auriculiformis x Acacia mangium
ref|XP_010048410.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  87.0    4e-17   Eucalyptus grandis [rose gum]
sp|O23760.1|COMT1_CLABR  RecName: Full=Caffeic acid 3-O-methyltra...  87.0    5e-17   Clarkia breweri [fairy fans]
gb|ABR18380.1|  unknown                                               87.0    5e-17   Picea sitchensis
gb|AAG43822.1|AF212316_1  caffeic acid O-methyltransferase            87.0    5e-17   Capsicum annuum
ref|XP_006478225.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  85.9    5e-17   
ref|XP_010520933.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  87.0    5e-17   Tarenaya hassleriana [spider flower]
ref|XP_006441468.1|  hypothetical protein CICLE_v10020874mg           86.7    5e-17   Citrus clementina [clementine]
ref|XP_006478224.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  85.9    5e-17   
sp|Q9FQY8.2|COMT1_CAPAN  RecName: Full=Caffeic acid 3-O-methyltra...  86.7    6e-17   Capsicum annuum
ref|XP_007039215.1|  Caffeic acid 3-O-methyltransferase 1             87.0    6e-17   
gb|AGO50639.1|  caffeic acid O-methyltransferase                      86.7    6e-17   Linum usitatissimum
gb|AAC18863.1|  caffeic acid 3-O-methyltransferase                    86.7    6e-17   Mesembryanthemum crystallinum
ref|XP_006478347.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  86.7    6e-17   
gb|AHY28755.1|  caffeate O-methyltransferase                          85.1    6e-17   Pinus palustris [longleaf pine]
sp|P59049.1|OMT1_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...  86.3    6e-17   Chrysosplenium americanum [water-carpet]
dbj|BAK42963.1|  caffeic acid O-methylltransferase                    86.7    6e-17   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAV36304.1|  caffeate O-methyltransferase                          84.7    7e-17   Pinus taeda
ref|XP_006441599.1|  hypothetical protein CICLE_v10020870mg           86.3    7e-17   Citrus clementina [clementine]
gb|ABK21417.1|  unknown                                               86.7    7e-17   Picea sitchensis
ref|XP_006478221.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  86.3    7e-17   Citrus sinensis [apfelsine]
ref|XP_006441596.1|  hypothetical protein CICLE_v10023568mg           86.3    8e-17   Citrus clementina [clementine]
ref|XP_006441603.1|  hypothetical protein CICLE_v10020875mg           86.3    8e-17   Citrus clementina [clementine]
gb|KDO41090.1|  hypothetical protein CISIN_1g018681mg                 86.3    8e-17   Citrus sinensis [apfelsine]
ref|XP_010068758.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  86.3    9e-17   Eucalyptus grandis [rose gum]
gb|AET34455.1|  putative S-adenosyl-L-methionine: flavonoid O-met...  85.5    9e-17   Ginkgo biloba [ginkgo]
gb|AEQ59236.1|  putative S-adenosyl-L-methionine:flavonoid O-meth...  85.5    9e-17   Ginkgo biloba [ginkgo]
gb|KJB52492.1|  hypothetical protein B456_008G264900                  86.7    1e-16   Gossypium raimondii
ref|XP_006478222.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  85.9    1e-16   Citrus sinensis [apfelsine]
ref|XP_010537046.1|  PREDICTED: flavone 3'-O-methyltransferase 1      86.3    1e-16   Tarenaya hassleriana [spider flower]
pdb|4PGH|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...  85.9    1e-16   Sorghum bicolor [broomcorn]
pdb|4PGG|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...  85.9    1e-16   Sorghum bicolor [broomcorn]
sp|Q42653.1|OMT2_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...  85.9    1e-16   Chrysosplenium americanum [water-carpet]
ref|XP_002445083.1|  hypothetical protein SORBIDRAFT_07g003860        85.9    1e-16   Sorghum bicolor [broomcorn]
dbj|BAM05584.1|  caffeic acid O-methyltransferase 2                   85.5    1e-16   Eucalyptus globulus subsp. globulus
gb|AAV36354.1|  caffeate O-methyltransferase                          84.0    1e-16   Pinus taeda
gb|AAL57301.1|AF387790_1  O-methyltransferase                         85.9    1e-16   Sorghum bicolor [broomcorn]
emb|CAI30878.1|  caffeate O-methyltransferase                         85.9    1e-16   
gb|KDO40925.1|  hypothetical protein CISIN_1g0357381mg                84.7    1e-16   
ref|XP_004235028.1|  PREDICTED: caffeic acid 3-O-methyltransferase    85.5    1e-16   
gb|AAV36346.1|  caffeate O-methyltransferase                          84.0    1e-16   
sp|Q9XGV9.1|COMT2_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...  85.5    1e-16   
gb|ABK22490.1|  unknown                                               85.5    1e-16   
ref|XP_006829216.1|  hypothetical protein AMTR_s00001p00272250        85.5    2e-16   
emb|CCC55423.1|  caffeic acid O-3-methyltransferase                   85.5    2e-16   
ref|XP_004137204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  85.1    2e-16   
sp|Q9XGW0.1|COMT1_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...  85.1    2e-16   
ref|XP_009387259.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  85.1    2e-16   
ref|XP_010918594.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  85.1    2e-16   
ref|XP_009119951.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...  85.1    2e-16   
gb|AAV36308.1|  caffeate O-methyltransferase                          83.2    2e-16   
ref|XP_009392797.1|  PREDICTED: flavone O-methyltransferase 1-like    85.1    3e-16   
gb|KDO44005.1|  hypothetical protein CISIN_1g018576mg                 84.7    3e-16   
ref|XP_006431772.1|  hypothetical protein CICLE_v10001661mg           84.7    3e-16   
emb|CDY18306.1|  BnaC09g30560D                                        84.7    3e-16   
gb|KDP36008.1|  hypothetical protein JCGZ_10407                       84.7    3e-16   
ref|XP_006478226.1|  PREDICTED: anthranilate N-methyltransferase-...  85.1    4e-16   
dbj|BAM05583.1|  caffeic acid O-methyltransferase 2                   84.0    4e-16   
gb|ABK25932.1|  unknown                                               84.3    4e-16   
ref|XP_009757562.1|  PREDICTED: caffeic acid 3-O-methyltransferase    84.3    4e-16   
emb|CAA52461.1|  catechol O-methyltransferase                         84.3    4e-16   
ref|XP_002320237.1|  eugenol O-methyltransferase family protein       84.3    4e-16   
ref|XP_009608171.1|  PREDICTED: caffeic acid 3-O-methyltransferase    84.3    4e-16   
gb|ABS57468.1|  caffeic acid O-methyl transferase                     84.3    4e-16   
gb|ABK23795.1|  unknown                                               84.3    4e-16   
gb|ADO16247.1|  caffeic acid O-methyltransferase                      84.3    5e-16   
gb|KEH43550.1|  caffeic acid O-methyltransferase                      84.3    5e-16   
ref|XP_010034911.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  84.3    5e-16   
dbj|BAM05582.1|  caffeic acid O-methyltransferase 2                   83.6    5e-16   
gb|AAD50440.1|AF168777_1  caffeic acid O-methyltransferase            83.6    5e-16   
gb|AHY28752.1|  caffeate O-methyltransferase                          84.0    5e-16   
emb|CAA52462.1|  catechol O-methyltransferase                         84.3    5e-16   
ref|XP_008376824.1|  PREDICTED: caffeic acid 3-O-methyltransferase    84.3    5e-16   
ref|XP_003556202.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  84.0    6e-16   
ref|XP_008803441.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  84.0    6e-16   
gb|KCW90804.1|  hypothetical protein EUGRSUZ_A02870                   84.0    6e-16   
gb|AGS49216.1|  O-methyltransferase                                   84.0    6e-16   
gb|AHY28754.1|  caffeate O-methyltransferase                          84.0    6e-16   
ref|XP_010061962.1|  PREDICTED: caffeic acid 3-O-methyltransferase    84.0    6e-16   
ref|XP_008357058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  84.0    7e-16   
gb|AHA44835.1|  caffeate O-methyltransferase                          84.0    7e-16   
gb|AFK45057.1|  unknown                                               82.4    7e-16   
gb|ABI54118.1|  caffeic acid O-methyltransferase                      83.6    7e-16   
ref|XP_008380838.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  83.6    8e-16   
gb|ABI54120.1|  caffeic acid O-methyltransferase                      83.6    9e-16   
gb|KDP37670.1|  hypothetical protein JCGZ_06898                       83.2    1e-15   
ref|XP_006441263.1|  hypothetical protein CICLE_v100208142mg          82.0    1e-15   
gb|KDP24164.1|  hypothetical protein JCGZ_25821                       83.2    1e-15   
ref|XP_003618025.1|  Caffeic acid 3-O-methyltransferase               82.8    1e-15   
ref|XP_006495276.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  81.6    1e-15   
gb|KDO44721.1|  hypothetical protein CISIN_1g036188mg                 81.6    1e-15   
gb|ACO90249.1|  scoulerine 9-O-methyltransferase                      81.3    1e-15   
ref|XP_004156527.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  82.8    1e-15   
ref|XP_011039447.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  82.8    1e-15   
gb|AFK41218.1|  unknown                                               82.8    1e-15   
gb|AET00984.2|  caffeic acid O-methyltransferase                      82.8    1e-15   
gb|AGI97942.1|  caffeic acid O-methyltransferase-like protein         82.8    2e-15   
gb|AHY28757.1|  caffeate O-methyltransferase                          82.4    2e-15   
ref|XP_010911558.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  82.8    2e-15   
gb|AFK48989.1|  unknown                                               82.4    2e-15   
sp|P93324.1|CHOMT_MEDSA  RecName: Full=Isoliquiritigenin 2'-O-met...  82.4    2e-15   
gb|ADI24332.1|  caffeic acid 3-O-methyltransferase                    82.0    3e-15   
ref|XP_007212477.1|  hypothetical protein PRUPE_ppa015120mg           82.0    3e-15   
ref|XP_006478090.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  82.4    3e-15   
gb|AAD48913.1|AF139533_1  caffeate O-methyltransferase                82.4    3e-15   
ref|XP_006436417.1|  hypothetical protein CICLE_v10031953mg           81.3    3e-15   
ref|XP_011075886.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...  82.0    3e-15   
ref|XP_010256417.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  82.0    3e-15   
gb|AAQ01670.1|  catechol O-methyltransferase                          82.0    3e-15   
ref|XP_010107139.1|  Caffeic acid 3-O-methyltransferase               82.0    3e-15   
ref|XP_010100665.1|  Anthranilate N-methyltransferase                 82.0    3e-15   
ref|XP_006441607.1|  hypothetical protein CICLE_v10020880mg           81.6    3e-15   
ref|XP_011084580.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  82.0    3e-15   
dbj|BAO31650.1|  O-methyltransferase                                  81.6    4e-15   
gb|ABR18103.1|  unknown                                               81.6    4e-15   
gb|AAQ67347.1|  caffeic acid 3-O-methyltransferase                    81.6    4e-15   
gb|ACJ76442.1|  caffeic acid 3-O-methyltransferase 2                  81.6    4e-15   
sp|Q43047.1|COMT3_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...  81.6    4e-15   
ref|XP_009386883.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  81.6    4e-15   
ref|XP_002321948.1|  Chain A family protein                           81.6    4e-15   
ref|XP_006485684.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  81.6    4e-15   
sp|O82054.1|COMT1_SACOF  RecName: Full=Caffeic acid 3-O-methyltra...  81.6    4e-15   
gb|ABK23414.1|  unknown                                               81.6    4e-15   
gb|ADN27527.1|  caffeic acid O-methyltransferase                      81.6    4e-15   
sp|O81646.1|COMT1_CAPCH  RecName: Full=Caffeic acid 3-O-methyltra...  81.6    4e-15   
ref|XP_003621331.1|  Isoliquiritigenin 2'-O-methyltransferase         81.6    4e-15   
ref|XP_007223223.1|  hypothetical protein PRUPE_ppa007212mg           81.6    4e-15   
ref|XP_006436416.1|  hypothetical protein CICLE_v10031953mg           81.3    4e-15   
gb|AGS49209.1|  O-methyltransferase                                   81.6    5e-15   
ref|XP_009418618.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...  81.3    5e-15   
gb|KDO39478.1|  hypothetical protein CISIN_1g036218mg                 77.0    5e-15   
gb|ACJ84475.1|  unknown                                               81.6    5e-15   
ref|XP_006494834.1|  PREDICTED: anthranilate N-methyltransferase-...  81.3    5e-15   
ref|XP_008347272.1|  PREDICTED: caffeic acid 3-O-methyltransferase    81.3    5e-15   
ref|XP_009395003.1|  PREDICTED: flavone O-methyltransferase 1-like    82.0    5e-15   
gb|AGS49199.1|  O-methyltransferase                                   81.3    6e-15   
gb|ADK97702.1|  putative caffeic acid O-methyltransferase             80.9    7e-15   
sp|Q43239.1|COMT1_ZINVI  RecName: Full=Caffeic acid 3-O-methyltra...  80.9    7e-15   
ref|XP_008803442.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  80.5    7e-15   
ref|XP_010035325.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  80.9    8e-15   
dbj|BAM05579.1|  caffeic acid O-methyltransferase 1                   80.1    8e-15   
ref|XP_010261275.1|  PREDICTED: LOW QUALITY PROTEIN: (S)-scouleri...  80.9    8e-15   
ref|XP_008219627.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...  80.9    8e-15   
gb|KDP28404.1|  hypothetical protein JCGZ_14175                       80.9    9e-15   
ref|XP_008244204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  80.9    9e-15   
ref|XP_003536383.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  80.9    9e-15   
ref|XP_011003285.1|  PREDICTED: caffeic acid 3-O-methyltransferase 3  80.9    9e-15   
ref|XP_004496361.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  80.9    9e-15   
gb|AAS64572.1|  caffeic acid O-methyltransferase                      80.5    1e-14   
gb|ACF04799.1|  caffeic acid 3-O-methytransferase                     80.5    1e-14   
ref|XP_008352782.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  80.5    1e-14   
gb|KHN00814.1|  Isoliquiritigenin 2'-O-methyltransferase              80.5    1e-14   
gb|AAU20770.1|  (S)-scoulerine 9-O-methyltransferase                  80.5    1e-14   
gb|AFZ78574.1|  caffeic acid O-methyltransferase                      80.5    1e-14   
ref|XP_006436320.1|  hypothetical protein CICLE_v10031951mg           79.3    1e-14   
ref|XP_007019090.1|  Caffeic acid 3-O-methyltransferase 1             80.1    1e-14   
ref|XP_009361268.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  80.5    1e-14   
ref|XP_007015118.1|  Caffeic acid 3-O-methyltransferase 1 isoform 2   79.3    1e-14   
ref|NP_001240974.1|  isoliquiritigenin 2'-O-methyltransferase-like    80.1    1e-14   
gb|AGS49206.1|  O-methyltransferase                                   80.5    1e-14   
ref|XP_008358297.1|  PREDICTED: anthranilate N-methyltransferase-...  80.1    1e-14   
ref|XP_003573470.1|  PREDICTED: flavone O-methyltransferase 1         80.1    1e-14   
gb|KCW89065.1|  hypothetical protein EUGRSUZ_A01392                   79.3    1e-14   
ref|XP_003556208.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...  80.1    1e-14   
gb|AFD61598.1|  caffeic acid 3-O-methyltransferase                    80.1    1e-14   
ref|XP_002302676.2|  eugenol O-methyltransferase family protein       80.1    1e-14   
ref|XP_008348753.1|  PREDICTED: anthranilate N-methyltransferase-...  80.1    1e-14   
gb|AFX98069.1|  caffeic acid O-methyltransferase                      80.1    1e-14   
emb|CDP19753.1|  unnamed protein product                              80.1    1e-14   
gb|KDP32877.1|  hypothetical protein JCGZ_12169                       80.1    1e-14   
ref|XP_006401618.1|  hypothetical protein EUTSA_v10013896mg           80.1    2e-14   
sp|Q9SWC2.1|COMT1_EUCGL  RecName: Full=Caffeic acid 3-O-methyltra...  79.3    2e-14   
gb|AAQ24337.1|  O-methyltransferase                                   79.7    2e-14   
gb|AGS49210.1|  O-methyltransferase                                   79.7    2e-14   
ref|XP_008343466.1|  PREDICTED: anthranilate N-methyltransferase-...  79.7    2e-14   
gb|AAQ24345.1|  O-methyltransferase                                   79.7    2e-14   
ref|XP_006401615.1|  hypothetical protein EUTSA_v10013908mg           79.7    2e-14   
gb|AGS49202.1|  O-methyltransferase                                   79.7    2e-14   
ref|XP_006436319.1|  hypothetical protein CICLE_v10031951mg           79.7    2e-14   
gb|AGS49214.1|  O-methyltransferase                                   79.7    2e-14   
gb|AGS49204.1|  O-methyltransferase                                   79.7    2e-14   
gb|AGS49201.1|  O-methyltransferase                                   79.7    2e-14   
ref|XP_010267679.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  79.7    2e-14   
gb|AAQ24355.1|  O-methyltransferase                                   79.7    2e-14   
gb|AAQ24338.1|  O-methyltransferase                                   79.7    2e-14   
gb|AAQ24339.1|  O-methyltransferase                                   79.3    2e-14   
gb|ABQ58825.1|  flavonoid O-methyltransferase                         79.3    3e-14   
dbj|BAO31651.1|  O-methyltransferase                                  79.3    3e-14   
gb|EMT17011.1|  Caffeic acid 3-O-methyltransferase                    79.3    3e-14   
ref|XP_007015117.1|  Caffeic acid 3-O-methyltransferase 1 isoform 1   79.0    3e-14   
ref|XP_006386660.1|  hypothetical protein POPTR_0002s18130g           79.3    3e-14   
ref|XP_009361271.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  79.3    3e-14   
ref|XP_009418619.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  77.4    3e-14   
ref|XP_006386659.1|  hypothetical protein POPTR_0002s18120g           79.0    3e-14   
ref|XP_006442371.1|  hypothetical protein CICLE_v10024037mg           79.0    3e-14   
ref|XP_010048400.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  79.0    4e-14   
sp|Q38J50.1|FOMT2_WHEAT  RecName: Full=Tricetin 3',4',5'-O-trimet...  79.0    4e-14   
ref|XP_009384387.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  79.0    4e-14   
gb|AGS49196.1|  O-methyltransferase                                   79.0    4e-14   
ref|XP_009384375.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  79.0    4e-14   
emb|CDM87233.1|  unnamed protein product                              79.0    4e-14   
gb|ABP93668.1|  O-methytransferase 4                                  78.6    4e-14   
gb|ABP63535.1|  caffeic acid 3-O-methyltransferase                    78.6    4e-14   
dbj|BAM05581.1|  caffeic acid O-methyltransferase 1                   78.2    5e-14   
ref|XP_010247677.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  78.6    5e-14   
gb|KDP32878.1|  hypothetical protein JCGZ_12170                       78.6    5e-14   
gb|KEH21637.1|  caffeic acid O-methyltransferase                      77.4    5e-14   
ref|XP_006436317.1|  hypothetical protein CICLE_v10031952mg           77.4    5e-14   
gb|EYU19261.1|  hypothetical protein MIMGU_mgv1a026228mg              77.0    7e-14   
ref|XP_002268308.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  78.2    7e-14   
gb|AGS49217.1|  O-methyltransferase                                   78.2    7e-14   
gb|EYU35612.1|  hypothetical protein MIMGU_mgv1a021833mg              77.0    7e-14   
ref|XP_006494578.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  78.2    7e-14   
ref|XP_009361274.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  78.2    8e-14   
gb|EMS55685.1|  Tricetin 3',4',5'-O-trimethyltransferase              77.8    8e-14   
gb|KEH21636.1|  caffeic acid O-methyltransferase                      77.0    8e-14   
gb|AAA80579.1|  3' flavonoid O-methyltransferase                      77.8    8e-14   
ref|XP_008353353.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  77.8    8e-14   
gb|AGS49190.1|  O-methyltransferase                                   78.2    8e-14   
ref|XP_010112212.1|  Caffeic acid 3-O-methyltransferase               78.2    9e-14   
ref|XP_002515087.1|  o-methyltransferase, putative                    77.8    9e-14   
gb|ABP94018.1|  O-methyltransferase                                   77.8    9e-14   
gb|AGS49184.1|  O-methyltransferase                                   77.8    9e-14   
ref|XP_006436309.1|  hypothetical protein CICLE_v10031949mg           76.6    9e-14   
gb|AEI54338.1|  isoliquiritigenin 2'-O-methyltransferase              77.8    9e-14   
ref|XP_006436316.1|  hypothetical protein CICLE_v10031952mg           77.8    1e-13   
gb|KHN00805.1|  Isoliquiritigenin 2'-O-methyltransferase              77.4    1e-13   
ref|XP_007015116.1|  Caffeic acid 3-O-methyltransferase 1             77.8    1e-13   
ref|XP_011025357.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  77.8    1e-13   
ref|XP_006436307.1|  hypothetical protein CICLE_v10031949mg           77.4    1e-13   
gb|AGS49203.1|  O-methyltransferase                                   77.4    1e-13   
ref|XP_006436308.1|  hypothetical protein CICLE_v10031949mg           77.4    1e-13   
ref|XP_009761316.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  77.4    1e-13   
gb|KHN17090.1|  Isoliquiritigenin 2'-O-methyltransferase              77.0    1e-13   
ref|XP_009361272.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  77.0    2e-13   
emb|CDP19755.1|  unnamed protein product                              77.4    2e-13   
ref|XP_004169230.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  75.9    2e-13   
sp|Q39522.1|SMT_COPJA  RecName: Full=(S)-scoulerine 9-O-methyltra...  77.4    2e-13   
gb|ABS18316.1|  caffeic acid-3-O-methyltransferase                    77.0    2e-13   
gb|AGS49197.1|  O-methyltransferase                                   77.0    2e-13   
ref|XP_003621334.1|  O-methyltransferase                              77.0    2e-13   
ref|XP_010541235.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  75.9    2e-13   
ref|XP_010520935.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  76.6    2e-13   
gb|ADP00412.1|  putative methyltransferase                            76.6    2e-13   
gb|AAD10255.1|  caffeic acid O-methyltransferase                      76.6    2e-13   
ref|XP_006472905.1|  PREDICTED: caffeic acid 3-O-methyltransferas...  76.6    2e-13   
gb|AAK68907.1|  caffeic acid O-methyltransferase                      76.6    2e-13   
ref|NP_001266643.1|  quercetin 3-O-methyltransferase 1                76.6    3e-13   
gb|AGS49183.1|  O-methyltransferase                                   76.6    3e-13   
gb|AAD10253.1|  caffeic acid O-methyltransferase                      76.6    3e-13   
gb|AGF25396.1|  caffeic acid 3-O-methyltransferase                    76.6    3e-13   
sp|Q06509.1|COMT1_MAIZE  RecName: Full=Caffeic acid 3-O-methyltra...  76.6    3e-13   
gb|AGS49185.1|  O-methyltransferase                                   76.6    3e-13   
gb|AAQ24348.1|  O-methyltransferase                                   76.6    3e-13   
gb|AGS49188.1|  O-methyltransferase                                   76.6    3e-13   
ref|NP_001106047.1|  catechol O-methyltransferase                     76.6    3e-13   
gb|AGS49181.1|  O-methyltransferase                                   76.6    3e-13   
gb|AAQ24361.1|  O-methyltransferase                                   76.3    3e-13   



>ref|XP_004304330.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 151/177 (85%), Gaps = 0/177 (0%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  214
            E+ N AR+ I+ELANMISVPMSL AV+RLNVADAIWQ GSN PLSAS+IL  VLP+G GD
Sbjct  9    EASNEARIAILELANMISVPMSLNAVVRLNVADAIWQKGSNTPLSASQILERVLPTGSGD  68

Query  215  APNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  394
            A NL+R+LRMLTSYG+F EH NAD SER++S+ EVG+TLVT++DGLSYG YVLQHHQ  +
Sbjct  69   AENLQRILRMLTSYGVFSEHFNADGSERKFSLTEVGQTLVTNQDGLSYGDYVLQHHQDVL  128

Query  395  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            M AWPLVHEAV+D S+EPFVK NGE  Y YYGK PEMN LMQKAMSG+SVPF+KA L
Sbjct  129  MGAWPLVHEAVIDPSVEPFVKANGEPAYQYYGKRPEMNGLMQKAMSGVSVPFIKAVL  185



>gb|KDP29212.1| hypothetical protein JCGZ_16601 [Jatropha curcas]
Length=357

 Score =   280 bits (715),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 153/178 (86%), Gaps = 1/178 (1%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            SES N ARL I+ELANMISVPMSL A++RLNVAD IWQGG+NAPLSASEIL+ V PSGG 
Sbjct  8    SESRNRARLAILELANMISVPMSLNAIVRLNVADVIWQGGANAPLSASEILARVHPSGG-  66

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            D  NL+R+LRMLTSY +F EH+N+DA+ERRYS+ E+GKTLVTD +GLSY +YVLQHHQ A
Sbjct  67   DPENLQRILRMLTSYDVFTEHVNSDATERRYSLTEIGKTLVTDSEGLSYASYVLQHHQDA  126

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M+AWPLVHEAVVD + EPFVK N E  Y+YYGK PEMN LMQKAMSG+SVPFMKA L
Sbjct  127  LMRAWPLVHEAVVDPTTEPFVKANDEPAYAYYGKQPEMNGLMQKAMSGVSVPFMKAIL  184



>ref|XP_008442758.1| PREDICTED: caffeic acid 3-O-methyltransferase [Cucumis melo]
Length=371

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 151/178 (85%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            SE  N ARL I+ELANMISVPMSL A++RLNVADAIWQ GSN+PLSASEIL+ V+PSGGG
Sbjct  21   SEIQNKARLAILELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGGG  80

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            DA NLER+LRMLTSYG+F EH++ ++S  RYS+ +VGKTLVTD DGLSY  YVLQHHQ A
Sbjct  81   DAHNLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDTDGLSYAPYVLQHHQDA  140

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M+AWP VHEA +DS+ EPFV+ NGE  YSYYGK  EMN LMQ+AM+G+SVPFMKA L
Sbjct  141  LMRAWPRVHEAAIDSTTEPFVRANGEPAYSYYGKKTEMNELMQRAMAGVSVPFMKAVL  198



>ref|XP_007027514.1| O-methyltransferase family protein [Theobroma cacao]
 gb|EOY08016.1| O-methyltransferase family protein [Theobroma cacao]
Length=356

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            ++S N ARL I+ELANM+SVPMSL AV+RLNV DAIWQGG+N PLSA++ILS VLPSGGG
Sbjct  6    ADSRNKARLAILELANMMSVPMSLNAVVRLNVPDAIWQGGANTPLSATQILSRVLPSGGG  65

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            D  NL+R+LRMLTSYG+F EH++++  ERR+S+ ++GKTLVTD DGLS   YVLQHHQ A
Sbjct  66   DPENLQRILRMLTSYGVFAEHLDSECPERRFSLTDIGKTLVTDADGLSCAPYVLQHHQDA  125

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M+ WPL+HEAV+D + EPFVKVNGEA YSYYGK PEMN LMQKAMSG+SVPFM+A L
Sbjct  126  LMRVWPLMHEAVLDPTSEPFVKVNGEAAYSYYGKKPEMNGLMQKAMSGVSVPFMRAIL  183



>gb|KJB62321.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=248

 Score =   269 bits (688),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 150/183 (82%), Gaps = 5/183 (3%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  212  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  376
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  377  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            HHQ A+M+AWPLVHEAV++ + EPFVK NGE  YSYYGK PEMN LMQKAMSG+SVPFM+
Sbjct  127  HHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMR  186

Query  557  AFL  565
            A L
Sbjct  187  AIL  189



>gb|KJB62324.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=269

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 150/183 (82%), Gaps = 5/183 (3%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  212  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  376
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  377  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            HHQ A+M+AWPLVHEAV++ + EPFVK NGE  YSYYGK PEMN LMQKAMSG+SVPFM+
Sbjct  127  HHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMR  186

Query  557  AFL  565
            A L
Sbjct  187  AIL  189



>ref|XP_008361606.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X2 [Malus domestica]
Length=278

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 157/190 (83%), Gaps = 3/190 (2%)
 Frame = +2

