BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF050B21

Length=614
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB59527.1|  hypothetical protein B456_009G259500                    330   1e-111   Gossypium raimondii
ref|XP_009628178.1|  PREDICTED: ras-related protein Rab7                329   2e-111   Nicotiana tomentosiformis
ref|XP_004237840.1|  PREDICTED: ras-related protein Rab7                328   3e-111   Solanum lycopersicum
ref|XP_009606119.1|  PREDICTED: ras-related protein Rab7-like           328   3e-111   Nicotiana tomentosiformis
ref|XP_011074118.1|  PREDICTED: ras-related protein Rab7                328   8e-111   Sesamum indicum [beniseed]
ref|XP_009763630.1|  PREDICTED: ras-related protein Rab7-like           327   1e-110   Nicotiana sylvestris
gb|AAA74120.1|  putative                                                327   1e-110   Nicotiana tabacum [American tobacco]
emb|CDP01135.1|  unnamed protein product                                327   1e-110   Coffea canephora [robusta coffee]
gb|EYU36545.1|  hypothetical protein MIMGU_mgv1a013950mg                327   2e-110   Erythranthe guttata [common monkey flower]
emb|CAA98168.1|  RAB7A                                                  326   3e-110   Lotus japonicus
ref|XP_002527104.1|  protein with unknown function                      325   5e-110   Ricinus communis
ref|NP_001235371.1|  uncharacterized protein LOC100499740               325   6e-110   Glycine max [soybeans]
gb|KHN17053.1|  Ras-related protein Rab7                                325   6e-110   Glycine soja [wild soybean]
ref|XP_010063810.1|  PREDICTED: ras-related protein Rab7                325   6e-110   Eucalyptus grandis [rose gum]
ref|XP_007201851.1|  hypothetical protein PRUPE_ppa011579mg             325   1e-109   Prunus persica
ref|XP_007143599.1|  hypothetical protein PHAVU_007G085200g             325   1e-109   Phaseolus vulgaris [French bean]
gb|KJB59938.1|  hypothetical protein B456_009G286800                    324   2e-109   Gossypium raimondii
ref|XP_003556176.1|  PREDICTED: ras-related protein Rab7                324   2e-109   
sp|Q41640.1|RAB7_VIGAC  RecName: Full=Ras-related protein Rab7          324   2e-109   Vigna aconitifolia [moth-bean]
ref|XP_009342702.1|  PREDICTED: ras-related protein Rab7                324   2e-109   Pyrus x bretschneideri [bai li]
ref|XP_010243311.1|  PREDICTED: ras-related protein Rab7                324   3e-109   Nelumbo nucifera [Indian lotus]
ref|XP_006434552.1|  hypothetical protein CICLE_v10002522mg             323   3e-109   Citrus clementina [clementine]
ref|XP_003636326.1|  Ras-related protein Rab7                           324   3e-109   
gb|ACU24093.1|  unknown                                                 323   3e-109   Glycine max [soybeans]
ref|XP_008337228.1|  PREDICTED: ras-related protein Rab7-like           323   3e-109   
ref|XP_010261069.1|  PREDICTED: ras-related protein Rab7-like iso...    323   3e-109   Nelumbo nucifera [Indian lotus]
gb|ACJ84198.1|  unknown                                                 324   4e-109   Medicago truncatula
ref|XP_003636325.1|  Ras-related protein Rab7                           323   4e-109   
ref|XP_002264356.1|  PREDICTED: ras-related protein Rab7 isoform X1     323   6e-109   Vitis vinifera
ref|XP_004290467.1|  PREDICTED: ras-related protein Rab7                323   6e-109   Fragaria vesca subsp. vesca
ref|XP_008361208.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    323   7e-109   
ref|XP_004139780.1|  PREDICTED: ras-related protein Rab7-like           323   8e-109   Cucumis sativus [cucumbers]
ref|XP_002300895.1|  hypothetical protein POPTR_0002s06310g             322   9e-109   Populus trichocarpa [western balsam poplar]
ref|XP_007019678.1|  RAB GTPase G3A isoform 1                           322   2e-108   Theobroma cacao [chocolate]
ref|XP_010681464.1|  PREDICTED: ras-related protein Rab7                322   2e-108   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB28941.1|  hypothetical protein B456_005G076500                    322   2e-108   Gossypium raimondii
ref|XP_004489906.1|  PREDICTED: ras-related protein Rab7-like           322   2e-108   Cicer arietinum [garbanzo]
gb|AFU92144.1|  small GTP binding protein                               321   3e-108   Arachis hypogaea [goober]
gb|KDP36048.1|  hypothetical protein JCGZ_10014                         321   3e-108   Jatropha curcas
gb|ACU17616.1|  unknown                                                 321   3e-108   Glycine max [soybeans]
gb|KJB28940.1|  hypothetical protein B456_005G076500                    321   4e-108   Gossypium raimondii