Query  5    KLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEIL  184
            ++  + A  S S+N ARL I+ELANMISVPMSL AV+RLNV DAIWQGG N PLSAS++L
Sbjct  6    QVSNVTAGPSSSNNEARLAILELANMISVPMSLNAVVRLNVPDAIWQGGCNTPLSASDVL  65

Query  185  SSVLPSGGGDAPNLERLLRMLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLS  355
            + V+P+GGGDA NL+R+LRMLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLS
Sbjct  66   ARVIPNGGGDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLS  125

Query  356  YGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSG  535
            YG YVLQHHQ  +M AWP+VHEAVVDS++EPFVK NGE  Y YYGK PEMN LMQKAMSG
Sbjct  126  YGPYVLQHHQDVLMGAWPMVHEAVVDSTVEPFVKANGELAYEYYGKKPEMNGLMQKAMSG  185

Query  536  ISVPFMKAFL  565
            +SVPFMKA L
Sbjct  186  VSVPFMKAIL  195



>gb|KJB62322.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=258

 Score =   269 bits (688),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 150/183 (82%), Gaps = 5/183 (3%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  212  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  376
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  377  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            HHQ A+M+AWPLVHEAV++ + EPFVK NGE  YSYYGK PEMN LMQKAMSG+SVPFM+
Sbjct  127  HHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMR  186

Query  557  AFL  565
            A L
Sbjct  187  AIL  189



>ref|XP_011101458.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=354

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = +2

Query  26   MGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG  205
            M +   N     IMELANMISVPM+L AV+RLNVADAIWQGGSN PLSA+EILS+     
Sbjct  1    MENSQTNSPTTAIMELANMISVPMALNAVVRLNVADAIWQGGSNNPLSAAEILSAAAVGP  60

Query  206  GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            GGDA NL+R+LR+LTS+G+F EH+NADA++RRYS+ EVGKTL TD++GLSYGAYVLQHHQ
Sbjct  61   GGDAENLQRILRLLTSFGVFEEHLNADATKRRYSLTEVGKTLATDENGLSYGAYVLQHHQ  120

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             A+M+AW LVHEAV+D S EPFVK NGE  YSYYGK PEMN LM KAMSG+SVPFMKAFL
Sbjct  121  DALMRAWTLVHEAVLDPSSEPFVKANGEGAYSYYGKKPEMNELMLKAMSGVSVPFMKAFL  180



>ref|XP_009341082.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Pyrus 
x bretschneideri]
Length=369

 Score =   272 bits (695),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            S S N ARL I+ELANMISVPMSL AV+RLNVADAIWQGG N PLSAS+IL+ VLP+GGG
Sbjct  16   SSSSNEARLAILELANMISVPMSLNAVVRLNVADAIWQGGCNTPLSASDILARVLPNGGG  75

Query  212  DAPNLERLLRMLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
            DA NL+R+LRMLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLSYG YVLQHH
Sbjct  76   DAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQHH  135

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
            Q  +M AWP+VHEAVVDS++EPFVK NGE  Y YYGK PEMN LMQKAMSG+SVPFMKA 
Sbjct  136  QDVLMGAWPMVHEAVVDSTVEPFVKANGEPAYEYYGKKPEMNGLMQKAMSGVSVPFMKAI  195

Query  563  L  565
            L
Sbjct  196  L  196



>gb|KGN59032.1| hypothetical protein Csa_3G747630 [Cucumis sativus]
Length=370

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            SE  N ARL I+ELANMISVPMSL A++RLNVADAIWQ GSN+PLSASEIL+ V+PSGG 
Sbjct  21   SEIQNKARLAIIELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGG-  79

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            DA NLER+LRMLTSYG+F EH++ ++S  RYS+ +VGKTLVTD DGLSY  YVLQHHQ A
Sbjct  80   DAHNLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDSDGLSYAPYVLQHHQDA  139

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M+AWP VHEA +DS+ EPFV+ NGEA YSYYGK  EMN LMQ+AM+G+SVPFMKA L
Sbjct  140  LMRAWPRVHEAAIDSTTEPFVRANGEAAYSYYGKKTEMNELMQRAMAGVSVPFMKAVL  197



>ref|XP_007202084.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
 gb|EMJ03283.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
Length=368

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 155/191 (81%), Gaps = 5/191 (3%)
 Frame = +2

Query  8    LKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILS  187
            +  +     +  N ARL I+ELANMISVPMSL AV+RLNV DAIWQGGSN+PLSAS ILS
Sbjct  5    VSHVTTTAEQPSNEARLGILELANMISVPMSLNAVVRLNVPDAIWQGGSNSPLSASAILS  64

Query  188  SVLPSGGGDAPNLERLLRMLTSYGIFREH-INAD----ASERRYSVDEVGKTLVTDKDGL  352
             VLP GGGDA NL+R+LRMLTSYG+F EH ++AD    + +R++S+ E+GKTLVTD++GL
Sbjct  65   HVLPDGGGDAENLQRILRMLTSYGVFAEHLVSADDDGGSHQRKFSLTEIGKTLVTDQNGL  124

Query  353  SYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMS  532
            SYG Y+LQHHQ  +M AWP+VHEAVVD +IEPFVKVNGE  Y YYGK PEMN LMQ+AMS
Sbjct  125  SYGPYILQHHQDVLMGAWPMVHEAVVDPTIEPFVKVNGEPAYEYYGKKPEMNGLMQRAMS  184

Query  533  GISVPFMKAFL  565
            G+SVPFMKA L
Sbjct  185  GVSVPFMKAIL  195



>gb|KJB62323.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=347

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 150/183 (82%), Gaps = 5/183 (3%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  212  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  376
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  377  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            HHQ A+M+AWPLVHEAV++ + EPFVK NGE  YSYYGK PEMN LMQKAMSG+SVPFM+
Sbjct  127  HHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMR  186

Query  557  AFL  565
            A L
Sbjct  187  AIL  189



>ref|XP_004137858.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 ref|XP_004169388.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=409

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            SE  N ARL I+ELANMISVPMSL A++RLNVADAIWQ GSN+PLSASEIL+ V+PSGG 
Sbjct  58   SEIQNKARLAIIELANMISVPMSLNAIVRLNVADAIWQNGSNSPLSASEILARVVPSGG-  116

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            DA NLER+LRMLTSYG+F EH++ ++S  RYS+ +VGKTLVTD DGLSY  YVLQHHQ A
Sbjct  117  DAHNLERILRMLTSYGVFEEHLSPNSSNHRYSLTDVGKTLVTDSDGLSYAPYVLQHHQDA  176

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M+AWP VHEA +DS+ EPFV+ NGEA YSYYGK  EMN LMQ+AM+G+SVPFMKA L
Sbjct  177  LMRAWPRVHEAAIDSTTEPFVRANGEAAYSYYGKKTEMNELMQRAMAGVSVPFMKAVL  234



>gb|KJB62320.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=361

 Score =   270 bits (689),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 150/183 (82%), Gaps = 5/183 (3%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLS  +ILS VLPSGGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSVVQILSRVLPSGGG  66

Query  212  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  376
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  377  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            HHQ A+M+AWPLVHEAV++ + EPFVK NGE  YSYYGK PEMN LMQKAMSG+SVPFM+
Sbjct  127  HHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMR  186

Query  557  AFL  565
            A L
Sbjct  187  AIL  189



>gb|KHG05883.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=361

 Score =   269 bits (688),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 150/183 (82%), Gaps = 5/183 (3%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +ES N ARL IMELANMISVPMSL A++RLNV DAIWQGG+N PLSA +ILS VLP GGG
Sbjct  7    AESSNKARLAIMELANMISVPMSLNAIVRLNVPDAIWQGGANTPLSAVQILSRVLPYGGG  66

Query  212  DAPNLERLLRMLTSYGIFREHINAD-----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  376
            D  NL+R+LRMLTSYG+F EH+N       + ER+YS+ ++GKTLVTD +GLSY  YVLQ
Sbjct  67   DPENLQRILRMLTSYGVFDEHLNCSGDDSHSPERKYSLTDIGKTLVTDAEGLSYAPYVLQ  126

Query  377  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            HHQ A+M+AWPLVHEAV++ + EPFVK NGE  YSYYGK PEMN LMQKAMSG+SVPFM+
Sbjct  127  HHQDALMRAWPLVHEAVLNPTSEPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMR  186

Query  557  AFL  565
            A L
Sbjct  187  AIL  189



>ref|XP_008361604.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X1 [Malus domestica]
Length=281

 Score =   265 bits (676),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 157/193 (81%), Gaps = 6/193 (3%)
 Frame = +2

Query  5    KLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEIL  184
            ++  + A  S S+N ARL I+ELANMISVPMSL AV+RLNV DAIWQGG N PLSAS++L
Sbjct  6    QVSNVTAGPSSSNNEARLAILELANMISVPMSLNAVVRLNVPDAIWQGGCNTPLSASDVL  65

Query  185  SSVLPSGGGDAPNLERLLRMLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLS  355
            + V+P+GGGDA NL+R+LRMLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLS
Sbjct  66   ARVIPNGGGDAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLS  125

Query  356  YGAYVLQHHQA---AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKA  526
            YG YVLQHHQ     +M AWP+VHEAVVDS++EPFVK NGE  Y YYGK PEMN LMQKA
Sbjct  126  YGPYVLQHHQLFKDVLMGAWPMVHEAVVDSTVEPFVKANGELAYEYYGKKPEMNGLMQKA  185

Query  527  MSGISVPFMKAFL  565
            MSG+SVPFMKA L
Sbjct  186  MSGVSVPFMKAIL  198



>ref|XP_009341081.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X1 [Pyrus 
x bretschneideri]
Length=372

 Score =   266 bits (681),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 153/184 (83%), Gaps = 6/184 (3%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            S S N ARL I+ELANMISVPMSL AV+RLNVADAIWQGG N PLSAS+IL+ VLP+GGG
Sbjct  16   SSSSNEARLAILELANMISVPMSLNAVVRLNVADAIWQGGCNTPLSASDILARVLPNGGG  75

Query  212  DAPNLERLLRMLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
            DA NL+R+LRMLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLSYG YVLQHH
Sbjct  76   DAENLQRILRMLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQHH  135

Query  383  QA---AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFM  553
            Q     +M AWP+VHEAVVDS++EPFVK NGE  Y YYGK PEMN LMQKAMSG+SVPFM
Sbjct  136  QLFKDVLMGAWPMVHEAVVDSTVEPFVKANGEPAYEYYGKKPEMNGLMQKAMSGVSVPFM  195

Query  554  KAFL  565
            KA L
Sbjct  196  KAIL  199



>ref|XP_006367254.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Solanum tuberosum]
Length=361

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 149/173 (86%), Gaps = 1/173 (1%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSGGGDAPNL  226
            ARL IMELANMISVPMSL AV++L VADAIWQ GSNAPLS  EIL+ +  P GGGDA NL
Sbjct  15   ARLAIMELANMISVPMSLNAVVKLKVADAIWQNGSNAPLSPVEILAKIRGPQGGGDAENL  74

Query  227  ERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAW  406
            +R+LRMLTSYG+F+EH+  D+S+RRYS+ EVGKTLVTD++GLS+G+YVLQHHQ A+M+AW
Sbjct  75   QRILRMLTSYGVFKEHVVDDSSQRRYSLTEVGKTLVTDENGLSHGSYVLQHHQDALMRAW  134

Query  407  PLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             +VHEAV DSSIEPFVK NGE  Y+YYGKN EMNSLM  AMSG+SVPFMKA L
Sbjct  135  TMVHEAVNDSSIEPFVKANGEPAYNYYGKNSEMNSLMLNAMSGVSVPFMKAIL  187



>ref|XP_004488687.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=353

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 147/178 (83%), Gaps = 2/178 (1%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            ++S   ARL I+ELANMISVPMSL AV+RLNVADAIW+GGSNAPLSA +IL  VLP GGG
Sbjct  5    TDSRKQARLSILELANMISVPMSLNAVVRLNVADAIWEGGSNAPLSADQILKRVLPGGGG  64

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            DA NL+R+LRMLTSY +F EH+     ER+YS+ +VGKTLVTD+ GLSYG+YVLQHHQ A
Sbjct  65   DAENLQRVLRMLTSYDVFEEHLGG--GERKYSLTDVGKTLVTDEQGLSYGSYVLQHHQDA  122

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M+AWPLVHEAVVD S EPF + NGEA Y YY K PEMN LM KAMSG+SVPFMKA L
Sbjct  123  LMRAWPLVHEAVVDPSKEPFERANGEAAYDYYLKKPEMNELMLKAMSGVSVPFMKALL  180



>ref|XP_008241354.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=368

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 148/182 (81%), Gaps = 5/182 (3%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  214
            +  N ARL I+ELANMISVPMSL AV+RLNV DAIWQ GSN PLSAS IL+ VLP GGGD
Sbjct  14   QPSNEARLGILELANMISVPMSLNAVVRLNVPDAIWQAGSNTPLSASAILARVLPDGGGD  73

Query  215  APNLERLLRMLTSYGIFREHI-----NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  379
            A NL+R+LRMLTSYG+F EH+     +  + +R++S+ E+GKTLVTD++GLSYG Y+LQH
Sbjct  74   AENLQRILRMLTSYGVFEEHLIKEDDDGGSQQRKFSLTEIGKTLVTDQNGLSYGPYILQH  133

Query  380  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  559
            HQ  +M AWP+VHEAVVD ++EPFVK NGE  Y YYGK PEMN LMQ+AMSG+SVPFMKA
Sbjct  134  HQDVLMGAWPMVHEAVVDPTVEPFVKANGEPAYEYYGKKPEMNGLMQRAMSGVSVPFMKA  193

Query  560  FL  565
             L
Sbjct  194  IL  195



>emb|CAN65776.1| hypothetical protein VITISV_030414 [Vitis vinifera]
Length=358

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 148/181 (82%), Gaps = 6/181 (3%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  214
            ES N ARL I+EL NMISVPM L A++RLNV DAIWQGGSNAPLSAS+IL+ VLPSG  D
Sbjct  7    ESRNQARLAILELTNMISVPMCLHAIVRLNVPDAIWQGGSNAPLSASQILTRVLPSG--D  64

Query  215  APNLERLLRMLTSYGIFREHINADASE----RRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
              NL+R+LR+LT+YG+F EH+  D S     R+YS+ ++GKTLVTD DGLSYGAYVLQH+
Sbjct  65   PHNLQRILRLLTTYGVFAEHLLTDPSSDQVLRKYSLTDIGKTLVTDADGLSYGAYVLQHY  124

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
            Q  +M AWPLVHEAVVDS+ EPFVK NGE  YSYYGK PEMN LMQ+AMSG+SVPFMKA 
Sbjct  125  QEELMTAWPLVHEAVVDSTTEPFVKANGEPAYSYYGKKPEMNDLMQRAMSGVSVPFMKAI  184

Query  563  L  565
            L
Sbjct  185  L  185



>ref|XP_002264566.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=358

 Score =   264 bits (674),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 148/181 (82%), Gaps = 6/181 (3%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  214
            ES N ARL I+EL NMISVPM L A++RLNV DAIWQGGSNAPLSAS+IL+ VLPSG  D
Sbjct  7    ESRNQARLAILELTNMISVPMCLHAIVRLNVPDAIWQGGSNAPLSASQILTRVLPSG--D  64

Query  215  APNLERLLRMLTSYGIFREHINADASE----RRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
              NL+R+LR+LT+YG+F EH+  D S     R+YS+ ++GKTLVTD DGLSYGAYVLQH+
Sbjct  65   PHNLQRILRLLTTYGVFAEHLLTDPSSDQVLRKYSLTDIGKTLVTDADGLSYGAYVLQHY  124

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
            Q  +M AWPLVHEAVVDS+ EPFVK NGE  YSYYGK PEMN LMQ+AMSG+SVPFMKA 
Sbjct  125  QEELMTAWPLVHEAVVDSTTEPFVKANGEPAYSYYGKKPEMNDLMQRAMSGVSVPFMKAI  184

Query  563  L  565
            L
Sbjct  185  L  185



>ref|XP_006428524.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
 gb|ESR41764.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
Length=261

 Score =   260 bits (664),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = +2

Query  53   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLER  232
            RL IMELANMISVPMSL A IRL+V DAIWQGG+N PLSAS+IL+ +LPSGGGDA NL+R
Sbjct  14   RLAIMELANMISVPMSLTAAIRLHVPDAIWQGGANTPLSASQILTRILPSGGGDAENLQR  73

Query  233  LLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  412
            +LR+LTSYG+F EH      ER+YS+ E+GK+LVTD +GLSY  YVLQHHQ A+M AWPL
Sbjct  74   ILRLLTSYGVFSEH-REFGGERKYSLTEIGKSLVTDAEGLSYAPYVLQHHQDALMSAWPL  132

Query  413  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            VHEAV+D +IEPFVKV+GE  YSYYGK PEMN LM+KAMSG+SVPFM + L
Sbjct  133  VHEAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVL  183



>ref|XP_006367255.1| PREDICTED: caffeic acid 3-O-methyltransferase 2-like [Solanum 
tuberosum]
Length=360

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  229
            ARL IMELANMISVPMSL A+I+L VADAIW+GGSNAPLS +EIL+ + P GGGDA NL+
Sbjct  16   ARLAIMELANMISVPMSLNAIIKLKVADAIWEGGSNAPLSPAEILAKIRPQGGGDAENLQ  75

Query  230  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  409
            R+LRMLTSY +F EH+  D S+RRYS+ EVGKTLVTD++GLS+G YVLQHHQ A+M+ W 
Sbjct  76   RILRMLTSYRVFEEHVVDDGSQRRYSLTEVGKTLVTDENGLSHGLYVLQHHQDALMRVWT  135

Query  410  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +VHE V DSS +PFVKV GE PYSYYGKNPEMNSLM  AMSG+S+PFMK  L
Sbjct  136  MVHETVNDSSSDPFVKVYGEQPYSYYGKNPEMNSLMFNAMSGVSMPFMKVML  187



>gb|AFK33955.1| unknown [Medicago truncatula]
Length=201

 Score =   254 bits (649),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +E+   ARL I+ELANMIS+PMSL AV+RLNVADAIW+GG+NAPLSA++IL+ V+P GGG
Sbjct  6    TEAQKQARLAILELANMISIPMSLHAVVRLNVADAIWEGGANAPLSAAQILARVVPGGGG  65

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            DA NL+R+LRML SYG+F EHI     ER+YS+  VGKTLV+D++G+SYGAYVLQ HQ A
Sbjct  66   DAENLQRVLRMLASYGVFEEHIGD--GERKYSLTNVGKTLVSDENGVSYGAYVLQLHQDA  123

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M+AWPLVHEAV+D S EPF + NGE  Y YY K PEMN LM KAM+G+SVPFMKA  
Sbjct  124  LMRAWPLVHEAVLDPSKEPFERANGEGAYDYYLKKPEMNELMLKAMAGVSVPFMKALF  181



>ref|XP_010050337.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 149/182 (82%), Gaps = 4/182 (2%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            S++ N ARLRI+ELANMISVPMSL AV+RL V DA+WQGGSNAPLSASEIL+    +  G
Sbjct  6    SDARNAARLRILELANMISVPMSLNAVVRLGVPDALWQGGSNAPLSASEILARSPAAPAG  65

Query  212  DAPNLERLLRMLTSYGIFREHINADAS----ERRYSVDEVGKTLVTDKDGLSYGAYVLQH  379
            DA NL+RLLRML S+G+F EH+   AS    ERRYS+ EVGKTLVTD +GLSY  YVLQH
Sbjct  66   DAENLQRLLRMLASHGVFEEHVAPAASSASSERRYSLTEVGKTLVTDAEGLSYAPYVLQH  125

Query  380  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  559
            HQ A+M+AWPLVHEAV+D + EPFVK NG+  Y++YGKNPEMN LMQ+AMSG+SVPFMKA
Sbjct  126  HQDALMRAWPLVHEAVLDPATEPFVKANGDTAYAHYGKNPEMNKLMQRAMSGVSVPFMKA  185

Query  560  FL  565
             L
Sbjct  186  IL  187



>ref|XP_002519426.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF42840.1| o-methyltransferase, putative [Ricinus communis]
Length=357

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 149/180 (83%), Gaps = 3/180 (2%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            SE+   A+L I+ELANMISVPMSL AV++LNVADAIWQ G N+PLSASEILS +  SGG 
Sbjct  6    SETRKNAKLAIIELANMISVPMSLNAVVQLNVADAIWQNGVNSPLSASEILSRINLSGG-  64

Query  212  DAPNLERLLRMLTSYGIFREHINA--DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            D  NL+R+LRML+SY +F EH++A    +ERRYS+ E+GKTLVTD +GLSYGAYVLQHHQ
Sbjct  65   DPDNLQRILRMLSSYNVFTEHLSAVDGVTERRYSLTEIGKTLVTDVNGLSYGAYVLQHHQ  124

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             A+M+AWPLVHEAV+DS+ EPF K NGE  Y YYGK PEMN LMQKAMSG+SVPFMKA L
Sbjct  125  DALMRAWPLVHEAVLDSTTEPFAKANGEPAYDYYGKRPEMNELMQKAMSGLSVPFMKAVL  184



>gb|KEH38506.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=354

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 147/178 (83%), Gaps = 2/178 (1%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +E+   ARL I+ELANMIS+PMSL AV+RLNVADAIW+GG+NAPLSA++IL+ V+P GGG
Sbjct  6    TEAQKQARLAILELANMISIPMSLHAVVRLNVADAIWEGGANAPLSAAQILARVVPGGGG  65

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            DA NL+R+LRML SYG+F EHI     ER+YS+  VGKTLV+D++G+SYGAYVLQHHQ A
Sbjct  66   DAENLQRVLRMLASYGVFEEHIGD--GERKYSLTNVGKTLVSDENGVSYGAYVLQHHQDA  123

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M+AWPLVHEAV+D S EPF + NGE  Y YY K PEMN LM KAM+G+SVPFMKA  
Sbjct  124  LMRAWPLVHEAVLDPSKEPFERANGEGAYDYYLKKPEMNELMLKAMAGVSVPFMKALF  181



>ref|XP_006381360.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59157.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=270

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 144/185 (78%), Gaps = 8/185 (4%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +E    ARL I ELANMISVPMSL A++RL VADAIWQGGSNAPLSAS+IL  +  S G 
Sbjct  8    AEKRKSARLAIFELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRIA-STGS  66

Query  212  DAPNLERLLRMLTSYGIFREHINADAS-------ERRYSVDEVGKTLVTDKDGLSYGAYV  370
            D  NL+R+LRMLTSYG+F EH+  ++S       ER+YS+ EVGKTLVTD +GLSY  YV
Sbjct  67   DPENLQRILRMLTSYGVFEEHLTIESSPLDGSVSERKYSLTEVGKTLVTDTEGLSYAPYV  126

Query  371  LQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPF  550
            LQHHQ A+MKAWPLVHEAV+D + EPFVK NGE  Y YYGK PEMN LM KAMSG+SVPF
Sbjct  127  LQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYGKQPEMNELMLKAMSGVSVPF  186

Query  551  MKAFL  565
            M+A L
Sbjct  187  MEAML  191



>ref|XP_006594705.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X2 
[Glycine max]
Length=298

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 147/178 (83%), Gaps = 2/178 (1%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +E    ARL IMELANMISVPM+L AV+RLNVADAIWQGG+N PLSA+EIL  +LP+GGG
Sbjct  7    TEQRKQARLAIMELANMISVPMALNAVVRLNVADAIWQGGANNPLSAAEILPRLLPAGGG  66

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            DA NL+RLLRML SYG+F EH++A   ER+YS+ +VGKTLVTD+ GLSY  YVLQHHQ A
Sbjct  67   DAENLQRLLRMLASYGVFYEHLSA--GERKYSLTDVGKTLVTDEQGLSYAHYVLQHHQDA  124

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M+AWP+VHEAVVD + EPF + NGE  Y YY K+PEMN LM +AMSG+SVPF++A L
Sbjct  125  LMRAWPMVHEAVVDPTKEPFERANGEPAYGYYLKHPEMNDLMVRAMSGVSVPFIRAML  182



>ref|XP_010312333.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Solanum lycopersicum]
Length=361

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 146/172 (85%), Gaps = 2/172 (1%)
 Frame = +2

Query  53   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSGGGDAPNLE  229
            RL IMELANMISVPMSL AV++L V DA+W+ GSNAPLS  EIL+ +  P GGGDA NL+
Sbjct  17   RLAIMELANMISVPMSLNAVVKLKVTDAVWENGSNAPLSPVEILAKIRGPQGGGDAENLQ  76

Query  230  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  409
            R+LRMLTSYG+F+EH++ D S+RRYS+ +VGKTLVTD++GLS+G+YVLQHHQ A+MKAW 
Sbjct  77   RILRMLTSYGVFKEHVD-DGSQRRYSLTKVGKTLVTDENGLSHGSYVLQHHQDALMKAWT  135

Query  410  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +VHEAV DSSIEPF K NGE  YSYYGKN EMNSLM  AMSG+SVPFMKA L
Sbjct  136  MVHEAVNDSSIEPFAKANGEPAYSYYGKNSEMNSLMLNAMSGVSVPFMKAIL  187



>ref|XP_011018830.1| PREDICTED: caffeic acid 3-O-methyltransferase [Populus euphratica]
Length=364

 Score =   256 bits (654),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 145/185 (78%), Gaps = 8/185 (4%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +E    ARL I+ELANMISVPMSL A++RL VADAIWQGGSNAPLSAS+IL  +  S G 
Sbjct  8    AEKRKSARLAILELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRI-ASTGS  66

Query  212  DAPNLERLLRMLTSYGIFREHI-------NADASERRYSVDEVGKTLVTDKDGLSYGAYV  370
            D  NL+R+LRMLTSYG+F EH+       +  ASER+YS+ EVGKTLVTD +GLSY  YV
Sbjct  67   DPENLQRILRMLTSYGVFEEHLTNESSPLDGSASERKYSLTEVGKTLVTDTEGLSYAPYV  126

Query  371  LQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPF  550
            LQHHQ A+MKAWPLVHEAV+D + EPFVK NGE  Y YYGK PEMN LM KAMSG+SVPF
Sbjct  127  LQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYGKQPEMNELMLKAMSGVSVPF  186

Query  551  MKAFL  565
            M+A L
Sbjct  187  MEAML  191



>ref|XP_006594704.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Glycine max]
Length=355

 Score =   256 bits (654),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 147/178 (83%), Gaps = 2/178 (1%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +E    ARL IMELANMISVPM+L AV+RLNVADAIWQGG+N PLSA+EIL  +LP+GGG
Sbjct  7    TEQRKQARLAIMELANMISVPMALNAVVRLNVADAIWQGGANNPLSAAEILPRLLPAGGG  66

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            DA NL+RLLRML SYG+F EH++A   ER+YS+ +VGKTLVTD+ GLSY  YVLQHHQ A
Sbjct  67   DAENLQRLLRMLASYGVFYEHLSA--GERKYSLTDVGKTLVTDEQGLSYAHYVLQHHQDA  124

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M+AWP+VHEAVVD + EPF + NGE  Y YY K+PEMN LM +AMSG+SVPF++A L
Sbjct  125  LMRAWPMVHEAVVDPTKEPFERANGEPAYGYYLKHPEMNDLMVRAMSGVSVPFIRAML  182



>ref|XP_010267318.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nelumbo nucifera]
Length=354

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 143/178 (80%), Gaps = 2/178 (1%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +E  N ARL I+ELANMISVPMSL A++RL V DAIWQ GSN PLSASEIL+  LP+G  
Sbjct  6    TEIRNNARLAILELANMISVPMSLNAIVRLKVPDAIWQSGSNVPLSASEILARALPTG--  63

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            D  NL+R+LRMLT+Y +F EHI   +SER+YS+ E+GKTLVTD +GLSY AYVLQHHQ A
Sbjct  64   DPENLQRILRMLTTYDVFSEHIADGSSERKYSLTEIGKTLVTDGEGLSYAAYVLQHHQDA  123

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +MKAWP++HEAVVD   EPFVK NGE  YSYYG   EMN LMQKAMSG+SVPFMKA L
Sbjct  124  LMKAWPILHEAVVDPKEEPFVKANGEPAYSYYGDKSEMNELMQKAMSGVSVPFMKAIL  181



>ref|XP_006381361.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59158.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=364

 Score =   254 bits (649),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 144/185 (78%), Gaps = 8/185 (4%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +E    ARL I ELANMISVPMSL A++RL VADAIWQGGSNAPLSAS+IL  +  S G 
Sbjct  8    AEKRKSARLAIFELANMISVPMSLNAIVRLKVADAIWQGGSNAPLSASQILQRI-ASTGS  66

Query  212  DAPNLERLLRMLTSYGIFREHINADAS-------ERRYSVDEVGKTLVTDKDGLSYGAYV  370
            D  NL+R+LRMLTSYG+F EH+  ++S       ER+YS+ EVGKTLVTD +GLSY  YV
Sbjct  67   DPENLQRILRMLTSYGVFEEHLTIESSPLDGSVSERKYSLTEVGKTLVTDTEGLSYAPYV  126

Query  371  LQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPF  550
            LQHHQ A+MKAWPLVHEAV+D + EPFVK NGE  Y YYGK PEMN LM KAMSG+SVPF
Sbjct  127  LQHHQDALMKAWPLVHEAVLDPTTEPFVKANGEPAYDYYGKQPEMNELMLKAMSGVSVPF  186

Query  551  MKAFL  565
            M+A L
Sbjct  187  MEAML  191



>ref|XP_011098295.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=355

 Score =   251 bits (642),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = +2

Query  44   NGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN  223
            N   L IMELAN++SVPMSL AVI+L V D IWQ GSN PLSA+EILS++     GDA N
Sbjct  7    NSPILAIMELANLVSVPMSLNAVIKLKVLDTIWQDGSNNPLSAAEILSAIALGPAGDAEN  66

Query  224  LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKA  403
            L+R+LR+LTSYG+F EHI  D  ERRYS+ EVGK L  D++GLSY  Y+LQHHQ A+M A
Sbjct  67   LQRILRLLTSYGVFDEHIGKDGRERRYSLTEVGKALAADENGLSYAPYILQHHQDALMLA  126

Query  404  WPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            WP VHEAV+D S EPFVKV+GE PYSYYGKNPEMN LMQKAMSG+SVPFM+ FL
Sbjct  127  WPRVHEAVLDPSSEPFVKVHGELPYSYYGKNPEMNLLMQKAMSGVSVPFMETFL  180



>ref|XP_007149437.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
 gb|ESW21431.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
Length=354

 Score =   251 bits (640),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 145/178 (81%), Gaps = 2/178 (1%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            ++S   +RL IMELANMISVPM+L AV+RLNVADAIW GG+NAPLSA++IL  +LP G G
Sbjct  6    TDSRKQSRLAIMELANMISVPMALNAVVRLNVADAIWNGGANAPLSAAQILPRILPVGDG  65

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            DA NL+RLLR+LTSYG+F EH+ A   ER+YS+ +VGK LVTD+ GLSYGAYVLQHHQ A
Sbjct  66   DAENLQRLLRILTSYGVFHEHLAA--GERKYSLTDVGKALVTDEQGLSYGAYVLQHHQDA  123

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M+AW LVHEAVVD + EPF + NGE  Y+YY K  EMN LM KAMSG+SVPFM+A L
Sbjct  124  LMRAWTLVHEAVVDPTKEPFERANGEGAYAYYLKQAEMNELMVKAMSGVSVPFMRAML  181



>ref|XP_006291371.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
 gb|EOA24269.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
Length=359

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 147/182 (81%), Gaps = 5/182 (3%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSG-  205
            SES N ARL IMELANMISVPMSL A +RL +ADAIW GG+N+PLSASEIL  +L PS  
Sbjct  6    SESRNRARLAIMELANMISVPMSLNAAVRLGIADAIWNGGANSPLSASEILPRLLIPSAT  65

Query  206  --GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  379
              GGD  NL+R+LRMLTSYG+F EH+   +SER++S+ +VGKTLVTD DGLSY AY+LQH
Sbjct  66   TTGGDPENLQRILRMLTSYGVFSEHL-VGSSERKFSLTDVGKTLVTDSDGLSYAAYILQH  124

Query  380  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  559
            HQ A+M+AWPLVH AVV+   EP+VK NGEA Y  YGK+ EMNSLM KAMSG+SVPFMKA
Sbjct  125  HQEALMRAWPLVHTAVVEPETEPYVKANGEAAYVQYGKSEEMNSLMLKAMSGVSVPFMKA  184

Query  560  FL  565
             L
Sbjct  185  IL  186



>ref|XP_006598126.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=356

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 142/179 (79%), Gaps = 3/179 (2%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLP-SGG  208
            +E    A L IMELANMISVPM+L AV+RLNVADA+WQGG+NAPLSASEIL  +LP + G
Sbjct  7    TEQRKQAMLAIMELANMISVPMALNAVVRLNVADALWQGGANAPLSASEILPRILPGADG  66

Query  209  GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  388
             DA NL+RLLRML SYG+FREH+ A   ER YS+ EVGKTLVTD+ GLSY  YVLQHHQ 
Sbjct  67   ADAENLQRLLRMLASYGVFREHLAA--GERNYSLTEVGKTLVTDEQGLSYAHYVLQHHQD  124

Query  389  AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            A+M+AWPLVHEAVVD + EPF   NGE  Y YY K PEMN LM +AMSG+SVPFM+A L
Sbjct  125  ALMRAWPLVHEAVVDPTKEPFEMANGEPAYGYYLKQPEMNDLMVRAMSGVSVPFMRAML  183



>ref|XP_010504072.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=385

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = +2

Query  11   KEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSS  190
            K++    SES N ARL I+ELANMISVPMSL A ++L +ADAIW GG+N+PLSA+EILS 
Sbjct  29   KKMEKESSESRNRARLAILELANMISVPMSLNAAVKLGIADAIWNGGANSPLSAAEILSR  88

Query  191  VLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYV  370
            +L   GGD  NL+R+LR LTSYG+F EH+   ++ER+YS+ +VGKTLVTD  GLSY AYV
Sbjct  89   LLLQSGGDPENLQRILRTLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDSGGLSYAAYV  147

Query  371  LQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPF  550
            LQHHQ A+M+AWPLVH AVV+   EP+VK NGEA Y  YGKN EMN LM KAMSG+SVPF
Sbjct  148  LQHHQDALMRAWPLVHTAVVEPETEPYVKANGEAAYVQYGKNEEMNDLMLKAMSGVSVPF  207

Query  551  MKAFL  565
            MKA L
Sbjct  208  MKAIL  212



>ref|XP_006403721.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
 gb|ESQ45174.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
Length=361

 Score =   248 bits (633),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 142/183 (78%), Gaps = 5/183 (3%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG--  205
            SES N ARL IMELANMISVPMSL A ++L +ADAIW  G+N+PLSA+EIL  +L S   
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVKLGIADAIWNAGANSPLSAAEILPRLLLSSST  65

Query  206  ---GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  376
                GD  NL+R+LRMLTSYG+F EHIN  + ER+YS+ +VGKTLVTD  GLSY AYVLQ
Sbjct  66   TTIAGDPENLQRILRMLTSYGVFSEHINGSSVERKYSLTDVGKTLVTDSGGLSYAAYVLQ  125

Query  377  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            HHQ A+M+AWPLVH AV++   EP+VK NGEA YS YGK  EMN LMQKAMSG+S PFMK
Sbjct  126  HHQEALMRAWPLVHTAVMEPETEPYVKANGEAAYSQYGKCEEMNGLMQKAMSGVSAPFMK  185

Query  557  AFL  565
            A L
Sbjct  186  AIL  188



>ref|XP_010426946.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=356

 Score =   248 bits (633),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSGG  208
            SES N ARL I+ELANMISVPMSL A ++L +ADAIW  G+N+PLSA+EIL  +L PSGG
Sbjct  6    SESRNRARLAILELANMISVPMSLNAAVKLGIADAIWNDGTNSPLSAAEILPRLLLPSGG  65

Query  209  GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  388
            GD  NL+R+LRMLTSYG+F EH+   ++ER+YS+ +VGKTLVTD  GLSY AYVLQHHQ 
Sbjct  66   GDPENLQRILRMLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDSGGLSYAAYVLQHHQD  124

Query  389  AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            A+M+AWPLVH AVV+   EP+VK NGE  Y  YGKN EMN LM KAMSG+SVPFMKA L
Sbjct  125  ALMRAWPLVHTAVVEPETEPYVKANGEGAYVQYGKNEEMNGLMLKAMSGVSVPFMKAIL  183



>ref|XP_006391885.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
 gb|ESQ29171.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
Length=363

 Score =   248 bits (633),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 144/185 (78%), Gaps = 7/185 (4%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSG-  205
            SES N ARL IMELANMISVPMSL A +RL +ADAIW  G+N+PLSASEIL  +L PS  
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVRLGIADAIWNSGANSPLSASEILPRLLLPSRD  65

Query  206  ---GGDAPNLERLLRMLTSYGIFREHINADAS--ERRYSVDEVGKTLVTDKDGLSYGAYV  370
               GGD  NL+R+LRMLTSYG+F EH+N DA   ER+YS+  VGKTLVTD  GLSY AYV
Sbjct  66   STIGGDPENLQRILRMLTSYGVFSEHLNGDAGSVERKYSLTNVGKTLVTDSGGLSYAAYV  125

Query  371  LQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPF  550
            LQHHQ ++M+AWPLVH AVV+   EP+VK NGEA Y  YGK  EMN LMQKAMSG+SVPF
Sbjct  126  LQHHQESLMRAWPLVHTAVVEPETEPYVKANGEAAYVQYGKCEEMNGLMQKAMSGVSVPF  185

Query  551  MKAFL  565
            MKA L
Sbjct  186  MKAIL  190



>ref|XP_010098845.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB75933.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=359

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 143/183 (78%), Gaps = 7/183 (4%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            SE  N ARL+++ELANMISVPMSL AV+RL V DAIWQ GSN+PLSAS+IL+ VLPS   
Sbjct  6    SEKRNQARLKVLELANMISVPMSLNAVVRLGVPDAIWQSGSNSPLSASQILTRVLPSSSS  65

Query  212  -----DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  376
                 D  NL+RLLR LTSYG+F EHI+ +   R+YS+ +VGKTLVTD DGLSY  YVLQ
Sbjct  66   SAASADPDNLQRLLRTLTSYGVFSEHISGEI--RKYSLTDVGKTLVTDSDGLSYAPYVLQ  123

Query  377  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            HHQ A+M+AW L+HEAVVD + EPF K NGE  Y YYGK PEMN LMQ+AMSG+SVPFMK
Sbjct  124  HHQDALMRAWSLLHEAVVDPTTEPFAKANGEPAYKYYGKMPEMNGLMQRAMSGVSVPFMK  183

Query  557  AFL  565
            A L
Sbjct  184  AIL  186



>ref|XP_009617330.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Nicotiana tomentosiformis]
Length=366

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 144/178 (81%), Gaps = 6/178 (3%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPS------GGG  211
            ARL IMELANMISVPMSL A++RL VADAIW+GGSNAPLS +EILS +  S      GGG
Sbjct  15   ARLAIMELANMISVPMSLNAIVRLKVADAIWEGGSNAPLSPTEILSKIRASEGGGGGGGG  74

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            DA NL+R+LRMLTSY +F EHI  D S+RRYS+ EVGKTLVTD++GLSYG+YVLQHHQ A
Sbjct  75   DAENLQRILRMLTSYDVFAEHIVDDGSQRRYSLTEVGKTLVTDENGLSYGSYVLQHHQDA  134

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M AW +V EAV DSS EPF K NGE  Y+YYGK PEMN+LM  AMSG+SVPFMKA L
Sbjct  135  LMSAWTMVDEAVNDSSTEPFAKANGEPAYNYYGKRPEMNNLMLNAMSGVSVPFMKAIL  192



>ref|NP_190882.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
 gb|AAK56277.1|AF367289_1 AT3g53140/T4D2_70 [Arabidopsis thaliana]
 emb|CAB64217.1| caffeic acid O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM91448.1| AT3g53140/T4D2_70 [Arabidopsis thaliana]
 gb|AEE79041.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
Length=359

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 146/182 (80%), Gaps = 5/182 (3%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV-LPSG-  205
            SES N ARL IMELANMISVPMSL A +RL +ADAIW GG+N+PLSA+EIL  + LPS  
Sbjct  6    SESRNRARLAIMELANMISVPMSLNAAVRLGIADAIWNGGANSPLSAAEILPRLHLPSHT  65

Query  206  --GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  379
              GGD  NL+R+LRMLTSYG+F EH+   + ER+YS+ +VGKTLVTD  GLSY AYVLQH
Sbjct  66   TIGGDPENLQRILRMLTSYGVFSEHL-VGSIERKYSLTDVGKTLVTDSGGLSYAAYVLQH  124

Query  380  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  559
            HQ A+M+AWPLVH AVV+   EP+VK NGEA Y+ YGK+ EMN LMQKAMSG+SVPFMKA
Sbjct  125  HQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKSEEMNGLMQKAMSGVSVPFMKA  184

Query  560  FL  565
             L
Sbjct  185  IL  186



>ref|XP_010515802.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=355

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 143/178 (80%), Gaps = 1/178 (1%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            SES N ARL I+ELANMISVPMSL A ++L +ADA+W GG+N+PLSA+EIL+ +L   GG
Sbjct  6    SESRNRARLAILELANMISVPMSLNAAVKLGIADAVWNGGTNSPLSAAEILTRLLLPSGG  65

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            D  NL+R+LRMLTSYG+F EH+   ++ER+YS+ +VGKTLVTD  GLSY AYVLQHHQ A
Sbjct  66   DPENLQRILRMLTSYGVFSEHL-VGSTERKYSLTDVGKTLVTDSGGLSYAAYVLQHHQDA  124

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M+AWPLVH AVV+   EP+VK N EA Y  YGKN EMN LM KAMSG+SVPFMKA L
Sbjct  125  LMRAWPLVHTAVVEPETEPYVKANSEAAYVQYGKNEEMNDLMLKAMSGVSVPFMKAIL  182



>ref|XP_009774776.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana sylvestris]
Length=252

 Score =   240 bits (613),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 140/178 (79%), Gaps = 6/178 (3%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP---  220
            ARL IMELANMISVPMSL AV+RL VADAIW+GGSNAPLS +EIL+ +  S GG      
Sbjct  15   ARLAIMELANMISVPMSLNAVVRLKVADAIWEGGSNAPLSPTEILAKISGSEGGGGAGGG  74

Query  221  ---NLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
               NL+R+LRMLTSY +F EHI  D  +RRYS+ EVGKTLVTDK+GLSYG+Y+LQHHQ A
Sbjct  75   DAENLQRILRMLTSYDVFAEHIVDDGPQRRYSLTEVGKTLVTDKNGLSYGSYILQHHQDA  134

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M AW +V EAV DSS EPF K NGE  Y+YYGK PEMN+LM  AMSG+SVPFMKA L
Sbjct  135  LMSAWTMVDEAVNDSSTEPFAKANGEPAYNYYGKKPEMNNLMLNAMSGVSVPFMKAIL  192



>emb|CDX76223.1| BnaA04g04870D [Brassica napus]
Length=268

 Score =   240 bits (613),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 142/183 (78%), Gaps = 7/183 (4%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV---LPS  202
            SES N ARL IMELANMISVPMSL A +RL +ADAIW  G N+PLSA+EIL  +     +
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPLSATEILPRLHLTYQN  65

Query  203  G--GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  376
            G  GGD  NL+R+LRMLTSYG+F EH+    + R+YS+ +VGKTLVTD DGLSY AYVLQ
Sbjct  66   GTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYAAYVLQ  123

Query  377  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            HHQ A+M+AWPLVH AVV+   EP+VK NGEA Y+ YGK  EMN LMQKAMSG+SVPFMK
Sbjct  124  HHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVSVPFMK  183

Query  557  AFL  565
            A L
Sbjct  184  AIL  186



>ref|XP_010546519.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=354

 Score =   241 bits (615),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 142/178 (80%), Gaps = 2/178 (1%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            SE  N ARL IMELANMISVPMSL A ++L VADAIW GG+N+P+SA+EILS     G G
Sbjct  6    SERRNRARLAIMELANMISVPMSLNAAVKLGVADAIWCGGANSPISAAEILSRCC-GGAG  64

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
               NL+R+LRMLTSYG+F EH + D SER+YS+ +VGKTLVTD DGLSYG+YVLQHHQ A
Sbjct  65   GPENLQRILRMLTSYGVFSEHFSGD-SERKYSLTDVGKTLVTDSDGLSYGSYVLQHHQEA  123

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M+AWPLVH AV D + EP+VK NGE  Y+ YGK+ EMN LM +AMSG+SVPFM+A L
Sbjct  124  LMRAWPLVHTAVEDPTREPYVKANGEPAYAQYGKSEEMNGLMLRAMSGVSVPFMRAIL  181



>ref|XP_009139429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brassica rapa]
Length=359

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 142/183 (78%), Gaps = 7/183 (4%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV---LPS  202
            SES N ARL IMELANMISVPMSL A +RL +ADAIW  G N+PLSA+EIL  +     +
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPLSAAEILPRLHLTYQN  65

Query  203  G--GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  376
            G  GGD  NL+R+LRMLTSYG+F EH+    + R+YS+ +VGKTLVTD DGLSY AYVLQ
Sbjct  66   GTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYAAYVLQ  123

Query  377  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            HHQ A+M+AWPLVH AVV+   EP+VK NGEA Y+ YGK  EMN LMQKAMSG+SVPFMK
Sbjct  124  HHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVSVPFMK  183

Query  557  AFL  565
            A L
Sbjct  184  AIL  186



>emb|CDX95399.1| BnaC04g27590D [Brassica napus]
Length=359

 Score =   238 bits (608),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 142/183 (78%), Gaps = 7/183 (4%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV---LPS  202
            SES N ARL IMELANMISVPMSL A +RL +ADAIW  G N+P+SA+EIL  +     +
Sbjct  6    SESRNKARLAIMELANMISVPMSLNAAVRLGLADAIWNDGDNSPVSAAEILPRLHLTYQN  65

Query  203  G--GGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  376
            G  GGD  NL+R+LRMLTSYG+F EH+    + R+YS+ +VGKTLVTD DGLSY AYVLQ
Sbjct  66   GTIGGDPENLQRILRMLTSYGVFSEHLTN--AGRKYSITDVGKTLVTDSDGLSYAAYVLQ  123

Query  377  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            HHQ A+M+AWPLVH AVV+   EP+VK NGEA Y+ YGK  EMN LMQKAMSG+SVPFMK
Sbjct  124  HHQEALMRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVSVPFMK  183

Query  557  AFL  565
            A L
Sbjct  184  AIL  186



>gb|KFK34550.1| hypothetical protein AALP_AA5G160800 [Arabis alpina]
Length=360

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 138/182 (76%), Gaps = 4/182 (2%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL-PSGG  208
            SE  N ARL IMELANMISVPMSL A +RL +AD IW  G N+PLSA+EIL  +L PS  
Sbjct  6    SERRNKARLAIMELANMISVPMSLNAAVRLGIADVIWNDGENSPLSAAEILPRLLLPSDT  65

Query  209  ---GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  379
               GD  NL+R+LRMLTSY +F EH+ A + ER+YS+ +VGKTLVTD  GLSY AYVLQH
Sbjct  66   TITGDPENLQRILRMLTSYDVFSEHLAAGSVERKYSLTDVGKTLVTDSGGLSYAAYVLQH  125

Query  380  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  559
            HQ A+M+AWPLVH AVV    EP++K NGE  Y+ YGK  EMN LMQKAMSG+SVPFMKA
Sbjct  126  HQEALMRAWPLVHTAVVQPETEPYMKANGETAYAQYGKCEEMNCLMQKAMSGVSVPFMKA  185

Query  560  FL  565
             L
Sbjct  186  IL  187



>ref|XP_011101457.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=360

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 136/186 (73%), Gaps = 19/186 (10%)
 Frame = +2

Query  65   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  244
            MELAN++SVPMSL AVI+L V D IWQ G N PLSA+EILS+V      DA NL+R+LR+
Sbjct  1    MELANLVSVPMSLNAVIKLKVLDTIWQDGFNNPLSAAEILSAVAVGPHADAENLQRILRL  60

Query  245  LTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEA  424
            LTSYG+F EHI  D S RRYS+ EVGK L TD++GLSY  YVLQHHQ A+M AWPLVHEA
Sbjct  61   LTSYGVFNEHIAGDGSGRRYSLTEVGKALATDENGLSYAPYVLQHHQDAIMLAWPLVHEA  120

Query  425  VVDSSIEPFVKV-------------------NGEAPYSYYGKNPEMNSLMQKAMSGISVP  547
            V+D S EPFVKV                   +GE PYSYYGK PEMN LMQKAMSG+SVP
Sbjct  121  VLDPSSEPFVKVHGELAYSYYGKYPEMNLLMHGELPYSYYGKYPEMNLLMQKAMSGVSVP  180

Query  548  FMKAFL  565
            FMKAFL
Sbjct  181  FMKAFL  186



>ref|XP_010271244.1| PREDICTED: uncharacterized protein LOC104607311 isoform X2 [Nelumbo 
nucifera]
Length=210

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 135/181 (75%), Gaps = 10/181 (6%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +E+ N ARL I+ELANMISVPMSL A++ L V DAIWQG SN PLSASE+L+ VLP+G  
Sbjct  6    TETRNNARLAILELANMISVPMSLNAIVCLKVPDAIWQGSSNIPLSASEVLAHVLPTGNS  65

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            +  NL R+LRM TSY +F EHI    SER+YS+ E+GK LVTD +GLSY  YVLQHHQ  
Sbjct  66   E--NLRRILRMFTSYDVFSEHIADGFSERKYSLTEIGKILVTDGEGLSYAVYVLQHHQDT  123

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVP---FMKAF  562
            ++KAWPL HEAVVD   EPFVK N     +YYG  PEMN LMQKAMSG+SVP   FMKA 
Sbjct  124  LVKAWPLQHEAVVDLKEEPFVKAN-----AYYGDKPEMNELMQKAMSGVSVPFVLFMKAI  178

Query  563  L  565
            +
Sbjct  179  V  179



>ref|XP_010271241.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271242.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271243.1| PREDICTED: uncharacterized protein LOC104607311 isoform X1 [Nelumbo 
nucifera]
Length=248

 Score =   229 bits (584),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 135/181 (75%), Gaps = 10/181 (6%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +E+ N ARL I+ELANMISVPMSL A++ L V DAIWQG SN PLSASE+L+ VLP+G  
Sbjct  6    TETRNNARLAILELANMISVPMSLNAIVCLKVPDAIWQGSSNIPLSASEVLAHVLPTGNS  65

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
            +  NL R+LRM TSY +F EHI    SER+YS+ E+GK LVTD +GLSY  YVLQHHQ  
Sbjct  66   E--NLRRILRMFTSYDVFSEHIADGFSERKYSLTEIGKILVTDGEGLSYAVYVLQHHQDT  123

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVP---FMKAF  562
            ++KAWPL HEAVVD   EPFVK N     +YYG  PEMN LMQKAMSG+SVP   FMKA 
Sbjct  124  LVKAWPLQHEAVVDLKEEPFVKAN-----AYYGDKPEMNELMQKAMSGVSVPFVLFMKAI  178

Query  563  L  565
            +
Sbjct  179  V  179



>gb|AAP03058.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=375

 Score =   220 bits (561),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 141/187 (75%), Gaps = 10/187 (5%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG--  205
            SE+ N ARL+I+ELAN+ISVPMSL A++RL V +AIW  GSN P+SA+EILS  LP    
Sbjct  16   SEARNNARLKIIELANLISVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDAPA  74

Query  206  GGDAPNLERLLRMLTSYGIFREHINADAS------ERRYSVDEVGKTLVT-DKDGLSYGA  364
              DA NL+RLLR+LTS+G+F EH++  +S      ERRY + EVG+TLV+ D+   S+GA
Sbjct  75   TADAENLQRLLRVLTSFGVFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSHGA  134

Query  365  YVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISV  544
            YVLQHHQ  ++KAWP +H A++D+S EPF +VNGE  Y YYGKN E+N  MQ AMSG+SV
Sbjct  135  YVLQHHQETLLKAWPFLHTAILDASTEPFARVNGEPAYQYYGKNDELNKNMQYAMSGVSV  194

Query  545  PFMKAFL  565
            P+MKA L
Sbjct  195  PYMKALL  201



>gb|KHN47498.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=337

 Score =   217 bits (552),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 127/178 (71%), Gaps = 20/178 (11%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +E    A L IMELANMISVPM+L AV+RLNVADA+WQGG+NAPLSASEIL  +LP G  
Sbjct  7    TEQRKQAMLAIMELANMISVPMALNAVVRLNVADALWQGGANAPLSASEILPRILPGG--  64

Query  212  DAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
                            +FREH+ A   ER YS+ EVGKTLVTD+ GLSY  YVLQHHQ A
Sbjct  65   ----------------VFREHLAA--GERNYSLTEVGKTLVTDEQGLSYAHYVLQHHQDA  106

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M+AWPLVHEAVVD + EPF   NGE  Y YY K PEMN LM +AMSG+SVPFM+A L
Sbjct  107  LMRAWPLVHEAVVDPTKEPFEMANGEPAYGYYLKQPEMNDLMVRAMSGVSVPFMRAML  164



>ref|XP_004502926.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=361

 Score =   215 bits (548),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = +2

Query  53   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLER  232
            RL I+E+A+M+SVPMSL AV+ + V DAIWQGG+N PLSASEIL+ V P+GGGDA NL+R
Sbjct  19   RLAILEVAHMMSVPMSLVAVLNMKVPDAIWQGGNNTPLSASEILAVVRPNGGGDAENLQR  78

Query  233  LLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  412
            +LR+LT+Y IF E +N+   ER+YS+ +VGKTL+ D DGLSY AYVLQHHQ A+M+AW L
Sbjct  79   ILRLLTTYDIFDEQLNSKG-ERKYSLSDVGKTLIADADGLSYAAYVLQHHQEALMRAWAL  137

Query  413  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            V EAV D ++EPF K NGE+  +YY K  ++ SL+  +++G+SVPFM+  L
Sbjct  138  VGEAVEDPTVEPFEKANGESAVAYYIKRADVMSLIYSSLAGMSVPFMREML  188



>ref|XP_003602597.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=358

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 135/177 (76%), Gaps = 1/177 (1%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  214
            +S + ARL I+ELA+++SVP SL AV+++ V +AIWQGG+N PLSAS+ILS V P+GGGD
Sbjct  10   KSQSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGNNTPLSASQILSIVRPNGGGD  69

Query  215  APNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  394
            A NL+R+LR+LT+Y IF E ++++  +R+YS+ EVGK LV D DGLSYG YVLQH+Q   
Sbjct  70   AENLQRILRLLTTYAIFAEDLSSNG-KRKYSLTEVGKALVPDDDGLSYGTYVLQHYQDQY  128

Query  395  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            ++AWPLV EAV D ++EPF K++GE  Y+Y  K P+  SL   +MSG+S+P M   L
Sbjct  129  LRAWPLVGEAVEDPTVEPFEKLHGEGAYAYCMKRPDEMSLFYASMSGMSMPHMNEML  185



>gb|KDO38249.1| hypothetical protein CISIN_1g043063mg [Citrus sinensis]
Length=301

 Score =   200 bits (509),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = +2

Query  152  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  331
            +N PLSAS+IL+ +LPSGGGDA NL+R+LR+LT+YG+F EH      ER+YS+ E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTNYGVFSEH-REFGGERKYSLTEIGKSL  74

Query  332  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  511
            VTD +G SY  YVLQHHQ A+M AWPLVHEA++D +IEPFVKV+GE  YSYYGK PEMN 
Sbjct  75   VTDAEGQSYAPYVLQHHQDALMSAWPLVHEAILDPTIEPFVKVHGEPTYSYYGKMPEMNG  134

Query  512  LMQKAMSGISVPFMKAFL  565
            LM+KAMSG+SVPFM + L
Sbjct  135  LMRKAMSGVSVPFMTSIL  152



>gb|AFK47565.1| unknown [Medicago truncatula]
Length=224

 Score =   196 bits (498),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  229
            ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA NL+
Sbjct  15   ARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAENLQ  74

Query  230  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  409
            R+LR+LT+Y IF E ++++  ER+YS+ +VGK LV D  GL+  ++ +QHHQ   ++AWP
Sbjct  75   RILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLRAWP  133

Query  410  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            LV +AV D ++EPF K++GEA Y+Y  K PE  SL   +MSG+S+P+M+  L
Sbjct  134  LVGDAVEDPTVEPFEKLHGEAAYAYCTKGPEEMSLFYASMSGMSLPYMREML  185