ref|XP_004496410.1|  PREDICTED: ras-related protein Rab7-like           320   5e-108   Cicer arietinum [garbanzo]
ref|XP_011026316.1|  PREDICTED: ras-related protein Rab7                320   8e-108   Populus euphratica
gb|EPS71938.1|  hypothetical protein M569_02820                         318   3e-107   Genlisea aurea
ref|XP_010261068.1|  PREDICTED: ras-related protein RABA4a-like i...    325   5e-107   Nelumbo nucifera [Indian lotus]
ref|XP_010261066.1|  PREDICTED: ras-related protein RABA4a-like i...    325   5e-107   Nelumbo nucifera [Indian lotus]
ref|XP_010261065.1|  PREDICTED: uncharacterized protein LOC104599...    325   6e-107   Nelumbo nucifera [Indian lotus]
gb|AFK34363.1|  unknown                                                 318   6e-107   Medicago truncatula
ref|XP_009335165.1|  PREDICTED: ras-related protein Rab7                318   7e-107   Pyrus x bretschneideri [bai li]
ref|XP_010935166.1|  PREDICTED: ras-related protein Rab7                318   7e-107   Elaeis guineensis
ref|XP_008447760.1|  PREDICTED: ras-related protein Rab7 isoform X2     317   8e-107   Cucumis melo [Oriental melon]
ref|XP_003636324.1|  Ras-related protein Rab7                           317   9e-107   
ref|XP_010261064.1|  PREDICTED: uncharacterized protein LOC104599...    325   9e-107   Nelumbo nucifera [Indian lotus]
gb|KHG00821.1|  Ras-related Rab7                                        317   1e-106   Gossypium arboreum [tree cotton]
gb|KEH43618.1|  RAB GTPase-like protein A1D                             317   1e-106   Medicago truncatula
ref|XP_002307527.1|  hypothetical protein POPTR_0005s22070g             317   2e-106   Populus trichocarpa [western balsam poplar]
ref|XP_009410766.1|  PREDICTED: ras-related protein Rab7-like           317   2e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011044829.1|  PREDICTED: ras-related protein Rab7-like           317   2e-106   Populus euphratica
ref|XP_008812295.1|  PREDICTED: ras-related protein Rab7                315   5e-106   Phoenix dactylifera
gb|AFK43592.1|  unknown                                                 315   7e-106   Lotus japonicus
ref|XP_006842165.1|  hypothetical protein AMTR_s00078p00147080          313   4e-105   Amborella trichopoda
ref|XP_010521112.1|  PREDICTED: ras-related protein Rab7                311   1e-104   Tarenaya hassleriana [spider flower]
ref|XP_010543071.1|  PREDICTED: ras-related protein RABG3a              309   1e-103   Tarenaya hassleriana [spider flower]
emb|CAA98169.1|  RAB7B                                                  309   2e-103   Lotus japonicus
ref|XP_009110129.1|  PREDICTED: ras-related protein RABG3b              306   1e-102   Brassica rapa
ref|XP_006416164.1|  hypothetical protein EUTSA_v10008896mg             305   2e-102   
ref|XP_006303560.1|  hypothetical protein CARUB_v10011037mg             306   3e-102   Capsella rubella
ref|XP_010460036.1|  PREDICTED: ras-related protein RABG3b              304   1e-101   Camelina sativa [gold-of-pleasure]
emb|CDY41473.1|  BnaA08g20750D                                          304   2e-101   Brassica napus [oilseed rape]
emb|CAN62813.1|  hypothetical protein VITISV_031882                     303   2e-101   Vitis vinifera
emb|CDX91688.1|  BnaC08g06070D                                          303   3e-101   
ref|NP_001044060.1|  Os01g0714900                                       303   5e-101   
ref|XP_002890529.1|  predicted protein                                  303   6e-101   
gb|KDP35265.1|  hypothetical protein JCGZ_09424                         302   7e-101   Jatropha curcas
ref|XP_007207890.1|  hypothetical protein PRUPE_ppa021084mg             302   7e-101   Prunus persica
ref|XP_002279477.1|  PREDICTED: ras-related protein Rab7 isoform X2     302   8e-101   Vitis vinifera
ref|XP_006644616.1|  PREDICTED: ras-related protein Rab7-like           302   8e-101   Oryza brachyantha
ref|XP_002872458.1|  AtRABG3a                                           302   9e-101   Arabidopsis lyrata subsp. lyrata
gb|KEH43617.1|  RAB GTPase-like protein A1D                             303   1e-100   Medicago truncatula
ref|XP_002973800.1|  rab family GTPase                                  301   2e-100   Selaginella moellendorffii
ref|XP_010438119.1|  PREDICTED: ras-related protein RABG3a              301   3e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006288671.1|  hypothetical protein CARUB_v10001979mg             301   3e-100   Capsella rubella
gb|KFK44364.1|  hypothetical protein AALP_AA1G247900                    301   3e-100   Arabis alpina [alpine rockcress]