>gb|AAP03054.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=181

 Score =   194 bits (494),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 125/167 (75%), Gaps = 10/167 (6%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG--  205
            SE+ N ARL+I+ELAN+ISVPMSL A++RL V +AIW  GSN P+SA+EILS  LP    
Sbjct  16   SEARNNARLKIIELANLISVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDAPA  74

Query  206  GGDAPNLERLLRMLTSYGIFREHINADAS------ERRYSVDEVGKTLVT-DKDGLSYGA  364
              DA NL+RLLR+LTS+G+F EH++  +S      ERRY + EVG+TLV+ D+   S+GA
Sbjct  75   TADAENLQRLLRVLTSFGVFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSHGA  134

Query  365  YVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEM  505
            YVLQHHQ  ++KAWP +H A++D+S EPF +VNGE  Y YYGKN E+
Sbjct  135  YVLQHHQETLLKAWPFLHTAILDASTEPFARVNGEPAYQYYGKNDEL  181



>gb|AAP03053.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=191

 Score =   194 bits (493),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 125/169 (74%), Gaps = 10/169 (6%)
 Frame = +2

Query  86   SVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG--GGDAPNLERLLRMLTSYG  259
            +VPMSL A++RL V +AIW  GSN P+SA+EILS  LP      DA NL+RLLR+LTS+G
Sbjct  6    NVPMSLTAIVRLKVPEAIWSNGSNTPVSAAEILSR-LPDAPPTADAENLQRLLRVLTSFG  64

Query  260  IFREHINADAS------ERRYSVDEVGKTLVT-DKDGLSYGAYVLQHHQAAMMKAWPLVH  418
            +F EH++  +S      ERRY + EVG+TLV+ D+   S+GAYVLQHHQ  ++KAWP +H
Sbjct  65   VFSEHLDTTSSSSSSTSERRYCLTEVGQTLVSFDESCPSHGAYVLQHHQETLLKAWPFLH  124

Query  419  EAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             A++D+S EPF +VNGE  Y YYGKN E+N  MQ AMSG+SVP+MKA L
Sbjct  125  TAILDASTEPFARVNGEPAYQYYGKNDELNKNMQYAMSGVSVPYMKALL  173



>emb|CAB65279.1| O-diphenol-O-methyl transferase [Medicago sativa subsp. x varia]
Length=358

 Score =   199 bits (506),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  229
            ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA NL+
Sbjct  15   ARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAENLQ  74

Query  230  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  409
            R+LR+LT+Y IF E ++++  +R+YS+ ++GK LV D DGLSY  YVLQH+Q   ++AWP
Sbjct  75   RILRLLTTYAIFAEDLSSNG-KRKYSLTDIGKALVPDDDGLSYATYVLQHYQDQYLRAWP  133

Query  410  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            LV +AV D+S+EPF K++GE  Y+Y  K P+  SL   +MSG+S+P M   L
Sbjct  134  LVGDAVEDASVEPFEKLHGEGAYAYCMKRPDEMSLFYASMSGLSMPHMNEML  185



>ref|XP_006423903.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
 gb|ESR37143.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
Length=294

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = +2

Query  152  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  331
            +N PLS S+IL+ +LPSGGGDA NL+ +LR+LTSYG+F EH      ER+YS+ E+GK+L
Sbjct  16   ANTPLSVSQILTCILPSGGGDAENLQCILRLLTSYGVFSEH-REFRGERKYSLTEIGKSL  74

Query  332  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  511
            VTD +GLSY  YVLQHHQ A M AWPLVHEAV+D +IEPFVKV+GE  YSYYGK PEMN 
Sbjct  75   VTDAEGLSYAPYVLQHHQDAFMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNG  134

Query  512  LMQKAMSGISVPFMKAFL  565
            LM++A+SG+SVPFM + L
Sbjct  135  LMRRAISGVSVPFMTSVL  152



>ref|XP_003602596.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|AES72847.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=264

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  229
            ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA NL+
Sbjct  15   ARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAENLQ  74

Query  230  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  409
            R+LR+LT+Y IF E ++++  ER+YS+ +VGK LV D  GL+  ++ +QHHQ   ++AWP
Sbjct  75   RILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLRAWP  133

Query  410  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            LV +AV D ++EPF K++GEA Y+Y  K PE  SL   +MSG+S+P+M+  L
Sbjct  134  LVGDAVEDPTVEPFEKLHGEAAYAYCTKGPEEMSLFYASMSGMSLPYMREML  185



>gb|KDO41959.1| hypothetical protein CISIN_1g021707mg [Citrus sinensis]
Length=309

 Score =   196 bits (499),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = +2

Query  152  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  331
            +N PLS S+IL+ +LPSGGGDA NL+ +LR+LTSYG+F EH      ER+YS+ E+GK+L
Sbjct  16   ANTPLSVSQILTCILPSGGGDAENLQCILRLLTSYGVFSEH-REFRGERKYSLTEIGKSL  74

Query  332  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  511
            VTD +GLSY  YVLQHHQ A M AWPLVHEAV+D +IEPFVKV+GE  YSYYGK PEMN 
Sbjct  75   VTDAEGLSYAPYVLQHHQDAFMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNG  134

Query  512  LMQKAMSGISVPFMKAFL  565
            LM++A+SG+SVPFM + L
Sbjct  135  LMRRAISGVSVPFMTSVL  152



>gb|AGW45465.1| beta-alanine n-methyltransferase, partial [Reaumuria trigyna]
Length=204

 Score =   191 bits (486),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 115/151 (76%), Gaps = 2/151 (1%)
 Frame = +2

Query  119  LNVADAIWQGGSNAPLSASEILSSVLP-SGGGDAPNLERLLRMLTSYGIFREHI-NADAS  292
            L V +AIW  GSN PL+A+EILS +LP S   D  NL+R+LR+LT+Y IF EH+ +    
Sbjct  1    LKVPEAIWAHGSNKPLTATEILSHILPNSPTADPENLQRMLRLLTTYNIFVEHLSDTTPV  60

Query  293  ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEA  472
            +RRYS+ EVG+TLV D DGLSYG Y++QHHQ A++++WPLVH AVVD   EPFV+ NGE+
Sbjct  61   QRRYSLTEVGETLVPDSDGLSYGDYIMQHHQDALVRSWPLVHMAVVDPVTEPFVRANGES  120

Query  473  PYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             Y YYGK+ EMN LMQKAM+G SVPFM+  L
Sbjct  121  AYWYYGKDEEMNELMQKAMAGFSVPFMRELL  151



>ref|XP_006436414.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
 gb|ESR49654.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
Length=317

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = +2

Query  152  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  331
            +N PLSAS+IL+ +LPSGGGDA NL+R+LR+LTSYG+F EH      +R YS+ E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTSYGVFSEH-REFGGKRMYSLTEIGKSL  74

Query  332  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  511
            VTD +GLSY  YVLQHHQ A+M  WPLVH+A++D +IEPF+KV+GE  YSYYGK PEMN 
Sbjct  75   VTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYSYYGKIPEMNG  134

Query  512  LMQKAMSGISVPFMKAFL  565
            LM+KAMSG+SVPFM + L
Sbjct  135  LMRKAMSGVSVPFMTSVL  152



>ref|XP_006485837.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=337

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = +2

Query  152  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  331
            +N PLSAS+IL+ +LPSGGGDA NL+R+LR+LTSYG+F EH      +R YS+ E+GK+L
Sbjct  16   ANTPLSASQILTRILPSGGGDAENLQRILRLLTSYGVFSEH-REFGGKRMYSLTEIGKSL  74

Query  332  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  511
            VTD +GLSY  YVLQHHQ A+M  WPLVH+A++D +IEPF+KV+GE  YSYYGK PEMN 
Sbjct  75   VTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYSYYGKIPEMNG  134

Query  512  LMQKAMSGISVPFMKAFL  565
            LM+KAMSG+SVPFM + L
Sbjct  135  LMRKAMSGVSVPFMTSVL  152



>ref|XP_003602595.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|ACJ84599.1| unknown [Medicago truncatula]
 gb|AES72846.1| caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AFK37235.1| unknown [Medicago truncatula]
Length=358

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  229
            ARL I+ELA+++SVP SL AV+++ V +AIWQGG N PLSAS+ILS V P+GGGDA NL+
Sbjct  15   ARLAILELAHIMSVPTSLNAVLKMKVPEAIWQGGKNTPLSASQILSIVRPNGGGDAENLQ  74

Query  230  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  409
            R+LR+LT+Y IF E ++++  ER+YS+ +VGK LV D  GL+  ++ +QHHQ   ++AWP
Sbjct  75   RILRLLTTYTIFVEDLSSNG-ERKYSLTDVGKALVPDDHGLTCASFFVQHHQDPYLRAWP  133

Query  410  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            LV +AV D ++EPF K++GEA Y+Y  K PE  SL   +MSG+S+P+M+  L
Sbjct  134  LVGDAVEDPTVEPFEKLHGEAAYAYCTKGPEEMSLFYASMSGMSLPYMREML  185



>ref|XP_009382782.1| PREDICTED: caffeic acid 3-O-methyltransferase [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   195 bits (495),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 133/182 (73%), Gaps = 4/182 (2%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            SE     RL +MELANMISVPM+L AV+RLNV DAIWQ GSN+PL+A+EIL+ + P    
Sbjct  14   SEVGKQGRLAMMELANMISVPMALNAVVRLNVPDAIWQSGSNSPLTAAEILALLRPPPPS  73

Query  212  DAPN--LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
             +    L+RLLR+L S+G+F E+  A +  RRYS+ +VG+TLV   DG SY AYVLQHHQ
Sbjct  74   SSDPSVLQRLLRLLASHGVFAENRCATSGARRYSLTDVGRTLVPSGDGASYAAYVLQHHQ  133

Query  386  AAMMKAWPLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGISVPFMKA  559
             A+++AWP +HEAV+D +  EPF + NG  P Y+YYG + E N+LMQ+AM G+S PFM+A
Sbjct  134  DALVRAWPRLHEAVLDPAGPEPFARANGGVPAYAYYGGDREANALMQRAMWGVSEPFMEA  193

Query  560  FL  565
             L
Sbjct  194  LL  195



>ref|XP_006451708.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
 gb|ESR64948.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
Length=305

 Score =   192 bits (488),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = +2

Query  152  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  331
            +N PLSAS+IL+ +LPSG GDA NL+R+LR+LTSYG+F EH      + +YS+ E+GK+L
Sbjct  4    ANTPLSASQILTHILPSGSGDAENLQRILRLLTSYGVFSEH-REFGGQMKYSITEIGKSL  62

Query  332  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  511
            VTD +GLSY  YVLQHHQ A+M  WPLVHEAV+D +IEP VKV+G+  YSYYGK PEMN 
Sbjct  63   VTDAEGLSYAPYVLQHHQDALMSMWPLVHEAVLDPTIEPLVKVHGKPAYSYYGKMPEMNG  122

Query  512  LMQKAMSGISVPFMKAFL  565
            LM+KAMSG+SVPFM + L
Sbjct  123  LMRKAMSGVSVPFMTSVL  140



>ref|XP_006485822.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=274

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = +2

Query  152  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  331
            +N PLSAS+IL+ +LPSG GDA NL+R+LR+LTSYG+F EH      + +YS+ E+GK+L
Sbjct  16   ANTPLSASQILTHILPSGSGDAENLQRILRLLTSYGVFSEH-REFGGQMKYSITEIGKSL  74

Query  332  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  511
            VTD +GLSY  YVLQHHQ A+M  WPLV+EAV+D +IEP VKV+G+  YSYYGK PEMN 
Sbjct  75   VTDAEGLSYAPYVLQHHQDALMSMWPLVYEAVLDPTIEPLVKVHGKPAYSYYGKMPEMNG  134

Query  512  LMQKAMSGISVPFMKAFL  565
            LM+KAMSG+SVPFM + L
Sbjct  135  LMRKAMSGVSVPFMTSVL  152



>ref|XP_010683979.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 131/191 (69%), Gaps = 14/191 (7%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGG-  208
            SE+ N ARL IMELANMISVPM+L AV+RL V  AIW  G+N PL+A+ I+S +LP+   
Sbjct  20   SETRNKARLAIMELANMISVPMALNAVVRLKVPAAIWSCGANTPLTAAAIISLILPNNPE  79

Query  209  GDAPNLERLLRMLTSYGIFREH--INADASERRYSVDEVGKTLVTDKDGL---------S  355
             DA NL RLLR+L++YG+F EH  +  D   RRYS+ EVG+TLV    G          S
Sbjct  80   ADADNLARLLRLLSTYGVFSEHPPLYGDIF-RRYSLTEVGRTLVAGDGGGGGGDDGGGSS  138

Query  356  YGAYVLQHHQAAMMKAWPLVHEAVV-DSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMS  532
            +G YVLQHHQ A+++AW  V  AVV  +S  PF   NGE  Y YYGKN EMN LMQ+AM+
Sbjct  139  HGEYVLQHHQEALVRAWLQVDRAVVGPTSKTPFEVANGEPAYDYYGKNEEMNGLMQRAMA  198

Query  533  GISVPFMKAFL  565
            G+SVPFMKA +
Sbjct  199  GVSVPFMKAVV  209



>ref|XP_010935842.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Elaeis 
guineensis]
Length=346

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 131/188 (70%), Gaps = 12/188 (6%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEI--LSSVLPSGG  208
            E    A L +MEL+NMI+VPMSL AV+RLNV  AIWQ G+N+PLSA+EI  L    P   
Sbjct  49   EVQKKANLAMMELSNMIAVPMSLHAVVRLNVPAAIWQSGTNSPLSAAEILPLLRPPPPPS  108

Query  209  GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVT-------DKDGLSYGAY  367
             D  NL+RLLR+L S+G+F EH++  +  RR+S+  VG+TLV+        +DG SY AY
Sbjct  109  TDPGNLQRLLRLLASHGVFTEHLSP-SGVRRFSLTPVGQTLVSAASSNGGGEDGPSYAAY  167

Query  368  VLQHHQAAMMKAWPLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGIS  541
            VLQHHQ A+++AWP +HEAV+D +  EPF + NG  P Y+YYG + E N LMQ+AM G+S
Sbjct  168  VLQHHQDALVRAWPRLHEAVLDPAGPEPFARANGGTPAYAYYGGDGEANELMQRAMWGVS  227

Query  542  VPFMKAFL  565
             PFM AFL
Sbjct  228  KPFMDAFL  235



>ref|XP_010935841.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 131/188 (70%), Gaps = 12/188 (6%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEI--LSSVLPSGG  208
            E    A L +MEL+NMI+VPMSL AV+RLNV  AIWQ G+N+PLSA+EI  L    P   
Sbjct  49   EVQKKANLAMMELSNMIAVPMSLHAVVRLNVPAAIWQSGTNSPLSAAEILPLLRPPPPPS  108

Query  209  GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVT-------DKDGLSYGAY  367
             D  NL+RLLR+L S+G+F EH++  +  RR+S+  VG+TLV+        +DG SY AY
Sbjct  109  TDPGNLQRLLRLLASHGVFTEHLSP-SGVRRFSLTPVGQTLVSAASSNGGGEDGPSYAAY  167

Query  368  VLQHHQAAMMKAWPLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGIS  541
            VLQHHQ A+++AWP +HEAV+D +  EPF + NG  P Y+YYG + E N LMQ+AM G+S
Sbjct  168  VLQHHQDALVRAWPRLHEAVLDPAGPEPFARANGGTPAYAYYGGDGEANELMQRAMWGVS  227

Query  542  VPFMKAFL  565
             PFM AFL
Sbjct  228  KPFMDAFL  235



>dbj|BAJ96291.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 123/175 (70%), Gaps = 7/175 (4%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  229
            ARL +MELANMI+VPM+L AVIRL V  A+W GG+N PLSA+E+    LP+G  D   LE
Sbjct  23   ARLAMMELANMIAVPMALTAVIRLGVPAAVWAGGANLPLSAAEL----LPAGHPDPSVLE  78

Query  230  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLV-TDKDGLSYGAYVLQHHQAAMMKAW  406
            RLLR+L S G+F EH      ERRY++  VG+TLV +   G SY  YVLQHHQ A++ AW
Sbjct  79   RLLRLLASRGVFSEHAADGGRERRYALTAVGRTLVPSAPSGASYADYVLQHHQDALVLAW  138

Query  407  PLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            P +HEAV+D +  EPF + +   P Y+YYG++ + N +M +AM+G+S PFM+A L
Sbjct  139  PRLHEAVLDPAGPEPFARAHAGVPAYAYYGQDRDANEVMLRAMTGVSEPFMEALL  193



>ref|XP_004954455.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Setaria italica]
Length=344

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 121/172 (70%), Gaps = 8/172 (5%)
 Frame = +2

Query  62   IMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLR  241
            +MELANMISVPM+L AVIRL V  A+W GG+NAPLSA+E+    LP G  D   LERLLR
Sbjct  1    MMELANMISVPMALTAVIRLGVPSAVWAGGANAPLSAAEL----LPEGHPDPSVLERLLR  56

Query  242  MLTSYGIFREHINADA-SERRYSVDEVGKTLV-TDKDGLSYGAYVLQHHQAAMMKAWPLV  415
            +L S G+F EH    A S RR+++  VG+TLV +   G SY  YVLQHHQ A++ AWP +
Sbjct  57   LLASRGVFSEHGGGSAGSPRRFALTAVGRTLVPSGPSGASYADYVLQHHQDALVSAWPRL  116

Query  416  HEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            HEAV+D +  EPF + N   P Y+YYG++ E N +M +AM+G+S PFM+A L
Sbjct  117  HEAVLDPAGPEPFARANAGVPAYAYYGRDREANEVMLRAMTGVSEPFMEALL  168



>ref|XP_002453074.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
 gb|EES06050.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
Length=377

 Score =   174 bits (441),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 121/179 (68%), Gaps = 11/179 (6%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  229
            ARL +MELANM+SVPM+L AVIRL V  AIW GG+NAP SA+E+    LP+G  D   LE
Sbjct  27   ARLAMMELANMVSVPMALTAVIRLGVPAAIWAGGANAPRSAAEL----LPAGHPDPSVLE  82

Query  230  RLLRMLTSYGIFREHINAD----ASERRYSVDEVGKTLVTD-KDGLSYGAYVLQHHQAAM  394
            RLLR+L S G+F E  +       + RR+++  VG+TLV +   G SY  YVLQHHQ A+
Sbjct  83   RLLRLLASRGVFSESTSTSEDRTTTTRRFALTAVGRTLVPEGASGASYADYVLQHHQDAL  142

Query  395  MKAWPLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            + AWP +HEAV+D    EPF + N   P Y+YYGK+ E N +M +AM+G+S PFM A L
Sbjct  143  VAAWPRLHEAVLDPRGPEPFARANAGVPAYAYYGKDREANQVMLRAMTGVSEPFMHALL  201



>ref|NP_001149617.1| LOC100283243 [Zea mays]
 gb|ACG36095.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 121/177 (68%), Gaps = 9/177 (5%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  229
            ARL +MELANM+SVPM+L AVIRL V  A+W GG+NAP+SA+++    LP G  D   LE
Sbjct  25   ARLAMMELANMVSVPMALAAVIRLGVPXAVWAGGANAPMSAADL----LPPGHPDPSVLE  80

Query  230  RLLRMLTSYGIFREHINADASERR--YSVDEVGKTLVT-DKDGLSYGAYVLQHHQAAMMK  400
            RLLR+L S G+F E   +  + RR  +++  VG+TLV     G SY  YVLQHHQ A++ 
Sbjct  81   RLLRLLASRGVFSESTESTPTTRRRLFALTAVGRTLVPGPASGASYADYVLQHHQDALVA  140

Query  401  AWPLVHEAVVD-SSIEPFVKVN-GEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            AWP +HEAV+D +  EPF + N G   Y+YYGK+ + N +M +AM+G+S PFM A L
Sbjct  141  AWPRLHEAVLDPAGPEPFARANAGVTAYAYYGKDQDANRVMLRAMAGVSEPFMGALL  197



>gb|ACN25427.1| unknown [Zea mays]
 gb|AFW63931.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 121/177 (68%), Gaps = 9/177 (5%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  229
            ARL +MELANM+SVPM+L AVIRL V  A+W GG+NAP+SA+++    LP G  D   LE
Sbjct  25   ARLAMMELANMVSVPMALAAVIRLGVPAAVWAGGANAPMSAADL----LPPGHPDPSVLE  80

Query  230  RLLRMLTSYGIFREHINADASERR--YSVDEVGKTLVT-DKDGLSYGAYVLQHHQAAMMK  400
            RLLR+L S G+F E   +  + RR  +++  VG+TLV     G SY  YVLQHHQ A++ 
Sbjct  81   RLLRLLASRGVFSESTESTPTTRRRLFALTAVGRTLVPGPASGASYADYVLQHHQDALVA  140

Query  401  AWPLVHEAVVD-SSIEPFVKVN-GEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            AWP +HEAV+D +  EPF + N G   Y+YYGK+ + N +M +AM+G+S PFM A L
Sbjct  141  AWPRLHEAVLDPAGPEPFARANAGVTAYAYYGKDQDANRVMLRAMAGVSEPFMGALL  197



>gb|EEC74273.1| hypothetical protein OsI_09508 [Oryza sativa Indica Group]
Length=345

 Score =   167 bits (424),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 128/191 (67%), Gaps = 13/191 (7%)
 Frame = +2

Query  20   GAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLP  199
            G  G  S   ARL +MELANMISVPM+L AVIRL V   +W GG+NAPL+A+++    LP
Sbjct  4    GGDGELSPAEARLAMMELANMISVPMALTAVIRLGVPAKLWAGGANAPLTAADL----LP  59

Query  200  SGGGDAPNLERLLRMLTSYGIFREHIN-ADASERRYSVDEVGKTLVTDKDGL------SY  358
            +G  D   LERLLR+L S G+F EH   +  S RR+S+  VG+TLV    G       SY
Sbjct  60   AGHPDPSVLERLLRLLASRGVFSEHTGSSSPSPRRFSLTAVGRTLVPGGGGSPSGSGASY  119

Query  359  GAYVLQHHQAAMMKAWPLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMS  532
              YVLQHHQ A+++AWPL+HEAV+D S  EPF + N   P Y+YYGK+ E N +M +AM+
Sbjct  120  ADYVLQHHQDALVRAWPLLHEAVLDPSGPEPFARANAGVPAYAYYGKDREANEVMLRAMT  179

Query  533  GISVPFMKAFL  565
            G+S PFM+A L
Sbjct  180  GVSEPFMEALL  190



>ref|NP_001048569.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAD22923.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAD22855.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAF10483.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAG97074.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58073.1| hypothetical protein OsJ_08933 [Oryza sativa Japonica Group]
Length=365

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 128/191 (67%), Gaps = 13/191 (7%)
 Frame = +2

Query  20   GAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLP  199
            G  G  S   ARL +MELANMISVPM+L AVIRL V   +W GG+NAPL+A+++    LP
Sbjct  4    GGDGELSPAEARLAMMELANMISVPMALTAVIRLGVPAKLWAGGANAPLAAADL----LP  59

Query  200  SGGGDAPNLERLLRMLTSYGIFREHIN-ADASERRYSVDEVGKTLVTDKDGL------SY  358
            +G  D   LERLLR+L S G+F EH   +  S RR+S+  VG+TLV    G       SY
Sbjct  60   AGHPDPSVLERLLRLLASRGVFSEHTGSSSPSPRRFSLTAVGRTLVPGGGGSPSGSGASY  119

Query  359  GAYVLQHHQAAMMKAWPLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMS  532
              YVLQHHQ A+++AWPL+HEAV+D S  EPF + N   P Y+YYGK+ E N +M +AM+
Sbjct  120  ADYVLQHHQDALVRAWPLLHEAVLDPSGPEPFARANAGVPAYAYYGKDREANEVMLRAMT  179

Query  533  GISVPFMKAFL  565
            G+S PFM+A L
Sbjct  180  GVSEPFMEALL  190



>ref|XP_008387516.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=284

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 92/111 (83%), Gaps = 3/111 (3%)
 Frame = +2

Query  242  MLTSYGIFREHI-NAD--ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  412
            MLTSYG+F EH+ N D  + +R++S+  +G+TLVTD++GLSYG YVLQHHQ  +M AWP+
Sbjct  1    MLTSYGVFEEHLSNLDDGSDDRKFSLTPIGQTLVTDQNGLSYGPYVLQHHQDVLMGAWPM  60

Query  413  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            VHEAVVDS++EPFVK NGE  Y YYGK PEMN LMQKAMSG+SVPFMKA L
Sbjct  61   VHEAVVDSTVEPFVKANGELAYEYYGKKPEMNGLMQKAMSGVSVPFMKAIL  111



>gb|KCW89310.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=285

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 91/112 (81%), Gaps = 4/112 (4%)
 Frame = +2

Query  242  MLTSYGIFREHINADAS----ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  409
            ML S+G+F EH+   AS    ERRYS+ EVGKTLVTD +GLSY  YVLQHHQ A+M+AWP
Sbjct  1    MLASHGVFEEHVAPAASSASSERRYSLTEVGKTLVTDAEGLSYAPYVLQHHQDALMRAWP  60

Query  410  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            LVHEAV+D + EPFVK NG+  Y++YGKNPEMN LMQ+AMSG+SVPFMKA L
Sbjct  61   LVHEAVLDPATEPFVKANGDTAYAHYGKNPEMNKLMQRAMSGVSVPFMKAIL  112



>ref|XP_003572969.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brachypodium distachyon]
Length=362

 Score =   160 bits (405),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 9/177 (5%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  229
            ARL +MELANMISVPM+L A IRL V  AIW  G+NAPLSA+++    LP+   D   LE
Sbjct  16   ARLAMMELANMISVPMALTAAIRLGVPGAIWADGANAPLSAADL----LPADHPDPSVLE  71

Query  230  RLLRMLTSYGIFREHINADASE--RRYSVDEVGKTLV-TDKDGLSYGAYVLQHHQAAMMK  400
            R+LR+L S G+F EH     +E  RR+++  VG+TLV     G SY  YVLQHHQ A++ 
Sbjct  72   RVLRLLASRGVFSEHHGPGPAEPTRRFALTAVGRTLVPAGPSGASYADYVLQHHQDALVL  131

Query  401  AWPLVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            AWP +HEA++D +  EPF + +   P Y++Y ++ E N +M + M+G+S PFM+A L
Sbjct  132  AWPRLHEALLDPAGPEPFARAHRGLPAYAFYAQDKEANEVMLRGMTGVSEPFMEALL  188



>gb|KDO38695.1| hypothetical protein CISIN_1g037818mg, partial [Citrus sinensis]
Length=199

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 94/138 (68%), Gaps = 29/138 (21%)
 Frame = +2

Query  152  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  331
            +N PLSAS+IL+ +LPSG GDA NL+R+LR+LTSYG                        
Sbjct  16   ANTPLSASQILTRILPSGDGDAENLQRILRLLTSYG------------------------  51

Query  332  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  511
                 GLSY  Y+LQHHQ A+M AWPLVHEAV+D +IEPFVKV+GE  YSYYGK PEMN 
Sbjct  52   -----GLSYAPYMLQHHQDALMSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNG  106

Query  512  LMQKAMSGISVPFMKAFL  565
            LM+KAMSG+SVPF+ + L
Sbjct  107  LMRKAMSGVSVPFITSVL  124



>ref|XP_010275846.1| PREDICTED: uncharacterized protein LOC104610771 [Nelumbo nucifera]
Length=277

 Score =   153 bits (387),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 112/202 (55%), Gaps = 45/202 (22%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVP--------------MSLC----------AVIRLNVA-DAI  139
            E+ +  RL I+ELANMI  P              +  C             R       I
Sbjct  7    ETRDNGRLAILELANMIKSPNVPQRHHPPQASKRIKACPGQPWPGRRTGFFRCRTTLVTI  66

Query  140  WQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEV  319
            WQGGSN PLSASEIL+ VLP    D  N + +L+ML+SYGIF EHI              
Sbjct  67   WQGGSNVPLSASEILAYVLPIS--DPENFQHILQMLSSYGIFSEHI--------------  110

Query  320  GKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNP  499
                VT+++GL Y AY+L+HHQ A++KAWP++HEAVVD   E  VK NGE   SYYG   
Sbjct  111  ----VTNREGLFYVAYILKHHQDALVKAWPILHEAVVDLEEELLVKSNGEPVRSYYGDKL  166

Query  500  EMNSLMQKAMSGISVPFMKAFL  565
            EMN LMQKA+SG+SV FMK  L
Sbjct  167  EMNELMQKAISGVSVSFMKTIL  188



>gb|AES72848.2| caffeic acid O-methyltransferase [Medicago truncatula]
Length=335

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 116/177 (66%), Gaps = 24/177 (14%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  214
            +S + ARL I+ELA+++SVP SL AV+++ V +AIWQGG+N PLSAS+ILS V P+GGGD
Sbjct  10   KSQSEARLAILELAHIMSVPTSLVAVLKMKVPEAIWQGGNNTPLSASQILSIVRPNGGGD  69

Query  215  APNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  394
            A NL+R+LR+LT+Y IF E ++++  +R+YS+ E                          
Sbjct  70   AENLQRILRLLTTYAIFAEDLSSNG-KRKYSLTE-----------------------DQY  105

Query  395  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            ++AWPLV EAV D ++EPF K++GE  Y+Y  K P+  SL   +MSG+S+P M   L
Sbjct  106  LRAWPLVGEAVEDPTVEPFEKLHGEGAYAYCMKRPDEMSLFYASMSGMSMPHMNEML  162



>ref|XP_006425490.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
 gb|ESR38730.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
Length=298

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 94/138 (68%), Gaps = 21/138 (15%)
 Frame = +2

Query  152  SNAPLSASEILSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTL  331
            +N  LSAS+IL+ +L SGGGDA NL+R+L   T                     E+GK+L
Sbjct  4    ANTHLSASQILTRILSSGGGDAENLQRILLQPT---------------------EIGKSL  42

Query  332  VTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNS  511
            VTD +GLSY  YVLQHH  A+M AWPLVHE V+D +IE FVKV+G   YSYYGK PE+NS
Sbjct  43   VTDAEGLSYAPYVLQHHHDALMSAWPLVHEVVLDPTIELFVKVHGVPAYSYYGKMPEINS  102

Query  512  LMQKAMSGISVPFMKAFL  565
            LM+KAMSG+SVPFM + L
Sbjct  103  LMRKAMSGVSVPFMTSVL  120



>gb|KCW89309.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=345

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 95/153 (62%), Gaps = 34/153 (22%)
 Frame = +2

Query  209  GDAPNLERLLRMLTSYGIFREHINADAS--------ERRYSVDEVGKTLVTDKDGLSYGA  364
            GDA NL+RLLRML S+G F E   A ++        ERR+S+ EV KTLVTD +GLSY A
Sbjct  20   GDAENLQRLLRMLASHGAFEERFPATSASSASSGCFERRFSLTEVRKTLVTDAEGLSYAA  79

Query  365  YV--------------------------LQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNG  466
            YV                           +    A+M+AWPLVHEAV+D + EPFVK NG
Sbjct  80   YVSSSTTRPKKAMERREICLPESRKKRRQKKASDALMRAWPLVHEAVLDPATEPFVKANG  139

Query  467  EAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +  Y++YGKNPEMN LMQ+AMSG+SVPFMKA L
Sbjct  140  DTAYAHYGKNPEMNKLMQRAMSGVSVPFMKAIL  172



>gb|KDO39806.1| hypothetical protein CISIN_1g025363mg [Citrus sinensis]
Length=254

 Score =   134 bits (338),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  302  YSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYS  481
            YS+ E+GK+LVTD +GLSY  YVLQHHQ A+M  WPLVH+A++D +IEPF+KV+GE  YS
Sbjct  2    YSLTEIGKSLVTDVEGLSYAPYVLQHHQDALMSMWPLVHKAILDPTIEPFLKVHGEPAYS  61

Query  482  YYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            YYGK PEMN LM+KAMSG+SVPFM + L
Sbjct  62   YYGKIPEMNGLMRKAMSGVSVPFMTSVL  89



>ref|XP_011101495.1| PREDICTED: caffeic acid 3-O-methyltransferase-like, partial [Sesamum 
indicum]
Length=113

 Score =   125 bits (315),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = +2

Query  44   NGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG---GGD  214
            N   L IMEL N++SVPMSL AVI+L V D I Q GSN PLS +EI  S LPS      D
Sbjct  7    NSPILAIMELVNLVSVPMSLKAVIQLKVLDTIRQDGSNNPLSPAEI--SYLPSRLALARD  64

Query  215  APNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYG  361
            A NL+R+LR+LTSYG+F EHI AD SERRYS+ EVGK L  DK+GLSY 
Sbjct  65   AENLQRILRLLTSYGVFNEHIGADGSERRYSLKEVGKALAADKNGLSYA  113



>ref|XP_006838729.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
 gb|ERN01298.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
Length=352

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 108/179 (60%), Gaps = 6/179 (3%)
 Frame = +2

Query  29   GSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGG  208
            GS   +     +MEL N I+V MSL A+ +L+V   IWQ G N PL+A EI + +    G
Sbjct  8    GSNGASHTTWAMMELTNSIAVSMSLRAMAKLDVPKIIWQNGENTPLTALEIATKLGSEAG  67

Query  209  GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  388
              + NLER+LR+LT++G+F E +   +  RR+S+  +G+ +V D+   S GA++L     
Sbjct  68   --SSNLERMLRLLTAHGVFNETMLGPSEGRRFSLTGLGREIV-DR---SMGAFILYRLDD  121

Query  389  AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            A++ AW L+HEAV++ S EPF+K +G+  Y Y+  +P  N  M +AMS  S   M  FL
Sbjct  122  ALLDAWRLLHEAVLEPSSEPFIKAHGKPAYHYHADDPVFNERMMEAMSSSSGAVMDWFL  180



>ref|XP_006649184.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Oryza brachyantha]
Length=313

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 94/174 (54%), Gaps = 48/174 (28%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLE  229
            ARL +MELANMISVPM+L AVIRL                      S  P+G G      
Sbjct  12   ARLAMMELANMISVPMALTAVIRLGF--------------------SPDPAGSG------  45

Query  230  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  409
                                S RR+++  VG+TLV    G SY  YVLQHHQ A+++AWP
Sbjct  46   --------------------SLRRFALTAVGRTLVPGPSGASYADYVLQHHQDALVRAWP  85

Query  410  LVHEAVVD-SSIEPFVKVNGEAP-YSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             +HEAV+D +  EPF + N   P Y+YYG++ E N +M +AM+G+S PFM+A L
Sbjct  86   RLHEAVLDPAGPEPFARANAGVPAYAYYGQDREANEVMLRAMTGVSEPFMEALL  139



>ref|XP_010243879.1| PREDICTED: uncharacterized protein LOC104587837 [Nelumbo nucifera]
Length=130

 Score =   107 bits (268),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 69/89 (78%), Gaps = 2/89 (2%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +++ N  RL I+ELAN+I+VPMSL A++ L VADAI QG SN PLSASEIL+ VLP+G  
Sbjct  6    TKTQNNTRLAILELANIINVPMSLNAIVCLKVADAIQQGSSNVPLSASEILACVLPTGDP  65

Query  212  DAPNLERLLRMLTSYGIFREHINADASER  298
            D  NL+ +LRMLTSY +F EHI  D+S++
Sbjct  66   D--NLQCILRMLTSYDVFSEHIVDDSSKQ  92



>ref|XP_002963872.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|ADE88151.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase 
[Selaginella moellendorffii]
 gb|EFJ35743.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 97/172 (56%), Gaps = 4/172 (2%)
 Frame = +2

Query  53   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLE  229
            RL+IMELA M SVPM+L   + ++VA+ I + G    LSA+EI+S +       +P  L+
Sbjct  14   RLQIMELATMCSVPMALKVAVEMDVAERIEKAGPGGLLSAAEIVSQIPECSSPMSPIYLD  73

Query  230  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  409
            R++R+L S  IF+E    +   R+Y +  + K L+ D+ G+S   +VL +     M+ W 
Sbjct  74   RIMRVLASRKIFKE--VDEGGVRKYGLTSMCKHLIKDERGVSLAHHVLMNQDKVFMETWQ  131

Query  410  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             +HEAV+D   EPF K  G+  +    +N  +N+L   AMS  S  +M A L
Sbjct  132  YLHEAVLDGG-EPFTKAFGQTEFELGKENSRVNNLFHAAMSNHSKLYMNAIL  182



>ref|XP_002988275.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|EFJ10694.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 97/172 (56%), Gaps = 4/172 (2%)
 Frame = +2

Query  53   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLE  229
            RL+IMELA M SVPM+L   + ++VA+ I + G    LSA+EI+S +       +P  L+
Sbjct  14   RLQIMELATMCSVPMALKVAVEMDVAERIEKAGPGGLLSAAEIVSQIPECSSPMSPIYLD  73

Query  230  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  409
            R++R+L S  IF+E    +   R+Y +  + K L+ D+ G+S   +VL +     M+ W 
Sbjct  74   RIMRVLASRKIFKE--VDEGGVRKYGLTSMCKHLIKDERGVSLAHHVLMNQDKVFMETWQ  131

Query  410  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             +HEAV+D   EPF K  G+  +    +N  +N+L   AMS  S  +M A L
Sbjct  132  YLHEAVLDGG-EPFTKAFGQTEFELGKENSRVNNLFHAAMSNHSKLYMNAIL  182



>ref|XP_002986521.1| hypothetical protein SELMODRAFT_124205 [Selaginella moellendorffii]
 gb|EFJ12378.1| hypothetical protein SELMODRAFT_124205 [Selaginella moellendorffii]
Length=238

 Score =   102 bits (255),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 102/186 (55%), Gaps = 8/186 (4%)
 Frame = +2

Query  8    LKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILS  187
            +  +G+M  + D+  RLRIME   M  +P +L AVI+L + D I     +APLS++EI++
Sbjct  1    MGSLGSMVLQDDD--RLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIA  57

Query  188  SVLPSGG-GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTD--KDGLSY  358
             +   G  G   NL+R+LR+L+S G+F+E ++ D   R+Y V  + + LVT+    GL  
Sbjct  58   QIPACGSSGSGANLDRILRVLSSVGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNSGLPL  116

Query  359  GAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGI  538
             ++V  +     MK W  ++++V  +  +PF   +G+  +     NP    +   AMS  
Sbjct  117  SSWVTLNQDVVFMKTWEFLYQSVT-TGADPFTAAHGKPVFDLTANNPRFRGIFDSAMSDN  175

Query  539  SVPFMK  556
            S  +M+
Sbjct  176  SNAYMR  181



>ref|XP_002986612.1| hypothetical protein SELMODRAFT_124122 [Selaginella moellendorffii]
 gb|EFJ12469.1| hypothetical protein SELMODRAFT_124122 [Selaginella moellendorffii]
Length=235

 Score =   102 bits (253),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 95/171 (56%), Gaps = 6/171 (4%)
 Frame = +2

Query  53   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDAPNLE  229
            RLRIME   M  +P +L AVI+L + D I     +APLS++EI++ +   G  G   NL+
Sbjct  11   RLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSGANLD  69

Query  230  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTD--KDGLSYGAYVLQHHQAAMMKA  403
            R+LR+L+S G+F+E ++ D   R+Y V  + + LVT+    GL   ++V+ +     MK 
Sbjct  70   RILRVLSSVGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIANQDVVFMKT  128

Query  404  WPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            W  ++++V  +  +PF   +G+  +     NP    +   AMS  S  +M+
Sbjct  129  WEFLYQSVT-TGADPFTAAHGKPLFDLTADNPRFRGIFDSAMSDNSNAYMR  178



>ref|XP_002965284.1| hypothetical protein SELMODRAFT_83100 [Selaginella moellendorffii]
 gb|EFJ34122.1| hypothetical protein SELMODRAFT_83100 [Selaginella moellendorffii]
Length=235

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 95/171 (56%), Gaps = 6/171 (4%)
 Frame = +2

Query  53   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGG-GDAPNLE  229
            RLRIME   M  +P +L AVI+L + D I     +APLS++EI++ +   G  G   NL+
Sbjct  11   RLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIPACGSSGSGANLD  69

Query  230  RLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTD--KDGLSYGAYVLQHHQAAMMKA  403
            R+LR+L+S G+F+E ++ D   R+Y V  + + LVT+    GL   ++V+ +     MK 
Sbjct  70   RILRVLSSIGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSWVIVNQDVVFMKT  128

Query  404  WPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            W  ++++V  +  +PF   +G+  +     NP    +   AMS  S  +M+
Sbjct  129  WEFLYQSVT-TGADPFTAAHGKPLFDLTADNPRFRGIFDSAMSDNSNAYMR  178



>gb|ADE88153.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase-like 
2 [Selaginella moellendorffii]
Length=357

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 102/183 (56%), Gaps = 8/183 (4%)
 Frame = +2

Query  17   IGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVL  196
            +G++  + D+  RLRIME   M  +P +L AVI+L + D I     +APLS++EI++ + 
Sbjct  1    MGSLVLQDDD--RLRIMEFGTMCGIPSALNAVIKLGIPD-ILSSSQDAPLSSAEIIAQIP  57

Query  197  PSGG-GDAPNLERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTD--KDGLSYGAY  367
              G  G   NL+R+LR+L+S G+F+E ++ D   R+Y V  + + LVT+    GL   ++
Sbjct  58   ACGSSGSGANLDRILRVLSSIGVFQESLH-DGGIRKYGVTPLCRYLVTNPSNGGLPLSSW  116

Query  368  VLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVP  547
            V+ +     MK W  ++++V  +  +PF   +G+  +     NP    +   AMS  S  
Sbjct  117  VIVNQDVVFMKTWEFLYQSVT-TGADPFTAAHGKPLFDLTADNPRFRGIFDSAMSDNSNA  175

Query  548  FMK  556
            +M+
Sbjct  176  YMR  178



>gb|AFM73596.1| caffeate O-methyltransferase, partial [Populus simonii]
Length=300

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 91/166 (55%), Gaps = 8/166 (5%)
 Frame = +2

Query  86   SVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLERLLRMLTSYGI  262
            +VPM+L A I L+V + I +GG  A LSA EI +  LP+   DAP  L+R+LR+L SY +
Sbjct  5    AVPMALKAAIELDVLEIIAKGGPGAHLSALEI-ARCLPTQNADAPIMLDRMLRLLASYNV  63

Query  263  FREHI-----NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAV  427
                I        + ERRY +  V K L+ ++DG+S    VL +     M++W  + EAV
Sbjct  64   LTCSIVSLDGGCGSIERRYGLAPVCKFLIRNQDGVSIAPLVLMNQDKVTMESWYHLKEAV  123

Query  428  VDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +D  I PF K +G + + Y+  +P  N +  + MS  S   MK  L
Sbjct  124  LDGGI-PFNKAHGMSAFEYHSTDPRFNKIFNRTMSDHSTLVMKKIL  168



>gb|KDO54338.1| hypothetical protein CISIN_1g032721mg [Citrus sinensis]
Length=135

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  395  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            M AWPLVHEAV+D +IEPFVKV+GE  YSYYGK PEMN LM+KAMSG+SVPFM + L
Sbjct  1    MSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVL  57



>ref|XP_006280681.1| hypothetical protein CARUB_v10026645mg [Capsella rubella]
 gb|EOA13579.1| hypothetical protein CARUB_v10026645mg [Capsella rubella]
Length=363

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 102/180 (57%), Gaps = 8/180 (4%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D+ A L  M+LA+   +PM+L A + L++ + + +  S  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKAALELDLLEIMAKNAS--PMSPTEI-ASKLPTKNPEA  71

Query  218  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+LTSY +       ++ D+ ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G + + Y+G +P  N +    MS  S   MK FL
Sbjct  132  KVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTIAMKKFL  190



>gb|AFK40372.1| unknown [Lotus japonicus]
Length=365

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 97/180 (54%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + I L++ + I + G+ A LS +EI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEFIAKAGTGAQLSPAEI-ASQLPTTNPDA  73

Query  218  PN-LERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L  Y I    +  +     +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PTVLDRMLRLLACYNILTCSVRTEQDGKVQRLYGLAPVAKYLVKNEDGVSISALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192



>ref|XP_010241050.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Nelumbo nucifera]
Length=364

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 95/172 (55%), Gaps = 8/172 (5%)
 Frame = +2

Query  65   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLERLLR  241
            M+LA+   VPM L A I L+V + I + G+ A +S SEI +S LP+   DAP  L+R+LR
Sbjct  23   MQLASASVVPMVLKAAIELDVLEIIAEAGAGAHISTSEI-ASHLPTQNPDAPVMLDRMLR  81

Query  242  MLTSYGI----FREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWP  409
            +L S+ I     R H +    ER Y +  V K LV ++DG+S    VL +    +M++W 
Sbjct  82   LLASFSILTCSLRTHDDGRV-ERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLMESWY  140

Query  410  LVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             + +AV+D  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  141  HLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  191



>ref|XP_010027213.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=128

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  395  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            M+AWPLVHEA+++ + EPFVK NG+  Y++YGKNPEMN LMQ+AMSG+SVPFMKA L
Sbjct  1    MRAWPLVHEAMLNPTSEPFVKANGDTAYAHYGKNPEMNELMQQAMSGVSVPFMKAIL  57



>ref|XP_006451875.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
 gb|ESR65115.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
Length=222

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  395  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            M AWPLVHEAV+D +IEPFVKV+GE  YSYYGK PEMN LM+KAMSG+SVPFM + L
Sbjct  1    MSAWPLVHEAVLDPTIEPFVKVHGEPAYSYYGKMPEMNGLMRKAMSGVSVPFMTSVL  57



>ref|XP_006432602.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
 gb|ESR45842.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
Length=206

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  395  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            M AWPLVHEA++D +IEPFVKV+GE  YSYYGK PEMN LM+KAMSG+SVPFM + L
Sbjct  1    MSAWPLVHEAILDPTIEPFVKVHGEPTYSYYGKMPEMNGLMRKAMSGVSVPFMTSIL  57



>gb|AAB96879.1| O-methyltransferase 1 [Arabidopsis thaliana]
Length=363

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 101/180 (56%), Gaps = 8/180 (4%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D+ A L  M+LA+   +PM+L + + L++ + + + GS  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPTEI-ASKLPTKNPEA  71

Query  218  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+LTSY +       ++ D  ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +A++D  I PF K  G + + Y+G +P  N +    MS  S   MK  L
Sbjct  132  KVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKIL  190



>ref|NP_200227.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Arabidopsis 
thaliana]
 sp|Q9FK25.1|OMT1_ARATH RecName: Full=Flavone 3'-O-methyltransferase 1; Short=AtOMT1; 
AltName: Full=Caffeate O-methyltransferase 1; AltName: Full=Quercetin 
3'-O-methyltransferase 1 [Arabidopsis thaliana]
 dbj|BAB11578.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAL32915.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAM10127.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AAM64849.1| O-methyltransferase [Arabidopsis thaliana]
 gb|AED96460.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Arabidopsis 
thaliana]
Length=363

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 101/180 (56%), Gaps = 8/180 (4%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D+ A L  M+LA+   +PM+L + + L++ + + + GS  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPTEI-ASKLPTKNPEA  71

Query  218  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+LTSY +       ++ D  ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +A++D  I PF K  G + + Y+G +P  N +    MS  S   MK  L
Sbjct  132  KVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKIL  190



>gb|ABU53653.1| caffeic acid O-3-methyltransferase [Populus deltoides]
Length=364

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 96/181 (53%), Gaps = 8/181 (4%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGI----FREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
            P  L+R+LR+L SY I     ++H +    ER Y +  V K L  ++DG+S     L + 
Sbjct  74   PVMLDRILRLLASYSILTCSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVSVSPLCLMNQ  132

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
               +M++W  + +A++D  I PF K  G   + Y+G +P  N +  K MS  S   MK  
Sbjct  133  DKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKI  191

Query  563  L  565
            L
Sbjct  192  L  192



>ref|XP_002864309.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40568.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=363

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 101/180 (56%), Gaps = 8/180 (4%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D+ A L  M+LA+   +PM+L + + L++ + + + GS  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPTEI-ASHLPTKNPEA  71

Query  218  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+LTSY +       ++ D  ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +A++D  I PF K  G + + Y+G +P  N +    MS  S   MK  L
Sbjct  132  KVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKIL  190



>prf||1906376A O-methyltransferase
Length=364

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 96/181 (53%), Gaps = 8/181 (4%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGI----FREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
            P  L+R+LR+L SY I     ++H +    ER Y +  V K L  ++DG+S     L + 
Sbjct  74   PVMLDRILRLLASYSILICSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVSVSPLCLMNQ  132

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
               +M++W  + +A++D  I PF K  G   + Y+G +P  N +  K MS  S   MK  
Sbjct  133  DKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKI  191

Query  563  L  565
            L
Sbjct  192  L  192



>gb|AAF60951.1| O-methyltransferase [Populus trichocarpa x Populus deltoides]
Length=364

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 96/181 (53%), Gaps = 8/181 (4%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGI----FREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
            P  L+R+LR+L SY I     ++H +    ER Y +  V K L  ++DG+S     L + 
Sbjct  74   PVMLDRILRLLASYSILTCSLKDHPDGKV-ERLYGLAPVCKFLTKNEDGVSVSPLCLMNQ  132

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
               +M++W  + +A++D  I PF K  G   + Y+G +P  N +  K MS  S   MK  
Sbjct  133  DKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKI  191

Query  563  L  565
            L
Sbjct  192  L  192



>dbj|BAD83867.1| Caffeic acid O-methyltransferase [Iris x hollandica]
Length=365

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 96/181 (53%), Gaps = 7/181 (4%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+L +   +PM+L A I L++ + I + G  A LS +EI SS LP+   +A
Sbjct  16   SDEEACLYAMQLRSFSVLPMTLKAAIELDLLEIIAKAGPGAYLSPAEI-SSQLPTENPEA  74

Query  218  PNL-ERLLRMLTSYGIFREHINADASE----RRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
            P + +R+LR+L  Y +    ++A   +    RRY  + V K L  ++DG+S  A  L + 
Sbjct  75   PAMIDRMLRLLACYSVVSCRVDAAGDDGKPRRRYGAERVVKYLTKNEDGVSMAALTLMNQ  134

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
                M++W  + +AV++  I PF K  G +P+ Y G +P  N +  + M   S   MK  
Sbjct  135  DKVFMESWYHLKDAVLEGGI-PFKKAFGMSPFEYQGTDPRFNKVFNEGMRNHSAFIMKKI  193

Query  563  L  565
            L
Sbjct  194  L  194



>ref|XP_007136428.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
 gb|ESW08422.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
Length=365

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 97/180 (54%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + I L++ + I +GG    LS S+I +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIIAKGGPGVHLSPSQI-ASQLPTRNPEA  73

Query  218  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLASYNILSFTLRTLPDGKVERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192



>gb|AFK39562.1| unknown [Lotus japonicus]
Length=359

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 87/177 (49%), Gaps = 4/177 (2%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  MELA   SVPM L + + L V + I + G  A LS SEI+S +      DA
Sbjct  13   SDEEALLFAMELAGASSVPMVLKSALDLGVIETIAKAGPGAYLSPSEIVSQIPSIKNPDA  72

Query  218  PN-LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  394
            P+ L RLLR+L SY I          ER Y +    K  V ++DG+S  +  L  H   +
Sbjct  73   PSMLNRLLRLLASYNILT--FQGSEPERHYGLSPYAKYFVNNQDGVSMISSFLMQHDKVL  130

Query  395  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
               W  + +++ +  + PF    G   + ++GKNP  N++  K MS  S   MK  L
Sbjct  131  KDMWYHLTDSIQEGGL-PFDNAYGMTSFEFHGKNPRFNNIFNKGMSDYSTIIMKKVL  186



>ref|XP_002317838.1| Chain A family protein [Populus trichocarpa]
 gb|ABK92533.1| unknown [Populus trichocarpa]
 gb|ACC63886.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa]
 gb|ACJ76441.1| caffeic acid 3-O-methyltransferase 1 [Populus trichocarpa]
 gb|EEE96058.1| Chain A family protein [Populus trichocarpa]
Length=364

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +A++D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKLL  192



>ref|XP_011043758.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Populus euphratica]
Length=365

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +A++D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192



>gb|AFZ78575.1| caffeic acid O-methyltransferase [Populus tomentosa]
Length=365

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +A++D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192



>sp|Q00763.1|COMT1_POPTM RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus tremuloides]
 emb|CAA44006.1| lignin bispecific acid/5-hydroxyferulic acid methyltransferase 
[Populus tremuloides]
 gb|AAB61731.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Populus 
tremuloides]
Length=365

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +A++D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192



>gb|AEV93478.1| caffeic acid O-methyltransferase [Caragana korshinskii]
Length=365

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 96/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + + L++ + I + G  A LS ++I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAHLSPNDI-ASQLPTNNPDA  73

Query  218  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L  Y IF      +     +R Y +  V K L+ ++DG+S  A  L +  
Sbjct  74   PIMLDRMLRLLACYNIFTCSLRTLQDGKVQRLYGLAPVAKYLIKNEDGVSLSALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192



>gb|AFK45226.1| unknown [Lotus japonicus]
Length=359

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 86/177 (49%), Gaps = 4/177 (2%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  MELA   SVPM L + + L V + I + G  A LS SEI S +      DA
Sbjct  13   SDEEALLFAMELAGASSVPMVLKSALDLGVIETIAKAGPGAYLSPSEIASQIPSIKNPDA  72

Query  218  PN-LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAM  394
            P+ L RLLR+L SY I          ER Y +    K  V ++DG+S  +  L  H   +
Sbjct  73   PSMLNRLLRLLASYNILT--FQGSEPERHYGLSPYAKYFVNNQDGVSMISSFLMQHDKVL  130

Query  395  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
               W  + +++ +  + PF    G   + ++GKNP  N++  K MS  S   MK  L
Sbjct  131  KDMWYHLTDSIQEGGL-PFDNAYGMTSFEFHGKNPRFNNIFNKGMSDYSTIIMKKVL  186



>ref|XP_003621323.1| Isoliquiritigenin 2'-O-methyltransferase [Medicago truncatula]
 gb|AES77541.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=370

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 93/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  41   DNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP  220
            D+   L  M L   +  P  L A I LN+ + I +  +   +SA EI +S LP+   D P
Sbjct  21   DDSDTLLAMVLGANMVFPAVLNAAIELNLFEIIAKESNGDFMSAFEI-ASKLPTQHSDLP  79

Query  221  N-LERLLRMLTSYGIFREHI---NADASERRYSVDEVGKTLVTDK-DGLSYGAYVLQHHQ  385
            N L+R+LRML SY +        + D++ R Y V   GK  V D+ DG   G++      
Sbjct  80   NRLDRMLRMLASYSLLSVSTRTNDDDSTVRVYGVTSSGKYFVNDENDGGYLGSFTSFMCH  139

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             A++  W    EAV+D  I+ F KVNG + Y Y+GK+P++N L  K+M+      MK  L
Sbjct  140  RALLGVWLNFKEAVIDPEIDLFKKVNGISKYEYFGKDPQINQLFNKSMTDTCNVHMKRIL  199



>gb|ACY06328.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + + L++ + I + G  A +S  EI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGAQISPIEI-ASQLPTTNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L  Y I    +        +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192



>gb|AER35881.1| S-adenosyl-L-methionine:flavonoid O-methyltransferase [Ginkgo 
biloba]
Length=362

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 89/170 (52%), Gaps = 4/170 (2%)
 Frame = +2

Query  65   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  244
            MEL N   +PM++ A + L+V   I   G  A +S  EI++ +  +    A  L+R+LR+
Sbjct  20   MELGNFSCLPMAMKAAVELDVLQIIANAGHGAQISPREIVTHIPTTNPDAAITLDRILRV  79

Query  245  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  415
            L S+ +    +  D    + R Y +  + K LV +KDG+S    VL +     M++W  +
Sbjct  80   LASHSVLSSSVTTDENGKTGRVYGLTPLCKYLVQNKDGVSLAPLVLMNQDKVFMESWYYL  139

Query  416  HEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             +AV+D S +PF K +G   + Y  K+P  N++  +AM+  S   M+  L
Sbjct  140  KDAVLDGS-QPFTKAHGVNAFEYPAKDPRFNNVFNRAMAEHSTMLMQKIL  188



>gb|KHF97637.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=308

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 99/189 (52%), Gaps = 7/189 (4%)
 Frame = +2

Query  2    GKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEI  181
            G  KE  +   + +   +L +  LAN + +PM L + + LN+ D I   G  A LS S+I
Sbjct  17   GAEKETMSQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI  75

Query  182  LSSVLPSGGGDAPNL-ERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDG  349
             +S LPS   DAP L +R+LR+L S+ I +  + A   +  ER Y    + K LV ++DG
Sbjct  76   -ASALPSKNPDAPVLLDRMLRLLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDG  134

Query  350  LSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAM  529
             S    +L HH    M++W  +++A+++  + PF K  G   + Y G +   N +  +AM
Sbjct  135  GSIAPLLLLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAM  193

Query  530  SGISVPFMK  556
            S  +   M+
Sbjct  194  SNHTALIMR  202



>gb|KHF97352.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
 gb|KHG01818.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
 gb|KHG22578.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=286

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 91/168 (54%), Gaps = 6/168 (4%)
 Frame = +2

Query  65   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  241
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  242  MLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  412
            +L S+ I +  + A   +  ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  413  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            +++A+++  + PF K  G   + Y G +   N +  +AMS  +   M+
Sbjct  134  LNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALIMR  180



>sp|Q8W013.1|COMT1_CATRO RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Catharanthus roseus]
 gb|AAK20170.1| caffeic acid O-methyltransferase [Catharanthus roseus]
Length=363

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 99/182 (54%), Gaps = 6/182 (3%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            ++ +  A L  M LA+   +PM L + I L++ + I + G  A +S SE L++ LP+   
Sbjct  13   TKEEEEACLSAMRLASASVLPMVLKSAIELDLLELIKKSGPGAYVSPSE-LAAQLPTQNP  71

Query  212  DAP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  379
            DAP  L+R+LR+L SY +     + +     ER YS+  V K L  ++DG+S  A +L +
Sbjct  72   DAPVMLDRILRLLASYSVLNCTLKDLPDGGIERLYSLAPVCKFLTKNEDGVSMAALLLMN  131

Query  380  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  559
                +M++W  + +AV++  I PF K  G   + Y+GK+P  N +  + MS  S   MK 
Sbjct  132  QDKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGKDPRFNKVFNQGMSNHSTIIMKK  190

Query  560  FL  565
             L
Sbjct  191  IL  192



>gb|ABO41840.1| putative caffeic acid methyltransferase [Gossypium arboreum]
Length=358

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 91/168 (54%), Gaps = 6/168 (4%)
 Frame = +2

Query  65   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  241
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  242  MLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  412
            +L S+ I +  + A   +  ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  413  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            +++A+++  + PF K  G   + Y G +   N +  +AMS  +   M+
Sbjct  134  LNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALIMR  180



>ref|XP_006401613.1| hypothetical protein EUTSA_v10013897mg [Eutrema salsugineum]
 gb|ESQ43066.1| hypothetical protein EUTSA_v10013897mg [Eutrema salsugineum]
Length=364

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 101/181 (56%), Gaps = 9/181 (5%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D+ A L  M+LA+   +PM+L + + L++ + + +  +  P+S SEI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAK--NTKPMSPSEI-ASHLPTKNPEA  71

Query  218  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
            P  L+R+LR+LT+Y +     R   N D  ER Y +  V K L  ++DG+S  A  L + 
Sbjct  72   PVMLDRILRLLTAYSVLTCSNRTLPNGDGVERLYGLGPVCKYLTKNEDGVSIAALCLMNQ  131

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
               +M++W  + +A++D  I PF K  G + + Y+GK+   N++    MS  S   MK  
Sbjct  132  DKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGKDLRFNTVFNNGMSNHSTITMKKI  190

Query  563  L  565
            L
Sbjct  191  L  191



>dbj|BAJ34520.1| unnamed protein product [Thellungiella halophila]
Length=364

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 101/181 (56%), Gaps = 9/181 (5%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D+ A L  M+LA+   +PM+L + + L++ + + +  +  P+S SEI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAK--NTKPMSPSEI-ASHLPTKNPEA  71

Query  218  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
            P  L+R+LR+LT+Y +     R   N D  ER Y +  V K L  ++DG+S  A  L + 
Sbjct  72   PVMLDRILRLLTAYSVLTCSNRTLPNGDGVERLYGLGPVCKYLTKNEDGVSIAALCLMNQ  131

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
               +M++W  + +A++D  I PF K  G + + Y+GK+   N++    MS  S   MK  
Sbjct  132  DKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGKDLRFNTVFNNGMSNHSTITMKKI  190

Query  563  L  565
            L
Sbjct  191  L  191



>gb|AAF63200.1| caffeic acid O-3-methyltransferase [Populus tomentosa]
Length=360

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +A+++  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAILEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192



>sp|P28002.1|COMT1_MEDSA RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Medicago sativa]
 pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|F Chain F, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYZ|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|E Chain E, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 gb|AAB46623.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + + L++ + I + G  A +S  EI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGAQISPIEI-ASQLPTTNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L  Y I    +        +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLACYIILTCSVRTQQDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192



>sp|Q43046.1|COMT1_POPKI RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus sieboldii x Populus 
grandidentata]
 dbj|BAA08558.1| caffeic acid O-methyltransferase [Populus kitakamiensis]
Length=365

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L   I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEI-ASHLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I     + +     ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +A+++  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAILEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192



>gb|ABO41845.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=358

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 91/168 (54%), Gaps = 6/168 (4%)
 Frame = +2

Query  65   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  241
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  242  MLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  412
            +L S+ I +  + A   +  ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCAVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  413  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            +++A+++  + PF K  G   + Y G +   N +  +AMS  +   M+
Sbjct  134  LNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALIMR  180



>gb|ACN41351.2| putative caffeic acid O-methyltransferase [Betula pendula]
Length=365

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 96/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + I L++ + + + G  A LS SEI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSAIELDLLEIMAKAGPGAYLSPSEI-ASQLPTTNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLASYSVLTYSLRTLPDGRVERLYGLGPVCKFLTKNEDGVSIAALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K +G   + Y+GK+   N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAHGMTSFEYHGKDLRFNKVFNKGMSDHSTITMKKIL  192



>gb|AAD29845.1|AF064697_1 O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 92/180 (51%), Gaps = 4/180 (2%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  214
            E +  A L  M+LA+   +PM L A I L+V + I + G  A ++ SEI S +  S    
Sbjct  13   EEEEEACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGQGAYVAPSEIASQLSTSNSQA  72

Query  215  APNLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
               L+R+LR+L SY +   ++        ER Y +  V K LV ++DG+S    VL +  
Sbjct  73   PIILDRILRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQD  132

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  133  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKLL  191



>ref|XP_003602396.1| Caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AES72647.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=365

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + + L++ + I + G  A +S  EI +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAQISPIEI-ASQLPTTNPEA  73

Query  218  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L  Y I    +        +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192



>gb|AFK39235.1| unknown [Medicago truncatula]
Length=365

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + + L++ + I + G  A +S  EI +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGAQISPIEI-ASQLPTTNPEA  73

Query  218  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L  Y I    +        +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILTCSVRTQQDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192



>dbj|BAO79380.1| 5-hydroxyconiferylaldehyde O-methyltransferase [Anthriscus sylvestris]
Length=365

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 97/182 (53%), Gaps = 6/182 (3%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            ++ +  A +  M+LA+   +PM L + I LN+ +AI + G  A +S SE L++ LPS   
Sbjct  15   NDEEEEACMFAMQLASASVLPMVLKSAIELNLLEAIAKAGPGAYVSPSE-LAAGLPSSQP  73

Query  212  DAP-NLERLLRMLTSYGIFREHIN---ADASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  379
            D P  L+R+LR+L SY + +  +        ER Y +  V K L  + DG+S    +L +
Sbjct  74   DTPVMLDRILRLLASYSVLKCQLRDLPHGRVERLYGLAPVCKFLTKNSDGVSMAPLLLMN  133

Query  380  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  559
                +M++W  + +AV+D  I PF K  G   + Y+GK+P  N +  + MS  S   MK 
Sbjct  134  QDKILMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGKDPRFNKVFNQGMSNHSTITMKK  192

Query  560  FL  565
             L
Sbjct  193  IL  194



>ref|XP_001762717.1| predicted protein [Physcomitrella patens]
 gb|EDQ72516.1| predicted protein [Physcomitrella patens]
Length=378

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 95/175 (54%), Gaps = 4/175 (2%)
 Frame = +2

Query  53   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLER  232
            RL  +EL    ++P +L ++ RLNV +A+ + G    L+  E+ +  +P    +   L R
Sbjct  30   RLAAIELVGQAAIPGTLASLARLNVFEALARAGDGVELTPQELGNQAMPGKVINLSYLGR  89

Query  233  LLRMLTSYGIFRE--HINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKA  403
            +LR+ +S  + RE   ++ D S E RY ++ +GK LV D +  S    +L +     +  
Sbjct  90   MLRLASSVKVLREVATMSEDGSTEHRYGLEPIGKFLVDDAEKGSLVHLLLMYQDPVFLST  149

Query  404  WPLVHEAVVDSSIEPFVKVNGEAPYSYYG-KNPEMNSLMQKAMSGISVPFMKAFL  565
            W  + E+V+D S++PF + +G      YG +NPE +    KAM+G S  +M+AFL
Sbjct  150  WNHLPESVLDDSVQPFARAHGGLHAWEYGMQNPEFDEKFNKAMAGHSKLYMRAFL  204



>gb|ACT32028.1| caffeic acid O-methyltransferase 1 [Gossypium hirsutum]
Length=366

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD+ A L  M+LA+   +PM L + I L++ + + + G  A LS  E+ +S LP+   DA
Sbjct  15   SDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKEV-ASKLPTTNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLASYNVLTCSLRTFPGGKVERLYGLGPVCKFLTRNEDGVTLSALSLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192



>gb|KHG13754.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=387

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD+ A L  M+LA+   +PM L + I L++ + + + G  A LS  E+ +S LP+   DA
Sbjct  37   SDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKEV-ASKLPTTNPDA  95

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  96   PVMLDRILRLLASYNVLTCSLRTFPGGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  155

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  156  KVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  214



>ref|XP_002971011.1| hypothetical protein SELMODRAFT_94918 [Selaginella moellendorffii]
 gb|EFJ27609.1| hypothetical protein SELMODRAFT_94918 [Selaginella moellendorffii]
Length=385

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 12/181 (7%)
 Frame = +2

Query  53   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV----LPSGGGDAP  220
            R RIMEL  + +VPM+L A IRL+V   I   G +A LSA+EI++ +     P+ GG   
Sbjct  19   RQRIMELGLLCNVPMALTAAIRLDVFQIIASAGCDAMLSAAEIVARIPGCQSPALGGIV-  77

Query  221  NLERLLRMLTSYGIFREHINAD----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  388
             L R+LR+L S GIFRE +  D    A+ RRY +  + + L+ D  G S   ++  +H  
Sbjct  78   -LNRILRVLASRGIFREDVERDDPAPAAIRRYGLTNLCRFLLKDDRGASLAPWISLNHDE  136

Query  389  AMMKAWPLVHEAVVD-SSIEPF-VKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
             +M+ W  + +AV+      PF +   GE  +    ++  ++ L   AM   S+ F+ A 
Sbjct  137  ILMRPWQFLADAVLSGGQTSPFSLAHGGEHFFQLASRSDRLDRLFTSAMCDHSMIFLPAI  196

Query  563  L  565
            L
Sbjct  197  L  197



>gb|AIJ28474.1| O-methyltransferase [Vaccinium corymbosum]
Length=370

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 99/184 (54%), Gaps = 6/184 (3%)
 Frame = +2

Query  26   MGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSG  205
            +GSE +  A L  M+LA+   +PM L + I L++ + + + G  A +S +E L++ LP+ 
Sbjct  16   VGSEEEEEACLFAMQLASASVLPMVLKSAIELDLLETMAKAGPGAFVSPTE-LAAQLPTQ  74

Query  206  GGDAP-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVL  373
              DA   L+R+LR+LTSY +    + +      ER Y++  V K L  + DG+S    +L
Sbjct  75   NPDAAVMLDRILRLLTSYSVLNCSVKSLPGGGVERLYALAPVCKYLTRNSDGVSMAPLLL  134

Query  374  QHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFM  553
             +    +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + MS  S   M
Sbjct  135  MNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITM  193

Query  554  KAFL  565
            K  L
Sbjct  194  KKIL  197



>gb|ABO41834.1| putative caffeic acid methyltransferase [Gossypium raimondii]
Length=358

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 91/171 (53%), Gaps = 6/171 (4%)
 Frame = +2

Query  65   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  241
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTISAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  242  MLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  412
            +L S+ I +  + A      ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  413  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +++A+++  + PF K  G   + Y G +   N +  +AMS  +   M+  +
Sbjct  134  LNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALIMRKIV  183



>dbj|BAA13683.1| O-methyltransferase [Glycyrrhiza echinata]
Length=367

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 94/180 (52%), Gaps = 5/180 (3%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGS-NAPLSASEILSSV-LPSGG  208
            ++++GA L  M L   +  P  L A I LN+ + I +     A +SASEI S + LP+  
Sbjct  19   QTEDGACLSAMRLVTNLVYPAVLNAAIDLNLFEIIAKATPPGAFMSASEIASKLPLPTQH  78

Query  209  GDAPN-LERLLRMLTSYGIFREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
             D PN L+R+LR+L SY +        ++ER Y + +VGK LV D       ++      
Sbjct  79   SDLPNRLDRMLRLLASYSVLT--CATRSTERVYGLSQVGKYLVPDGSRGYLASFTTFLCY  136

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             A+M  W    EAVVD  I+ F K++G + Y Y   +P+MN +  K+M+ +    MK  L
Sbjct  137  PALMNVWLNFKEAVVDEDIDLFKKLHGVSKYEYMETDPKMNHIFNKSMADVCATEMKRIL  196



>ref|XP_009352092.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Pyrus x bretschneideri]
Length=269

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 97/180 (54%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA++  +PM L A I L++ + + + G    +S ++ LSS LP+   DA
Sbjct  15   SDEEASLFAMQLASVSVLPMVLKAAIELDLLEIMAKAGPGVFVSPAD-LSSQLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I       +     ER Y +  V K L T++DG+S  +  L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLQDGKVERLYGLGPVCKFLTTNEDGVSIASLCLMNLD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
               +++W  + +AV++  I PF K  G   + Y+G +P  N +  +AM+ IS   MK  L
Sbjct  134  KVPVESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRAMADISTITMKKIL  192



>gb|KJB16304.1| hypothetical protein B456_002G222400 [Gossypium raimondii]
Length=404

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 99/192 (52%), Gaps = 7/192 (4%)
 Frame = +2

Query  2    GKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEI  181
            G  KE  +   + +   +L +  LAN + +PM L + + LN+ D I   G  A LS S+I
Sbjct  41   GAEKETMSQEDQEEEVGKLAV-RLANAVVLPMVLKSALELNIIDTISAAGDGAFLSPSQI  99

Query  182  LSSVLPSGGGDAPNL-ERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDG  349
             +S LPS   DAP L +R+LR+L S+ I +  + A      ER Y    + K LV ++DG
Sbjct  100  -ASALPSKNPDAPVLLDRMLRLLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDG  158

Query  350  LSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAM  529
             S    +L HH    M++W  +++A+++  + PF K  G   + Y G +   N +  +AM
Sbjct  159  GSIAPLLLLHHDQVFMQSWYHLNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAM  217

Query  530  SGISVPFMKAFL  565
            S  +   M+  +
Sbjct  218  SNHTALIMRKIV  229



>gb|AGG91492.1| caffeic acid 3-O-methyltransferase [Betula platyphylla]
Length=365

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 96/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + I L++ + + + G  A LS SE+ +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSAIELDLLEIMAKAGPGAYLSPSEV-ASQLPTTNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLASYSVLTYSLRTLPDGRVERLYGLGPVCKFLTKNEDGVSIAALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K +G   + Y+GK+   N +  K MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAHGMTSFEYHGKDLRFNKVFNKGMSDHSTITMKKIL  192



>prf||2119166A caffeic acid O-methyltransferase
Length=365

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 91/179 (51%), Gaps = 4/179 (2%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + I L+V + I + G    LS ++I ++V  +    A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDVLEIIAKAGPGVHLSPADIAANVPTTNPDAA  74

Query  218  PNLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  388
              L+R+LR+L  Y I    +        ER Y +  V K LV ++DG+S  A  L +H  
Sbjct  75   VMLDRMLRLLACYNILNHSLRTLPDGKVERLYGLAPVAKFLVKNEDGVSLSALNLMNHDK  134

Query  389  AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             +M++W  + E V++  I PF K  G   + Y+G +P  N +  K M+  +   MK  L
Sbjct  135  VLMESWYYLKETVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMNDHTTITMKKIL  192



>ref|XP_006441597.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
 gb|ESR54837.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
Length=181

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  65   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLER  232
            MELANMISVPMSL A IRL+V DAI QGG+N PLSAS+IL+ +LPSGGGDA NL+R
Sbjct  1    MELANMISVPMSLTAAIRLHVPDAIRQGGANTPLSASQILTCILPSGGGDAENLQR  56



>ref|XP_002962074.1| hypothetical protein SELMODRAFT_76630 [Selaginella moellendorffii]
 gb|EFJ37334.1| hypothetical protein SELMODRAFT_76630 [Selaginella moellendorffii]
Length=385

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 12/181 (7%)
 Frame = +2

Query  53   RLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSV----LPSGGGDAP  220
            R RIMEL  + +VPM+L A IRL+V   I   G +A LSA+EI++ +     P+ GG   
Sbjct  19   RQRIMELGLLCNVPMALTAAIRLDVFQIIASAGCDAMLSAAEIVARIPGCQSPALGGIV-  77

Query  221  NLERLLRMLTSYGIFREHINAD----ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  388
             L R+LR+L S GIFRE +  D    A+ RRY +  + + L+ D  G S   ++  +H  
Sbjct  78   -LNRILRVLASRGIFREDVERDDPAPAAIRRYGLTNLCRFLLKDDRGASLAPWISLNHDE  136

Query  389  AMMKAWPLVHEAVVD-SSIEPF-VKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
             +M+ W  + +AV+      PF +   GE  +    ++  ++ L   AM   S+ F+ A 
Sbjct  137  ILMRPWQFLADAVLSGGQTSPFSLAHGGEHFFQLASRSNRLDRLFTSAMCDHSMIFLPAI  196

Query  563  L  565
            L
Sbjct  197  L  197



>gb|KDP30064.1| hypothetical protein JCGZ_18389 [Jatropha curcas]
Length=365

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + I L++ + I + G  A LS  +I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIIGKAGPGAFLSPYDI-ASQLPTKNPDA  73

Query  218  PN-LERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I    +        E+ Y +  V K L  ++DG+S     L +  
Sbjct  74   PVVLDRILRLLASYSILTYSLRTLPDGKVEKLYGLAPVCKFLTKNEDGVSIAPLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + EAV++  I PF K  G   + Y+G +P  N++  K MS  S   MK  L
Sbjct  134  KVLMESWYHLKEAVLEGGI-PFNKAYGMTAFEYHGTDPRFNTVFNKGMSDHSTITMKKIL  192



>gb|ACD56610.1| putative caffeic acid protein [Gossypioides kirkii]
Length=358

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 90/171 (53%), Gaps = 6/171 (4%)
 Frame = +2

Query  65   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  241
            + LAN + +PM L + + LN+ D I   G    LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTISAAGDGTFLSPSQI-ASCLPSKNPDAPVLLDRMLR  73

Query  242  MLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  412
            +L S+ I +  + A      ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  413  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +++A+++  + PF K  G   + Y G +   N +  +AMS  +   M+  +
Sbjct  134  LNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTTLIMRKIV  183



>ref|NP_001242325.1| uncharacterized protein LOC100805999 [Glycine max]
 gb|ACU21012.1| unknown [Glycine max]
Length=365

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I SS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGVHLSPTDI-SSQLPTQNPDA  73

Query  218  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192



>gb|KHN23296.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I SS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPGVHLSPTDI-SSQLPTQNPDA  73

Query  218  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192



>gb|ACT87981.1| caffeic acid O-methyltransferase [Jatropha curcas]
Length=365

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + I L++ + I + G  A LS  +I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIIGKAGPGAFLSPYDI-ASQLPTKDPDA  73

Query  218  PN-LERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I    +        E+ Y +  V K L  ++DG+S     L +  
Sbjct  74   PVVLDRILRLLASYSILTYSLRTLPDGKVEKLYGLAPVCKFLTKNEDGVSIAPLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + EAV++  I PF K  G   + Y+G +P  N++  K MS  S   MK  L
Sbjct  134  KVLMESWYHLKEAVLEGGI-PFNKAYGMTAFEYHGTDPRFNTVFNKGMSDHSTITMKKIL  192



>ref|XP_003634161.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=364

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 96/181 (53%), Gaps = 6/181 (3%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  214
            ESD  A L  M+L +   +PM L + + L++ + I + G  A +S SEI + + P+   +
Sbjct  13   ESDEEASLFSMQLVSASVLPMVLKSALELDLLEIIAKAGPGAFVSTSEIAAQI-PTHNPE  71

Query  215  AP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
            AP  L+R+LR+L +Y + +    ++     ER Y +  V K L  ++DG+S    +L + 
Sbjct  72   APVMLDRILRLLATYAVVKCSLRNLPDGGVERLYGLAPVCKYLTRNEDGVSVAPLLLMNQ  131

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
               +M++W  + +AV+D  I PF K  G   + Y+G +P  N +    MSG S   MK  
Sbjct  132  DKVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNNGMSGHSTITMKKI  190

Query  563  L  565
            L
Sbjct  191  L  191



>sp|Q6T1F5.1|COMT1_AMMMJ RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Ammi majus]
 gb|AAR24097.1| caffeic acid O-methyltransferase [Ammi majus]
Length=365

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 98/182 (54%), Gaps = 6/182 (3%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            ++ +  A +  M+LA+   +PM L + I LN+ ++I + G  A +S S+ L++ LPS   
Sbjct  15   NDDEEEACMFAMQLASASVLPMVLKSAIELNLLESIAKAGPGAYVSPSQ-LAAALPSSQP  73

Query  212  DAP-NLERLLRMLTSYGIFREHIN--ADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQH  379
            D P  L+R+LR+L SY +    +    DA  ER Y +  V K L  + DG+S    +L +
Sbjct  74   DTPVMLDRILRLLASYSVLNCKLRDLPDARVERLYGLAPVCKFLTKNSDGVSMAPLLLMN  133

Query  380  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  559
                +M++W  + +AV+D  I PF K  G   + Y+GK+P  N +  + MS  S   MK 
Sbjct  134  QDKILMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGKDPRFNKVFNQGMSNHSTITMKK  192

Query  560  FL  565
             L
Sbjct  193  IL  194



>ref|XP_004502769.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=365

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + + L++ + I + G  A LS  EI +S LP+   DA
Sbjct  15   SDEEAALFAMQLASASVLPMVLKSALELDLLEIIAKAGPAAHLSPYEI-ASQLPTNNPDA  73

Query  218  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L  Y I       ++    +R Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILTCSLTTLHDGKVQRLYGLATVAKYLVKNEDGVSISALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K MS  S   MK  L
Sbjct  134  KILMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKIL  192



>ref|XP_002525818.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF36570.1| o-methyltransferase, putative [Ricinus communis]
Length=365

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + I L++ + + + G +A LS SEI +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPSAFLSPSEI-ASQLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY +    +        ER Y +  V K L+ ++DG+S     L +  
Sbjct  74   PVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLAPVCKFLIKNEDGVSIAPLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+   I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLLGGI-PFNKAYGMTAFDYHGTDPRFNKVFNRGMSDHSTITMKKIL  192



>gb|AAD29841.1|AF064693_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=364

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 93/176 (53%), Gaps = 6/176 (3%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-L  226
            A L  M+LA+   +PM L A I L+V + I + G  A ++ SEI +S L +    AP  L
Sbjct  20   AYLHAMQLASASVLPMVLKAAIELDVLEIIAKAGKGAYVAPSEI-ASQLSTSNSQAPTVL  78

Query  227  ERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMM  397
            +R+LR+L SY +      ++     ER Y +  V K LV ++DG+S    VL +    +M
Sbjct  79   DRMLRLLASYKVLTCNLRNLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLM  138

Query  398  KAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            ++W  + +AV+D  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  139  ESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKLL  193



>gb|AAF28353.1|AF220491_1 O-methyltransferase [Fragaria x ananassa]
Length=365

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L A I L++ + + + G  + LS S+ L+S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGSFLSPSD-LASQLPTKNPEA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLASYSILTCSLRTLPDGKVERLYCLGPVCKFLTKNEDGVSIAALCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              ++++W  + +AV+D  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKIL  192



>gb|ACT32029.1| caffeic acid O-methyltransferase 2 [Gossypium hirsutum]
Length=365

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTSNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L +Y I    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF KV G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKVYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192



>ref|XP_002864307.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40566.1| O-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=362

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 98/180 (54%), Gaps = 8/180 (4%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D+ A L  M+LA+   +PM+L + + L++ + + + GS  P+S +EI +S LP+    A
Sbjct  15   TDDEAALFAMQLASASVLPMALKSALELDLLEIMAKNGS--PMSPTEI-ASHLPTKNPGA  71

Query  218  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+LTS+ +       ++ D  ER Y +  V K L  ++DG+S     L    
Sbjct  72   PVMLDRILRLLTSHSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAGLCLTSQD  131

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +A++D  I PF K  G + + Y+G +P  N +    MS  S   MK  L
Sbjct  132  KVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKIL  190



>gb|AAD29844.1|AF064696_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=364

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 93/176 (53%), Gaps = 6/176 (3%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-L  226
            A L  M+LA+   +PM L A I L+V + I + G  A ++ SEI +S L +    AP  L
Sbjct  20   ACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGKGAYVAPSEI-ASQLSTSNSQAPTVL  78

Query  227  ERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMM  397
            +R+LR+L SY +      ++     ER Y +  V K LV ++DG+S    VL +    +M
Sbjct  79   DRMLRLLASYKVLTCNLRNLEDGGVERLYGLAPVCKFLVKNEDGVSMAPLVLMNQDKVLM  138

Query  398  KAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            ++W  + +AV+D  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  139  ESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKLL  193



>gb|AHM25237.1| noraucuparin O-methyltransferase [Sorbus aucuparia]
Length=365

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L A I L++ + + + G  A +S ++ L+S LP+   DA
Sbjct  15   SDEEANLFAMQLASGSILPMVLKAAIELDLLEVMAKAGPGAFVSPAD-LASQLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG S G+  L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGASIGSLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKLL  192



>ref|XP_008775842.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Phoenix 
dactylifera]
Length=367

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 86/167 (51%), Gaps = 4/167 (2%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D  A +  ++LA+   +PM+L A I L++ + I + G  A LS +E+ + +       A
Sbjct  19   ADEAACMYAVQLASSSILPMTLKAAIELDILEIIVKAGPGAKLSPAEVATQLPTENPMAA  78

Query  218  PNLERLLRMLTSYGIFREHINADASE---RRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  388
              L+R+LR+L SY I    +  DA     RRY    V K L  +K+G S  A  L +   
Sbjct  79   TMLDRMLRLLASYNILTCSVEIDADGKPFRRYGAAPVCKWLTKNKEGASMSALTLMNQDK  138

Query  389  AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAM  529
             +M +W  + +AV+D  I PF K  G   + YYG +P  N +  +AM
Sbjct  139  ILMGSWYYLKDAVLDGGI-PFNKAYGTTAFEYYGTDPRFNRVFNEAM  184



>ref|XP_003526767.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform 1 [Glycine 
max]
 gb|KHN23294.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I SS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPTDI-SSQLPTQNPDA  73

Query  218  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV  +DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKTEDGVSIAALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192



>gb|ABI54119.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L A I L++ + + + G  A +S ++ LSS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFVSPAD-LSSQLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I    +        ER Y +  V K L   +DG S G+  L +  
Sbjct  74   PVMLDRMLRVLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKSEDGASIGSLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYNLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKLL  192



>gb|KFK27028.1| hypothetical protein AALP_AA8G324800 [Arabis alpina]
Length=365

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 98/182 (54%), Gaps = 10/182 (5%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D+ A L  M+LA+   +PM+L   + L++ + + +  S  P+S SEI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKTALELDLLEIMAKNSS--PMSPSEI-ASHLPTKNLEA  71

Query  218  P-NLERLLRMLTSYGIFREHINA-----DASERRYSVDEVGKTLVTDKDGLSYGAYVLQH  379
            P  L+R+LR+LT+Y +            DA ER Y +  V K L  ++DG+S  A  L +
Sbjct  72   PVMLDRILRLLTAYSVLTCSNRTLPGGGDAVERTYGLGPVCKYLTKNEDGVSIAALCLMN  131

Query  380  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  559
                +M++W  + +A++D  I PF K  G + + Y+G +P  N +    MS  S   MK 
Sbjct  132  QDKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKK  190

Query  560  FL  565
             L
Sbjct  191  IL  192



>ref|XP_010671332.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 86/162 (53%), Gaps = 6/162 (4%)
 Frame = +2

Query  92   PMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLRMLTSYGIFR  268
            PM L AVI L+V + I + G NA LS +EI++  LPS   DA   L+R+LR+L SY I  
Sbjct  30   PMVLKAVIELDVLEIIKRAGPNAQLSPAEIVAQ-LPSKNPDAATMLDRMLRLLASYSILS  88

Query  269  EHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSS  439
              +        ER Y +  V + L  ++DG++ GA  L +    +M++W  + +AV+D  
Sbjct  89   YSLRTLPDGKVERLYGLAPVCQFLTKNQDGVTLGALSLMNQDKILMESWYHLKDAVLDGG  148

Query  440  IEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            I PF K  G   + Y+G +P  N +    MS  S   MK  L
Sbjct  149  I-PFNKAYGMTAFEYHGTDPRFNKVFNNGMSNHSTITMKRIL  189



>gb|ABO41846.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=345

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 90/168 (54%), Gaps = 6/168 (4%)
 Frame = +2

Query  65   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  241
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS   DAP L +R+LR
Sbjct  15   VRLANAVILPMVLKSALELNIIDTILAAGDGAFLSPSQI-ASALPSKNPDAPVLLDRMLR  73

Query  242  MLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  412
            +L S+ I +  + A   +  ER Y    + K LV ++DG S    ++ HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKEEIERLYGAGPLCKFLVKNQDGGSIAPLLVLHHDQVFMQSWYH  133

Query  413  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            +++A+++    PF K  G   + Y G +   N +  +AMS  +   M+
Sbjct  134  LNDAILEGGF-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALIMR  180



>sp|Q8GU25.1|COMT1_ROSCH RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Rosa chinensis]
 emb|CAD29457.1| caffeic acid O-methyltransferase [Rosa chinensis]
Length=365

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L A I L++ + + + G  A LS ++ L+S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPND-LASQLPTKNPEA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSIAALCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              ++++W  + +AV+D  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKIL  192



>dbj|BAC78827.1| caffeic acid O-methyltransferase [Rosa chinensis var. spontanea]
Length=365

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L A I L++ + + + G  A LS ++ L+S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPND-LASQLPTKNPEA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSIAALCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              ++++W  + +AV+D  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKIL  192



>emb|CDY70033.1| BnaCnng66420D [Brassica napus]
Length=230

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  395  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            M+AWPLVH AVV+   EP+VK NGEA Y+ YGK  EMN LMQKAMSG+SVPFMKA L
Sbjct  1    MRAWPLVHTAVVEPETEPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVSVPFMKAIL  57



>ref|XP_008788729.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase [Phoenix 
dactylifera]
Length=367

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 91/179 (51%), Gaps = 4/179 (2%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D  A +  ++LA+   +PM+L   I L+V + I + GS A LS +E+ + +       A
Sbjct  19   ADEEACMYALQLASASILPMTLKNAIELDVLEIIAKAGSAAKLSPAEVAAQLPTKNPMAA  78

Query  218  PNLERLLRMLTSYGIFREHINADASE---RRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  388
              L+R+LR+L SY +    +  DA     RRY    V K L  ++DG+S  A  L +   
Sbjct  79   AMLDRMLRLLASYNVLTCSVEVDADGKPLRRYGPAPVCKWLTKNEDGVSMAALTLMNQDK  138

Query  389  AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + M   S+   K  L
Sbjct  139  ILMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSIIITKKLL  196



>ref|XP_007032646.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
 gb|EOY03572.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
Length=365

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 99/186 (53%), Gaps = 6/186 (3%)
 Frame = +2

Query  20   GAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLP  199
            G   +E D  +    M++ +   +PMS+ A I+L + D I + G NA  S  EI ++ LP
Sbjct  11   GNNNAEQDQESFSYAMQIVSSSVLPMSMHAAIQLELFDIIAKAGPNAKFSPKEI-AAQLP  69

Query  200  SGGGDAPN-LERLLRMLTSYGIFREHI---NADASERRYSVDEVGKTLVTDKDGLSYGAY  367
                +AP+ L+R+LR+L S+GI    +     +  +R YS+  V K  V ++DG+S+G  
Sbjct  70   CKNPEAPSMLDRILRVLASHGIVGCSVVDEEGNNPQRLYSLTPVSKFFVRNEDGVSFGPL  129

Query  368  VLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVP  547
            +        + +W  + +AV++  + PF +V+G   + Y+GK+P +N +   AM   +  
Sbjct  130  MALTQDKVSLDSWSHLKDAVLEGGV-PFDRVHGTHAFEYFGKDPRLNQVFNTAMINHATI  188

Query  548  FMKAFL  565
             +K  L
Sbjct  189  IVKKIL  194



>gb|AAD29843.1|AF064695_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 92/180 (51%), Gaps = 4/180 (2%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  214
            E +  A L  M+LA+   +PM L A I L+V + I + G  A ++ +EI S +  S    
Sbjct  13   EEEEEACLHAMQLASASVLPMVLKAAIELDVLEIIAKAGQGAYVAPTEIASQLSTSNSQA  72

Query  215  APNLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
               L+R+LR+L SY +   ++        ER Y +  V K LV ++DG+S    VL +  
Sbjct  73   PIILDRVLRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSIAPLVLMNQD  132

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  133  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKLL  191



>ref|NP_001240003.1| uncharacterized protein LOC100780100 [Glycine max]
 gb|ACU22737.1| unknown [Glycine max]
 gb|KHN19570.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS S+I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPSDI-ASRLPTHNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L  Y I    +        ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPHGKVERLYGLAPVAKYLVRNEDGVSIAALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192



>gb|EPS67212.1| hypothetical protein M569_07558 [Genlisea aurea]
Length=364

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 99/183 (54%), Gaps = 7/183 (4%)
 Frame = +2

Query  32   SESDN-GARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGG  208
            ++SD  GA L  M+LA+   +PM L + I LN+ + I   G+ + +S +E L++ LP+  
Sbjct  13   TDSDEEGAFLFAMQLASASVLPMVLKSAIELNLLELIKTSGAGSFVSPAE-LAAQLPASN  71

Query  209  GDAPN-LERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQ  376
             DAP  ++R+LR+L  Y +    +   A    ERRY +  V K L  ++DG+S    VL 
Sbjct  72   ADAPVVIDRILRLLACYDVLSCRVETLADGGIERRYGLGPVCKFLTKNEDGVSMAPLVLM  131

Query  377  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
            +    +M++W  + +AV++  I PF +  G + + YYG++   + +    MS  S   MK
Sbjct  132  NQDKVLMESWYHLKDAVLEGGI-PFNRAYGMSAFEYYGRDTRFSKIFNAGMSNHSTLIMK  190

Query  557  AFL  565
              L
Sbjct  191  KLL  193



>gb|AAD29842.1|AF064694_1 catechol O-methyltransferase [Thalictrum tuberosum]
Length=362

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 92/180 (51%), Gaps = 4/180 (2%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  214
            E +  A L  M+LA+   +PM L A I L+V + I + G  A ++ +EI S +  S    
Sbjct  13   EEEEEACLHAMQLASASVLPMVLKAAIELSVLEIIAKAGQGAYVAPTEIASQLSTSNSQA  72

Query  215  APNLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
               L+R+LR+L SY +   ++        ER Y +  V K LV ++DG+S    VL +  
Sbjct  73   PIILDRILRLLASYKVLTCNLRTLEDGGVERLYGLAPVCKFLVKNEDGVSIAPLVLMNQD  132

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  133  KVLMESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKLL  191



>ref|NP_001289246.1| caffeic acid 3-O-methyltransferase [Pyrus x bretschneideri]
 gb|AGS44640.1| caffeic acid-O-methyltransferase [Pyrus x bretschneideri]
Length=365

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L A I L++ + + + G  A +S ++I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASGSILPMVLKAAIELDLLEVMAKAGPGAFVSPADI-ASQLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I    +        +R Y +  V K L  ++DG S G+  L +  
Sbjct  74   PVMLDRILRLLASYSILTYSLRTLPDGKVQRLYGLGPVCKFLTKNEDGASIGSLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + E+V++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYHLKESVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKLL  192



>sp|P46484.1|COMT1_EUCGU RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Eucalyptus gunnii]
 emb|CAA52814.1| 0-Methyltransferase [Eucalyptus gunnii]
Length=366

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 101/195 (52%), Gaps = 14/195 (7%)
 Frame = +2

Query  17   IGAMGSE--------SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSA  172
            +G+ GSE        SD  A L  M+LA+   +PM L A I L++ + + + G  A LS 
Sbjct  1    MGSTGSETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSP  60

Query  173  SEILSSVLPSGGGDAP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTD  340
             E+ ++ LP+   +AP  L+R+ R+L SY +      ++     ER Y +  V K LV +
Sbjct  61   GEV-AAQLPTQNPEAPVMLDRIFRLLASYSVLTCTLRNLPDGKVERLYGLAPVCKFLVKN  119

Query  341  KDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQ  520
            +DG+S  A  L +    +M++W  + +AV++  I PF K  G   + Y+G +P  N +  
Sbjct  120  EDGVSIAALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKIFN  178

Query  521  KAMSGISVPFMKAFL  565
            + MS  S   MK  L
Sbjct  179  RGMSDHSTITMKKIL  193



>ref|XP_006478241.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Citrus 
sinensis]
Length=432

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 88/156 (56%), Gaps = 3/156 (2%)
 Frame = +2

Query  68   ELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NLERLLRM  244
            EL     + M++ AVI+L + + I + G  A LSASEI + +  +   DAP  L+R+LR+
Sbjct  95   ELVTGSVLHMTMKAVIKLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRILRL  154

Query  245  LTSYGIFREHI-NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHE  421
            L SYGI +  + + D S R Y +++V K  V+++DG+S G  +      A + +W  + E
Sbjct  155  LASYGIVQCSLDDVDGSHRLYGLNDVSKYFVSNQDGVSLGPVLALIQDKAFLDSWSQLKE  214

Query  422  AVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAM  529
             +++  + PF +V+G   + Y G +P  N +   AM
Sbjct  215  TIIEGGV-PFDRVHGTHAFEYLGLDPRFNEVYSTAM  249



>gb|AGR85824.1| caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=306

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + I L++ + + + G  A LS  E+ ++ LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGASLSPKEV-AAQLPTTNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I    + +      ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLASYSILTCSLRSLPDGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMNDHSTITMKKIL  192



>gb|KHG13289.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=365

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 93/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTNNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L +Y I    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192



>ref|XP_004307899.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=365

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L A I L++ + + + G  + LS ++ L+S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGSFLSPND-LASQLPTENPEA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I    +        ER Y +  V K L  ++DG+S  A  L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSIAALCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              ++++W  + +AV+D  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLVESWYHLKDAVLDGGI-PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKIL  192



>gb|AGJ84131.1| putative caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=365

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + I L++ + + + G  A LS  E+ +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPMEV-ASQLPTANPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L +Y I    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGRVERLYGLGPVCKFLTKNQDGVALSALSLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192



>gb|ADB82906.1| caffeic O-methyltransferase1 [Eucalyptus camaldulensis]
Length=366

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 100/195 (51%), Gaps = 14/195 (7%)
 Frame = +2

Query  17   IGAMGSE--------SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSA  172
            +G+ GSE        SD  A L  M+LA+   +PM L A I L++ + + + G  A LS 
Sbjct  1    MGSTGSETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSP  60

Query  173  SEILSSVLPSGGGDAPN-LERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTD  340
             E+ ++ LP+   +AP  L+R+ R+L SY +       +     ER Y +  V K LV +
Sbjct  61   GEV-AAQLPTQNPEAPAMLDRIFRLLASYSVLTCTLRDLPDGKVERLYGLAPVCKFLVKN  119

Query  341  KDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQ  520
            +DG+S  A  L +    +M++W  + +AV++  I PF K  G   + Y+G +P  N +  
Sbjct  120  EDGVSIAALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKIFN  178

Query  521  KAMSGISVPFMKAFL  565
            + MS  S   MK  L
Sbjct  179  RGMSDHSTITMKKIL  193



>gb|KDO39208.1| hypothetical protein CISIN_1g041308mg [Citrus sinensis]
Length=244

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  395  MKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            M AWPLVHEAV+D +IEPF KV+GE  YSYYGK P+MN LM+KAMS + VPFM + L
Sbjct  1    MSAWPLVHEAVLDPTIEPFAKVHGEPAYSYYGKKPKMNGLMRKAMSRVFVPFMTSVL  57



>gb|ABO41852.1| putative caffeic acid methyltransferase [Gossypium hirsutum]
Length=358

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 90/171 (53%), Gaps = 6/171 (4%)
 Frame = +2

Query  65   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNL-ERLLR  241
            + LAN + +PM L + + LN+ D I   G  A LS S+I +S LPS    AP L +R+LR
Sbjct  15   VRLANAVVLPMVLKSALELNIIDTISAAGDGAFLSPSQI-ASALPSKNPGAPVLLDRMLR  73

Query  242  MLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPL  412
            +L S+ I +  + A      ER Y    + K LV ++DG S    +L HH    M++W  
Sbjct  74   LLASHSILKCSVKAKEKGEIERLYGAGPLCKFLVKNQDGGSIAPLLLLHHDQVFMQSWYH  133

Query  413  VHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +++A+++  + PF K  G   + Y G +   N +  +AMS  +   M+  +
Sbjct  134  LNDAILEGGV-PFSKAYGMTAFEYPGTDQRFNRVFNQAMSNHTALIMRKIV  183



>ref|XP_010048429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Eucalyptus grandis]
Length=366

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 100/195 (51%), Gaps = 14/195 (7%)
 Frame = +2

Query  17   IGAMGSE--------SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSA  172
            +G+ GSE        SD  A L  M+LA+   +PM L A I L++ + + + G  A LS 
Sbjct  1    MGSTGSETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSP  60

Query  173  SEILSSVLPSGGGDAP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTD  340
             E+ ++ LP+   +AP  L+R+ R+L SY +       +     ER Y +  V K LV +
Sbjct  61   GEV-AAQLPTQNPEAPVMLDRIFRLLASYSVLTCTLRDLPDGKVERLYGLAPVCKFLVKN  119

Query  341  KDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQ  520
            +DG+S  A  L +    +M++W  + +AV++  I PF K  G   + Y+G +P  N +  
Sbjct  120  EDGVSIAALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKIFN  178

Query  521  KAMSGISVPFMKAFL  565
            + MS  S   MK  L
Sbjct  179  RGMSDHSTITMKKIL  193



>gb|ACY66932.1| caffeic O-methyltransferase 1 [Eucalyptus camaldulensis]
Length=366

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 100/195 (51%), Gaps = 14/195 (7%)
 Frame = +2

Query  17   IGAMGSE--------SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSA  172
            +G+ GSE        SD  A L  M+LA+   +PM L A I L++ + + + G  A LS 
Sbjct  1    MGSTGSETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSP  60

Query  173  SEILSSVLPSGGGDAP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTD  340
             E+ ++ LP+   +AP  L+R+ R+L SY +       +     ER Y +  V K LV +
Sbjct  61   GEV-AAQLPTQNPEAPVMLDRIFRLLASYSVLTCTLRDLPDGKVERLYGLAPVCKFLVKN  119

Query  341  KDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQ  520
            +DG+S  A  L +    +M++W  + +AV++  I PF K  G   + Y+G +P  N +  
Sbjct  120  EDGVSIAALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKIFN  178

Query  521  KAMSGISVPFMKAFL  565
            + MS  S   MK  L
Sbjct  179  RGMSDHSTITMKKIL  193



>gb|KHN23295.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=350

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPTDI-ASQLPTHNPNA  73

Query  218  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDCKIERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192



>ref|XP_008376825.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D    L  M+LAN   +PM L   + L++ + + + G  A +S+++ LSS LP+   DA
Sbjct  15   TDKETNLFAMQLANAPVLPMVLKTALELDLLEIMVKAGPGAFVSSAD-LSSQLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA--DAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I    +    D + ER Y +  V K L  ++DG+S     L    
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGNVERLYGLGPVCKFLTKNEDGVSIAPLCLMSQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMAAQSTIIMKKLL  192



>ref|XP_003528001.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=366

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I +S LP+   +A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPTDI-ASQLPTHNPNA  73

Query  218  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L  Y I  F      D   ER Y +  V K LV ++DG+S  A  L +  
Sbjct  74   PVMLDRILRLLACYNILSFSLRTLPDCKIERLYGLAPVAKYLVKNEDGVSIAALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192



>gb|KJB23956.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=251

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 93/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTSNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L +Y I    +        ER Y +  V K +  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTLSALSLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192



>gb|KJB23955.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=269

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 93/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTSNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L +Y I    +        ER Y +  V K +  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTLSALSLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192



>ref|XP_008362805.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=365

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 96/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L A I L++ + + + G  A +S ++ L+S LP+   DA
Sbjct  15   SDEEASLFAMQLASASVLPMVLKATIELDLLEIMAKAGPGAFVSPAD-LASQLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I       +     ER Y +  V K L T++DG+S  +  L +  
Sbjct  74   PVMLDRMLRLLASYSILXYSLRTLQDGKVERLYGLGPVCKFLTTNEDGVSIASLCLMNLD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
               +++W  + +AV++  I PF K  G   + Y+  +P  N +  +AM+ IS   MK  L
Sbjct  134  KVPVESWYHLKDAVLEGGI-PFNKAYGMTAFEYHSTDPRFNKVFNRAMADISTITMKKIL  192



>gb|KDP35860.1| hypothetical protein JCGZ_10599 [Jatropha curcas]
Length=365

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+L++   +PM L + I L++ + I + G  A LS  +I +S LP+   DA
Sbjct  15   SDEEAILFAMQLSSAPLLPMVLKSAIELDLLEIIAKAGPGAFLSTYDI-ASQLPTKSADA  73

Query  218  PN-LERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I       +N    ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVVLDRILRLLASYSILTCSLRKLNDGKVERLYGLAPVCKFLTKNEDGVSIAPLCLLNLD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K +G   + Y G +P  + +  K MS  S+  MK  L
Sbjct  134  KVLMESWYHLKDAVLEGVI-PFNKAHGMDAFEYQGTDPRFSKVFNKGMSNHSIVTMKKIL  192



>emb|CDY43839.1| BnaC03g14720D [Brassica napus]
Length=364

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 99/181 (55%), Gaps = 9/181 (5%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D+ A L  M+LA+   +PM L + + L++ + + +  S  P+S SEI +S L +   +A
Sbjct  15   TDDEAALFAMQLASASVLPMVLKSALDLDLLEIMAKNSS--PMSPSEI-ASKLQTKNPEA  71

Query  218  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
            P  L+R+LR+LTSY I     R     D+ ER Y +  V K L  ++DG+S  A  L + 
Sbjct  72   PVMLDRILRLLTSYSILTCSNRTIPGGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQ  131

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
               +M++W  + +AV+D  I PF K  G + + Y+GK+   N++    MS  S   MK  
Sbjct  132  DKVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGKDLRFNTVFNNGMSNHSTITMKKI  190

Query  563  L  565
            L
Sbjct  191  L  191



>gb|KJB23957.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=290

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 93/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTSNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L +Y I    +        ER Y +  V K +  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTLSALSLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192



>ref|XP_006478243.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like, partial 
[Citrus sinensis]
Length=214

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 82/147 (56%), Gaps = 3/147 (2%)
 Frame = +2

Query  95   MSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLRMLTSYGIFRE  271
            M++ AVI+L + + I + G  A LSASEI + +  +   DAP  L+R+L +L SYGI   
Sbjct  51   MTMKAVIKLGLLEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVEC  110

Query  272  HI-NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEP  448
             + + D S R Y +++V K  V ++DG+S G  +      A + +W  + E +++  + P
Sbjct  111  SLDDVDGSHRLYGLNDVSKYFVPNQDGVSLGPVLALIQDEAFLDSWSQLKETIIEGGV-P  169

Query  449  FVKVNGEAPYSYYGKNPEMNSLMQKAM  529
            F +V+G   + Y G +P  N +   AM
Sbjct  170  FDRVHGTNAFEYLGLDPRFNEVFSTAM  196



>ref|XP_010934913.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Elaeis 
guineensis]
Length=367

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 88/178 (49%), Gaps = 4/178 (2%)
 Frame = +2

Query  41   DNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP  220
            D  A L  ++L +   +PM+L A I L+V + I + G    LS +++ + +       A 
Sbjct  20   DEAACLYALQLVSSSILPMTLKAAIELDVLEIIAKAGPEGKLSPAQVAAQLPTENSMAAT  79

Query  221  NLERLLRMLTSYGIFREHINADASE---RRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
             L+R+LR+L SY I    +  DA     RRY    V K L  ++DG+S     L +    
Sbjct  80   MLDRMLRLLASYNILTCSVEVDADGKPLRRYGPAPVCKWLTKNEDGVSMAPLTLMNQDKV  139

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M++W  + +AV+D  I PF K  G   + Y+G +P  N++  + M   S+   K  L
Sbjct  140  LMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNNVFNEGMKNHSIVITKKLL  196



>ref|XP_010934914.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=367

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 89/178 (50%), Gaps = 4/178 (2%)
 Frame = +2

Query  41   DNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP  220
            D  + +  ++LA+   +PM+L A I L V + I + GS   LS +++ + +       A 
Sbjct  20   DEASCMYALQLASSSILPMTLKAAIELGVLEIIAKAGSVGKLSPAQVAAQLPTENPMAAT  79

Query  221  NLERLLRMLTSYGIFREHINADASE---RRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAA  391
             L+R+LR+L SY I    +  DA     RRY    V K L  ++DG+S  A  L +    
Sbjct  80   MLDRMLRLLASYNILTCSVEVDADGKPLRRYGPAPVCKWLTKNEDGVSMAALTLMNQDKV  139

Query  392  MMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + M   S+   K  L
Sbjct  140  LMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNEGMKNHSIIITKKLL  196



>dbj|BAO79382.1| hypothetical plant O-methyltransferase [Anthriscus sylvestris]
Length=365

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 95/181 (52%), Gaps = 6/181 (3%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  214
            + +  A +  M+LA+   +PM L + I L++ ++I Q G  A +S +E L++ LPS   D
Sbjct  16   DEEEEACMFAMQLASASVLPMVLKSAIELDLLESIAQAGPGAYVSPAE-LAAKLPSSQPD  74

Query  215  AP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
             P  L+R+LR+L SY + +     +     ER Y++  V K L  + DG+S    +L + 
Sbjct  75   TPVMLDRILRLLASYSVLKCKLRDLPQGGVERLYALAPVCKFLTKNSDGVSMAPLLLMNQ  134

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
               +M++W  + + V+D  I PF K  G   + Y+GK+P  N +    MS  S   MK  
Sbjct  135  DKILMESWYHLKDTVLDGGI-PFNKAYGMTAFEYHGKDPRFNKVFNLGMSNHSTITMKKI  193

Query  563  L  565
            L
Sbjct  194  L  194



>ref|XP_008376828.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D    L  M+LAN   +PM L   + L++ + + + G  A +S+++ LSS LP+   DA
Sbjct  15   TDKETNLFAMQLANAPVLPMVLKTALELDLLEIMVKAGPGAFVSSAD-LSSQLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA--DAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I    +    D + ER Y +  V K L  ++DG+S     L    
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLPDGNVERLYGLGPVCKFLTKNEDGVSIAPLCLMSQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G + + Y+G +P  N +  + M+  S   MK  L
Sbjct  134  KVLMESWYHLKDAVLEGGI-PFNKAYGMSAFEYHGTDPRFNKVFNRGMAAQSTITMKKLL  192



>gb|KCW89068.1| hypothetical protein EUGRSUZ_A01397 [Eucalyptus grandis]
Length=429

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 101/197 (51%), Gaps = 14/197 (7%)
 Frame = +2

Query  11   KEIGAMGSE--------SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPL  166
            + +G+ GSE        SD  A L  M+LA+   +PM L A I L++ + + + G  A L
Sbjct  62   ERMGSTGSETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFL  121

Query  167  SASEILSSVLPSGGGDAP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLV  334
            S  E+ ++ LP+   +AP  L+R+ R+L SY +       +     ER Y +  V K LV
Sbjct  122  SPGEV-AAQLPTQNPEAPVMLDRIFRLLASYSVLTCTLRDLPDGKVERLYGLAPVCKFLV  180

Query  335  TDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSL  514
             ++DG+S  A  L +    +M++W  + +AV++  I PF K  G   + Y+G +P  N +
Sbjct  181  KNEDGVSIAALNLMNQDKILMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKI  239

Query  515  MQKAMSGISVPFMKAFL  565
              + MS  S   MK  L
Sbjct  240  FNRGMSDHSTITMKKIL  256



>ref|XP_008462913.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Cucumis melo]
Length=359

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 97/185 (52%), Gaps = 11/185 (6%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            S+ +  A+L  M+LA+   +PM L   I L++ + I +GG  A LS S+I S +    G 
Sbjct  6    SDDEEEAQLFAMQLASASVLPMVLKTAIELDLLEIIGRGGEGALLSPSQIASQL---SGL  62

Query  212  DAPN----LERLLRMLTSYGIFREHIN--ADAS-ERRYSVDEVGKTLVTDKDGLSYGAYV  370
              P     L+R+LR+L SY I    +N   D S +R Y +  V K L+ ++DG+S     
Sbjct  63   KNPEAHVMLDRMLRLLASYSILTCSLNPLPDGSLQRLYGLAPVSKFLIKNQDGVSIAPLC  122

Query  371  LQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPF  550
            L +    +M++W  + +AV++  I PF +  G + + Y+G +P  N +  K MS  S   
Sbjct  123  LMNQDKVLMESWYHLKDAVLEGGI-PFNRAYGISAFEYHGTDPRFNKVFNKGMSDHSTIT  181

Query  551  MKAFL  565
            MK  L
Sbjct  182  MKKIL  186



>ref|XP_009132451.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Brassica rapa]
 emb|CDY43052.1| BnaA03g11990D [Brassica napus]
Length=364

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 99/181 (55%), Gaps = 9/181 (5%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D+ A L  M+LA+   +PM L + + L++ + + +  S  P+S SEI +S L +   +A
Sbjct  15   TDDEAALFAMQLASASVLPMVLKSALDLDLLEIMAKNSS--PMSPSEI-ASKLQTKNPEA  71

Query  218  P-NLERLLRMLTSYGIF----REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
            P  L+R+LR+LTSY I     R     D+ ER Y +  V K L  ++DG+S  A  L + 
Sbjct  72   PVMLDRILRLLTSYSILTCSNRTIPGGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQ  131

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
               +M++W  + +A++D  I PF K  G + + Y+GK+   N++    MS  S   MK  
Sbjct  132  DKVLMESWYHLKDAILDGGI-PFNKAYGMSAFEYHGKDLRFNTVFNNGMSNHSTITMKKI  190

Query  563  L  565
            L
Sbjct  191  L  191



>gb|AAV36348.1| caffeate O-methyltransferase, partial [Pinus taeda]
 gb|AAV36366.1| caffeate O-methyltransferase, partial [Pinus taeda]
Length=185

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 86/170 (51%), Gaps = 4/170 (2%)
 Frame = +2

Query  65   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  244
            MEL N   +PM++ A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  16   MELGNFSCLPMAMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  75

Query  245  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  415
            L S+ +    +  +    +ER Y +  + K LV ++DG+S    VL +    +M++W  V
Sbjct  76   LASHSVLSCSVTTNENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYV  135

Query  416  HEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             +AV+D S +PF K +G   + Y   +   N +  + MS  S   M   L
Sbjct  136  KDAVLDGS-QPFTKAHGMNAFEYPAMDQRFNRVFNRGMSEHSTMLMNKIL  184



>ref|XP_010482824.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Camelina sativa]
Length=363

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 101/180 (56%), Gaps = 8/180 (4%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D+ A L  M+LA+   +PM+L A + L++ + + +  S  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKAALDLDLLEIMAKNAS--PMSPTEI-ASQLPTKNPEA  71

Query  218  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+LTSY I       ++ D+ ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSILTCSNRKLSGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G + + Y+G +P  N +    MS  S   MK  L
Sbjct  132  KVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKLL  190



>gb|ABG27066.1| caffeic acid O-methyltransferase [Boehmeria nivea]
Length=365

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 92/180 (51%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L   I L++ + I + G  A LS +EI ++ LP+    A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKTAIELDLLEIIAKAGPGAWLSPAEI-AAQLPTTNPAA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L  Y +    +      A+ER Y +  V K L  + DG+S     L +  
Sbjct  74   PVMLDRILRLLACYSVVACQLRTLPGGAAERLYGLAPVCKFLTKNNDGVSISPLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKLL  192



>ref|XP_009418616.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=362

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 94/191 (49%), Gaps = 4/191 (2%)
 Frame = +2

Query  2    GKLKEIGAMGSESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEI  181
            G LK    +  E D  A +  M+LA+   +PM+L A I L++ + + + G  A LS +++
Sbjct  2    GSLKNALQLTPEEDEDACMYAMQLASASILPMTLKAAIELDLLEILVRAGPGAQLSPADV  61

Query  182  LSSVLPSGGGDAPNLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGL  352
            ++ +       A  ++R+LR+L +Y +    +  DA     R+Y      K L  ++DG+
Sbjct  62   VAQLPTENPQAAVMVDRMLRLLAAYNVVSCTVGTDADGKPSRKYGAAPACKYLTKNEDGV  121

Query  353  SYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMS  532
            S  A  L +    +M++W  + +AV+D  I PF K  G + + YYG +   N +  + M 
Sbjct  122  SMAALTLMNQDKVLMESWYYLKDAVLDGGI-PFNKAYGMSAFEYYGADARFNKVFNEGMR  180

Query  533  GISVPFMKAFL  565
              S    K  L
Sbjct  181  NHSTILTKKLL  191



>ref|XP_008234634.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=365

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L A I L++ + + + G    LS ++I +S LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGVFLSPADI-ASQLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I    +   A    ER Y +  V K L  ++DG+S     L +  
Sbjct  74   PVMLDRMLRLLASYSILTYSLRTLADGKVERLYGLGPVCKFLTKNEDGVSIAPLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              ++++W  + +AV++  I PF K  G   + Y+G +P  N +  + M+  S   MK  L
Sbjct  134  KVLVESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKIL  192



>gb|KJB23954.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=365

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 93/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+L +   +PM L + I L++ + + + G  A LS  E L+S LP+   DA
Sbjct  15   SDEEANLFAMQLTSASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKE-LASQLPTSNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L +Y I    +        ER Y +  V K +  ++DG++  A  L +  
Sbjct  74   PVMLDRILRLLATYSILTCSLRTLPDGKVERLYGLGPVCKFVTKNEDGVTLSALSLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKIL  192



>ref|XP_009119948.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Brassica rapa]
 emb|CDY14330.1| BnaA10g07250D [Brassica napus]
Length=362

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 96/179 (54%), Gaps = 7/179 (4%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D+   L  ++LA+   +PM+L + I L++ + + +  S  P+SASEI SS LP+   +A
Sbjct  15   TDDETALFAIQLASASVLPMALKSAIELDLLEIMARNCS--PMSASEI-SSHLPTKNPEA  71

Query  218  P-NLERLLRMLTSYGIFREHINA--DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQA  388
            P  L+R+LR+LT+Y +    +    D  +R Y +  V K  + ++DG+S     L +H  
Sbjct  72   PVMLDRILRLLTAYSVLTCSVRTLPDGVDRLYGLGPVCKYFIKNEDGVSIAPLCLLNHDK  131

Query  389  AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              M +W  + +AV+D  I PF K  G + + Y+G +   N +    MS  S   MK  L
Sbjct  132  VFMGSWYYLKDAVLDGGI-PFNKAYGMSAFEYHGTDLRFNKVFNNGMSNHSTITMKKIL  189



>gb|AEO14871.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza]
Length=364

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 90/173 (52%), Gaps = 4/173 (2%)
 Frame = +2

Query  56   LRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERL  235
            L  M+LA+   +PM L + I L++ + I + G+ A +S +E+ + +  +  G A  L+R+
Sbjct  22   LFAMQLASASVLPMVLKSAIELDLLEIIKKAGAGAFVSPAEVAAQLPTTNEGAAVMLDRI  81

Query  236  LRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAW  406
            LR+L SY I    +        +R Y +  V K L  + DG+S     L +    +M++W
Sbjct  82   LRLLASYAILECRLKTLPDGGVQRLYGLAPVCKFLTKNDDGVSVAPLALMNQDKVLMESW  141

Query  407  PLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              + +AV+D  I PF K  G + + Y+G +P  N +  + MSG S   MK  L
Sbjct  142  YHLKDAVLDGEI-PFNKAYGMSAFEYHGTDPRFNKVFNQGMSGHSTITMKKIL  193



>dbj|BAE94400.1| Caffeic acid 3-O-methyltransferase [Ipomoea nil]
 dbj|BAE94406.1| Caffeic acid 3-O-methyltransferase [Ipomoea nil]
Length=364

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 95/181 (52%), Gaps = 6/181 (3%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  214
            +SD  A L  M+LA+   +PM L + I L++ + I + G  A +S SE L++ LP+   D
Sbjct  15   DSDEEASLFAMQLASASVLPMVLKSAIELDLLELIAKAGPGAAVSPSE-LAAQLPTTNPD  73

Query  215  AP-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
            A   L+R+LR+L +Y +    +        ER YS+  V K L  + DG+S    +L + 
Sbjct  74   AAVMLDRILRLLCTYSVLNCSLRTLPDGRVERLYSLAPVCKYLTKNGDGVSMAPLLLMNQ  133

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
               +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  
Sbjct  134  DKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKI  192

Query  563  L  565
            L
Sbjct  193  L  193



>gb|AEI54336.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Glycine 
max]
Length=365

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 93/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L + + L++ + I + G    LS ++I SS LP+   DA
Sbjct  15   SDEEANLFAMQLASASVLPMVLKSALELDLLEIIAKAGPGVHLSPTDI-SSQLPTQNPDA  73

Query  218  P-NLERLLRMLTSYGI--FREHINADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+   Y I  F      D   ER Y +  V K LV  +DG+S  A  L +  
Sbjct  74   PVMLDRILRLSACYNILSFSLRTLPDGKVERLYGLAPVAKYLVKTEDGVSIAALNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV++  I PF K  G   + Y+G +P  N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKIL  192



>dbj|BAE94403.1| Caffeic acid 3-O-methyltransferase [Ipomoea nil]
Length=364

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 95/181 (52%), Gaps = 6/181 (3%)
 Frame = +2

Query  35   ESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGD  214
            +SD  A L  M+LA+   +PM L + I L++ + I + G  A +S SE L++ LP+   D
Sbjct  15   DSDEEASLFAMQLASASVLPMVLKSAIELDLLELIAKAGPGAAVSPSE-LAAQLPTTNPD  73

Query  215  AP-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
            A   L+R+LR+L +Y +    +        ER YS+  V K L  + DG+S    +L + 
Sbjct  74   AAVMLDRILRLLCTYSVLNCSLRTLPDGRVERLYSLAPVCKYLTKNGDGVSMAPLLLMNQ  133

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
               +M++W  + +AV++  I PF K  G   + Y+G +P  N +  + MS  S   MK  
Sbjct  134  DKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKI  192

Query  563  L  565
            L
Sbjct  193  L  193



>gb|AEO14870.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza]
Length=364

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 90/173 (52%), Gaps = 4/173 (2%)
 Frame = +2

Query  56   LRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERL  235
            L  M+LA+   +PM L + I L++ + I + G+ A +S +E+ + +  +  G A  L+R+
Sbjct  22   LFAMQLASASVLPMVLKSAIELDLLEIIKKAGAGAFVSPAEVAAQLPTTNEGAAVMLDRI  81

Query  236  LRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAW  406
            LR+L SY I    +        +R Y +  V K L  + DG+S     L +    +M++W
Sbjct  82   LRLLASYAILECRLKTLPDGGVQRLYGLAPVCKFLTKNDDGVSVAPLALMNQDKVLMESW  141

Query  407  PLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              + +AV+D  I PF K  G + + Y+G +P  N +  + MSG S   MK  L
Sbjct  142  YHLKDAVLDGEI-PFNKAYGMSAFEYHGTDPRFNKVFNQGMSGHSTITMKKIL  193



>gb|AAP03055.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=234

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  389  AMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             ++KAWP +H A++D+S EPF +VNGE  Y YYGKN E+N  MQ AMSG+SVP+MKA L
Sbjct  2    TLLKAWPFLHTAILDASTEPFARVNGEPAYQYYGKNDELNKNMQYAMSGVSVPYMKALL  60



>ref|XP_010103059.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB94708.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=264

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A L  M+LA+   +PM L   + L++ + + + G  A LS S+++S  LP+    A
Sbjct  15   SDEEANLFAMQLASASVLPMVLKTALDLDLLEIMAKAGPGAYLSPSDVVSQ-LPTKNPGA  73

Query  218  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY I      ++     ER Y +  V K L  ++DG+S G+  L +  
Sbjct  74   PVMLDRVLRLLASYSILTYSLRNLPDGKVERLYGLGPVCKYLTKNEDGVSIGSLCLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + + +++  I PF K +G   + Y+G +P  N +  K M   S   MK  L
Sbjct  134  KVLMESWYHLKDTILEGGI-PFNKAHGMTSFDYHGTDPRFNKIFNKGMFDHSTITMKKIL  192



>ref|XP_010446534.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Camelina sativa]
Length=363

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 101/180 (56%), Gaps = 8/180 (4%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D+ A L  M+LA+   +PM+L A + L++ + + +  S  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKAALDLDLLEIMAKNAS--PMSPTEI-ASQLPTKNPEA  71

Query  218  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+LTSY +       ++ D+ ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G + + Y+G +P  N +    MS  S   MK  L
Sbjct  132  KVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKLL  190



>ref|XP_010442991.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Camelina sativa]
Length=363

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 101/180 (56%), Gaps = 8/180 (4%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D+ A L  M+LA+   +PM+L A + L++ + + +  S  P+S +EI +S LP+   +A
Sbjct  15   TDDEAALFAMQLASASVLPMALKAALDLDLLEIMAKNAS--PMSPTEI-ASQLPTKNPEA  71

Query  218  P-NLERLLRMLTSYGIF---REHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+LTSY +       ++ D+ ER Y +  V K L  ++DG+S  A  L +  
Sbjct  72   PVMLDRILRLLTSYSVLTCSNRKLSGDSVERIYGLGPVCKYLTKNEDGVSIAALCLMNQD  131

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G + + Y+G +P  N +    MS  S   MK  L
Sbjct  132  KVLMESWYHLKDAVLDGGI-PFNKAYGMSAFEYHGTDPRFNKVFNNGMSNHSTITMKKLL  190



>ref|XP_007015113.1| Caffeic acid 3-O-methyltransferase 1 isoform 1 [Theobroma cacao]
 gb|EOY32732.1| Caffeic acid 3-O-methyltransferase 1 isoform 1 [Theobroma cacao]
Length=426

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 94/183 (51%), Gaps = 7/183 (4%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            SE D  +    M+L N  ++PMSL A I+L + + I + G +A LS  EI  + LP+   
Sbjct  75   SEQDEESFSCAMQLVNSTALPMSLHAAIQLEIFEIIAKAGPDAKLSPQEI-GAHLPTQNP  133

Query  212  DAPN-LERLLRMLTSYGIFREHI----NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  376
            DAP  L+ +LR+L S+ +    +      D+ +R YS+  V K  + ++DG+S    V  
Sbjct  134  DAPMMLDSILRLLASHSVLACSLAVVEQGDSPQRLYSLTPVTKFFIRNEDGVSLAPLVSL  193

Query  377  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
                  + +W  + +A+++  I PF +V+G   + Y GK+P  N +   AM   +   MK
Sbjct  194  VQDKIFLDSWCQLKDAILEGGI-PFNRVHGTHAFEYPGKDPRFNKIFNTAMMNQTTIVMK  252

Query  557  AFL  565
              L
Sbjct  253  KIL  255



>gb|AFO69477.1| caffeic acid O-methyltransferase [Sorghum bicolor]
Length=362

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSS--VLPSGGG  211
            +D  A +  M+LA+   +PM+L   + L + + + Q  +   L+A E+++   V P+   
Sbjct  12   ADEEACMYAMQLASSSILPMTLKNALELGLLEVL-QKDAGKALAAEEVVARLPVAPTNPA  70

Query  212  DAPNLERLLRMLTSYGIFREHI-NADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
             A  ++R+LR+L SY + R  + + D   ERRYS   VGK L  ++DG+S  A  L +  
Sbjct  71   AADMVDRMLRLLASYDVVRCQMEDKDGKYERRYSAAPVGKWLTPNEDGVSMAALALMNQD  130

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + M   SV   K  L
Sbjct  131  KVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLL  189



>gb|AAO43609.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AEM63601.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AEM63610.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AEM63611.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AEM63612.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AFO69478.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AFO69479.1| caffeic acid O-methyltransferase [Sorghum bicolor]
 gb|AHN09802.1| caffeic acid O-methyltransferase [Sorghum sudanense]
Length=362

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 95/180 (53%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSS--VLPSGGG  211
            +D  A +  M+LA+   +PM+L   + L + + + Q  +   L+A E+++   V P+   
Sbjct  12   ADEEACMYAMQLASSSILPMTLKNALELGLLEVL-QKDAGKALAAEEVVARLPVAPTNPA  70

Query  212  DAPNLERLLRMLTSYGIFREHI-NADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
             A  ++R+LR+L SY + R  + + D   ERRYS   VGK L  ++DG+S  A  L +  
Sbjct  71   AADMVDRMLRLLASYDVVRCQMEDKDGKYERRYSAAPVGKWLTPNEDGVSMAALALMNQD  130

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G   + Y+G +P  N +  + M   SV   K  L
Sbjct  131  KVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLL  189



>ref|XP_007015114.1| Caffeic acid 3-O-methyltransferase 1 isoform 2 [Theobroma cacao]
 gb|EOY32733.1| Caffeic acid 3-O-methyltransferase 1 isoform 2 [Theobroma cacao]
Length=427

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 94/183 (51%), Gaps = 7/183 (4%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            SE D  +    M+L N  ++PMSL A I+L + + I + G +A LS  EI  + LP+   
Sbjct  75   SEQDEESFSCAMQLVNSTALPMSLHAAIQLEIFEIIAKAGPDAKLSPQEI-GAHLPTQNP  133

Query  212  DAPN-LERLLRMLTSYGIFREHI----NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQ  376
            DAP  L+ +LR+L S+ +    +      D+ +R YS+  V K  + ++DG+S    V  
Sbjct  134  DAPMMLDSILRLLASHSVLACSLAVVEQGDSPQRLYSLTPVTKFFIRNEDGVSLAPLVSL  193

Query  377  HHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMK  556
                  + +W  + +A+++  I PF +V+G   + Y GK+P  N +   AM   +   MK
Sbjct  194  VQDKIFLDSWCQLKDAILEGGI-PFNRVHGTHAFEYPGKDPRFNKIFNTAMMNQTTIVMK  252

Query  557  AFL  565
              L
Sbjct  253  KIL  255



>dbj|BAD18975.1| phloroglucinol O-methyltransferase [Rosa chinensis var. spontanea]
Length=371

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 91/173 (53%), Gaps = 8/173 (5%)
 Frame = +2

Query  65   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLR  241
            + LAN++ +PM L + + LNV D IW  G    LS S+I ++ LP+   +AP  L+R+LR
Sbjct  30   IRLANVVILPMVLKSALELNVIDIIWGAGDGESLSPSDI-AAQLPTKNSNAPAVLDRMLR  88

Query  242  MLTSYGIFR--EHINADAS-ERRYSVDEVGKTLVTDKDG--LSYGAYVLQHHQAAMMKAW  406
            +L S+ I +      +D   ER YS   + K LV D++G   S G   L HH    M+ W
Sbjct  89   LLASHSILKCSARTGSDGQVERLYSAGPICKFLVKDQNGGTRSVGPLFLLHHDKVFMEGW  148

Query  407  PLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +++A+++  I PF +  G   + Y   +   N +  +AMS  +   +K  L
Sbjct  149  FHLNDAILEGGI-PFNRAYGMTAFEYPETDERFNRVFNQAMSNHTTLILKKIL  200



>sp|Q8LL87.1|COMT1_COFCA RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Coffea canephora]
 gb|AAN03727.1| caffeic acid O-methyltransferase [Coffea canephora]
 emb|CDP04982.1| unnamed protein product [Coffea canephora]
Length=350

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 94/176 (53%), Gaps = 6/176 (3%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NL  226
            A L  M LA+   +PM L + I L++ + I + G  A +S SE L++ LP+   +AP  L
Sbjct  6    ACLFAMSLASASVLPMVLKSAIELDLLELIAKAGPGAYVSPSE-LAAQLPTHNPEAPIML  64

Query  227  ERLLRMLTSYGIFREHIN--ADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMM  397
            +R+LR+L +Y +    +N  AD   ER Y +  V K L  + DG+S    +L +    +M
Sbjct  65   DRILRLLATYSVLDCKLNNLADGGVERLYGLAPVCKFLTKNADGVSMAPLLLMNQDKVLM  124

Query  398  KAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            ++W  + +AV+D  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  125  ESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKIL  179



>gb|KJB52493.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
 gb|KJB52494.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
Length=275

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 92/180 (51%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD  A    M+LA+   +PM L + I L++ + + + G  A LS  E+ +S LP+   DA
Sbjct  37   SDEEANSFAMQLASASVLPMVLKSAIELDLLEIMAKAGPGAFLSPKEV-ASKLPTTNPDA  95

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+LR+L SY +    +        ER Y +  V K L  ++DG++  A  L +  
Sbjct  96   PVMLDRILRLLASYNVLTCSLRTLPDGKVERLYGLGPVCKFLTKNEDGVTLSALSLMNQD  155

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + +AV+D  I PF K  G   + Y+G +   N +  K MS  S   MK  L
Sbjct  156  KVLMESWYYLKDAVLDGGI-PFNKAYGMTAFEYHGTDTRFNKVFNKGMSDHSTITMKKIL  214



>gb|AAN03726.1| caffeic acid O-methyltransferase [Coffea canephora]
Length=350

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 94/176 (53%), Gaps = 6/176 (3%)
 Frame = +2

Query  50   ARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAP-NL  226
            A L  M LA+   +PM L + I L++ + I + G  A +S SE L++ LP+   +AP  L
Sbjct  6    ACLFAMSLASASVLPMVLKSAIELDLLELIAKAGPGAYVSPSE-LAAQLPTHNPEAPIML  64

Query  227  ERLLRMLTSYGIFREHIN--ADAS-ERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMM  397
            +R+LR+L +Y +    +N  AD   ER Y +  V K L  + DG+S    +L +    +M
Sbjct  65   DRILRLLATYSVLDCKLNNLADGGVERLYGLAPVCKFLTKNADGVSMAPLLLMNQDKVLM  124

Query  398  KAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            ++W  + +AV+D  I PF K  G   + Y+G +P  N +  + MS  S   MK  L
Sbjct  125  ESWYHLKDAVLDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKIL  179



>gb|AAY86361.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
 gb|ADQ53456.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
Length=365

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 94/180 (52%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            +D  A L  M+LA+   +PM L + + L++ + I + G NA LS S+I +S LP+   DA
Sbjct  15   NDEEANLFAMQLASASVLPMILKSALELDLLEIIAKAGPNAQLSPSDI-ASQLPTKNPDA  73

Query  218  P-NLERLLRMLTSYGIFREHINA---DASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
               L+R++R+L  Y +    +        ER Y +  V K LV ++DG+S     L +  
Sbjct  74   AVMLDRMMRLLACYNVLSSSLRTLPDGKIERLYGLAPVAKYLVKNEDGVSIAPLNLMNQD  133

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
              +M++W  + E V++  I PF K +G   + Y+GK+   N +  K M+  S   MK  L
Sbjct  134  KVLMESWYYLTETVLEGGI-PFNKAHGMTSFEYHGKDARFNKVFNKGMADHSTITMKKIL  192



>ref|XP_010048410.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
 gb|KCW89067.1| hypothetical protein EUGRSUZ_A01395 [Eucalyptus grandis]
Length=366

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 92/180 (51%), Gaps = 6/180 (3%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDA  217
            SD GA L  M+L     +P  L   I L++ + + + G  A L+ +E+ +S LP+   DA
Sbjct  16   SDEGANLFAMQLVTASVLPRVLKTTIELDLLEIMARAGPGACLTPAEV-ASQLPTQNPDA  74

Query  218  P-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQ  385
            P  L+R+ ++L SY +       +     ER Y +  V K L+ ++DG+S     L +H 
Sbjct  75   PVMLDRIFQLLASYSVLTCTLRDLPEGKVERLYGLAPVCKFLMKNEDGISIAPLNLMNHS  134

Query  386  AAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
               +++W  + +A++D  I PF K +G   + Y G +P +N    + MS +S   MK  L
Sbjct  135  KLAVESWNCLKDAILDGGI-PFNKAHGMTAFDYLGTDPRLNKTFNRLMSDLSTITMKKIL  193



>sp|O23760.1|COMT1_CLABR RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase; Flags: Precursor [Clarkia breweri]
 gb|AAB71141.1| caffeic acid O-methyltransferase [Clarkia breweri]
Length=370

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 11/181 (6%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQG---GSNAPLSASEILSSVLPSGG  208
            SD  A L  M+LA+   +PM L A I L+V + + +    GS A +S +EI ++ LP+  
Sbjct  17   SDEEANLFAMQLASASVLPMVLKAAIELDVLEIMAKSIPHGSGAYISPAEI-AAQLPTTN  75

Query  209  GDAP-NLERLLRMLTSYGI----FREHINADASERRYSVDEVGKTLVTDKDGLSYGAYVL  373
             DAP  L+R+LR+L SY +     RE  +    ER Y +  V K L  ++DG+S     L
Sbjct  76   PDAPVMLDRVLRLLASYSVVTCSLRELPDGKV-ERLYGLAPVCKFLTKNEDGVSLAPLCL  134

Query  374  QHHQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFM  553
             +    +M++W  + +A++D  I PF K  G   + Y+G +P  N +  + MS  S   M
Sbjct  135  MNQDKVLMESWYYLKDAILDGGI-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITM  193

Query  554  K  556
            K
Sbjct  194  K  194



>gb|ABR18380.1| unknown [Picea sitchensis]
Length=365

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 86/170 (51%), Gaps = 4/170 (2%)
 Frame = +2

Query  65   MELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPNLERLLRM  244
            MEL N   +PM + A I L+V   I   G+   LS  +I++ +  +    A  L+R+LR+
Sbjct  24   MELGNFSCLPMGMKAAIELDVLQIIANAGNGVQLSPRQIVAHIPTTNPDAAITLDRILRV  83

Query  245  LTSYGIFREHINAD---ASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLV  415
            L S+ +    +  D    +ER Y +  + K LV ++DG+S    VL +    +M+ W  +
Sbjct  84   LASHSVLSCSVTTDENGKAERLYGLTPLCKYLVNNQDGVSLAPLVLMNQDKVLMETWYYL  143

Query  416  HEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             +AV++ S +PF K +G   + Y   +   N L  ++MS  S+  M   +
Sbjct  144  KDAVLEGS-QPFTKAHGMNAFEYTAMDQRFNRLFNRSMSEYSIMLMNKIM  192



>gb|AAG43822.1|AF212316_1 caffeic acid O-methyltransferase [Capsicum annuum]
Length=359

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 98/182 (54%), Gaps = 6/182 (3%)
 Frame = +2

Query  32   SESDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGG  211
            +++++ A L  M+LA+   +PM L + + L++ + + + G  A +S SE L++ LP+   
Sbjct  9    TQTEDEAFLFAMQLASASVLPMVLKSALELDLLEIMAKAGPGAAISPSE-LAAQLPTKNP  67

Query  212  DAP-NLERLLRMLTSYGIFREHINADAS---ERRYSVDEVGKTLVTDKDGLSYGAYVLQH  379
            +AP  L+R+LR+L +Y +    +        ER YS+  V K L  + DG+S    +L +
Sbjct  68   EAPIMLDRMLRLLATYSVLNCTLRTLPDGRVERLYSLAPVCKLLTKNADGVSVAPLLLMN  127

Query  380  HQAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKA  559
                +M++W  + +AV+D  + PF K  G   + Y+G +P  N +  + MS  S   MK 
Sbjct  128  QDKVLMESWYHLTDAVLDGGV-PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTMTMKK  186

Query  560  FL  565
             L
Sbjct  187  IL  188



>ref|XP_006478225.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X2 [Citrus sinensis]
Length=252

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 86/161 (53%), Gaps = 3/161 (2%)
 Frame = +2

Query  89   VPMSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLRMLTSYGIF  265
            +PM++ AVI L V + I + G  A LSASEI + +  +   DAP  L+R+LR+L S+   
Sbjct  22   LPMAMQAVIGLGVFEIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRMLRLLASHSAV  81

Query  266  REHIN-ADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSI  442
               I+ AD S+R Y +++V    V +KDG+S G  +        M +W  + EA+ +  +
Sbjct  82   ECSIDDADDSQRLYGLNDVSNYFVPNKDGVSLGPMLALIQDKVFMDSWSQLKEAITEGGV  141

Query  443  EPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
             PF +V+G   + Y G +P  N +   AM   +   ++  L
Sbjct  142  -PFDRVHGTHAFEYLGLDPRFNEVFNIAMYNYTTLVIQKIL  181



>ref|XP_010520933.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Tarenaya hassleriana]
Length=366

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 96/181 (53%), Gaps = 7/181 (4%)
 Frame = +2

Query  38   SDNGARLRIMELANMISVPMSLCAVIRLNVADAIWQ-GGSNAPLSASEILSSVLPSGGGD  214
            SD+ A L  M+LA+   +PM L + I L++ + + +  G +  +S S+I +S LP+   D
Sbjct  15   SDDEANLFAMQLASASVLPMVLKSAIELDLLEIMAKTAGFSGQMSPSDI-ASRLPTKNPD  73

Query  215  AP-NLERLLRMLTSYGIFR---EHINADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHH  382
            AP  L+R+LR+L SY I       ++    ER Y +  V K L  ++DG+S  A  L + 
Sbjct  74   APVMLDRILRILASYSILTCSVRTLSGGGVERLYGLGPVCKYLTKNEDGVSIAALCLMNQ  133

Query  383  QAAMMKAWPLVHEAVVDSSIEPFVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAF  562
               +M++W  + +AV++  I PF K  G   + Y+G +P  N +    MS  S   MK  
Sbjct  134  DKVLMESWYHLKDAVLEGGI-PFNKAYGMTAFEYHGTDPRFNKVFNNGMSNHSTITMKKI  192

Query  563  L  565
            L
Sbjct  193  L  193



>ref|XP_006441468.1| hypothetical protein CICLE_v10020874mg [Citrus clementina]
 gb|ESR54708.1| hypothetical protein CICLE_v10020874mg [Citrus clementina]
Length=352

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 86/159 (54%), Gaps = 3/159 (2%)
 Frame = +2

Query  95   MSLCAVIRLNVADAIWQGGSNAPLSASEILSSVLPSGGGDAPN-LERLLRMLTSYGIFRE  271
            M++ AVI L + + I + G  A LSASEI + +  +   DAP  L+R+L +L SYGI   
Sbjct  24   MTMKAVINLGLFEIIAKAGPGAKLSASEIAAQLPATKNKDAPTMLDRILGLLASYGIVEC  83

Query  272  HI-NADASERRYSVDEVGKTLVTDKDGLSYGAYVLQHHQAAMMKAWPLVHEAVVDSSIEP  448
             + + D S R Y +++V K  V ++DG+S G  +      A + +W  + E +++  + P
Sbjct  84   SLDDVDGSHRLYGLNDVSKYFVPNQDGVSLGPVLALIQDKAFLDSWSELKETIIEGGV-P  142

Query  449  FVKVNGEAPYSYYGKNPEMNSLMQKAMSGISVPFMKAFL  565
            F +V+G   + Y G +P  N +   AMS  +   ++  L
Sbjct  143  FDRVHGTNAFEYLGLDPRFNEVFSTAMSNHTTLVLQKIL  181



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920