ref|XP_004969742.1|  PREDICTED: ras-related protein Rab7-like           301   4e-100   Setaria italica
ref|XP_008232432.1|  PREDICTED: ras-related protein Rab7                300   4e-100   Prunus mume [ume]
ref|XP_009399841.1|  PREDICTED: ras-related protein Rab7-like           300   6e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_192710.1|  RAB GTPase homolog G3A                                300   8e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397152.1|  hypothetical protein EUTSA_v10028966mg             300   8e-100   Eutrema salsugineum [saltwater cress]
dbj|BAJ99564.1|  predicted protein                                      300   9e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003569676.1|  PREDICTED: ras-related protein Rab7                300   9e-100   Brachypodium distachyon [annual false brome]
ref|XP_009113550.1|  PREDICTED: ras-related protein RABG3a              300   1e-99    
gb|KFK32051.1|  hypothetical protein AALP_AA6G193700                    299   1e-99    Arabis alpina [alpine rockcress]
emb|CDY48910.1|  BnaA09g22850D                                          299   1e-99    Brassica napus [oilseed rape]
ref|XP_010421879.1|  PREDICTED: ras-related protein RABG3a-like         299   1e-99    Camelina sativa [gold-of-pleasure]
ref|XP_002458401.1|  hypothetical protein SORBIDRAFT_03g032810          299   2e-99    Sorghum bicolor [broomcorn]
ref|XP_009336367.1|  PREDICTED: ras-related protein Rab7                299   2e-99    Pyrus x bretschneideri [bai li]
ref|XP_004141770.1|  PREDICTED: ras-related protein RABG3d-like i...    299   2e-99    Cucumis sativus [cucumbers]
ref|NP_173688.1|  GTP-binding protein Rab7                              298   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004158989.1|  PREDICTED: ras-related protein RABG3d-like i...    298   2e-99    
gb|ABK23074.1|  unknown                                                 298   2e-99    Picea sitchensis
gb|KHG02230.1|  Ras-related Rab7                                        298   4e-99    Gossypium arboreum [tree cotton]
ref|XP_011464793.1|  PREDICTED: ras-related protein Rab7                298   4e-99    Fragaria vesca subsp. vesca
ref|XP_010027761.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    298   4e-99    
ref|XP_008462166.1|  PREDICTED: ras-related protein Rab7                298   4e-99    Cucumis melo [Oriental melon]
ref|XP_009409452.1|  PREDICTED: ras-related protein Rab7                298   4e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413819.1|  PREDICTED: ras-related protein Rab7-like           298   5e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010065394.1|  PREDICTED: ras-related protein Rab7                298   5e-99    Eucalyptus grandis [rose gum]
ref|XP_010652865.1|  PREDICTED: ras-related protein Rab7 isoform X1     298   5e-99    Vitis vinifera
ref|XP_010254112.1|  PREDICTED: ras-related protein Rab7-like           297   6e-99    Nelumbo nucifera [Indian lotus]
ref|XP_010925847.1|  PREDICTED: ras-related protein Rab7-like           297   6e-99    Elaeis guineensis
gb|KDP37234.1|  hypothetical protein JCGZ_06290                         297   7e-99    Jatropha curcas
ref|NP_001266750.1|  uncharacterized protein LOC101027204               297   1e-98    
ref|XP_008798405.1|  PREDICTED: ras-related protein Rab7-like           297   1e-98    Phoenix dactylifera
ref|XP_011100905.1|  PREDICTED: ras-related protein Rab7-like           297   1e-98    Sesamum indicum [beniseed]
gb|KJB70461.1|  hypothetical protein B456_011G074700                    296   1e-98    Gossypium raimondii
gb|KJB49115.1|  hypothetical protein B456_008G101600                    296   2e-98    Gossypium raimondii
ref|XP_010545703.1|  PREDICTED: ras-related protein RABG3d              296   2e-98    Tarenaya hassleriana [spider flower]
ref|XP_007024171.1|  RAB GTPase G3D isoform 1                           296   2e-98    Theobroma cacao [chocolate]
ref|XP_002516039.1|  protein with unknown function                      296   2e-98    Ricinus communis
gb|AFC93432.1|  Ras-like protein                                        296   2e-98    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010924742.1|  PREDICTED: ras-related protein Rab7-like iso...    296   3e-98    
ref|XP_010915809.1|  PREDICTED: ras-related protein Rab7                296   3e-98    Elaeis guineensis
gb|KJB49113.1|  hypothetical protein B456_008G101600                    296   3e-98    Gossypium raimondii
ref|XP_009416417.1|  PREDICTED: ras-related protein Rab7-like           296   3e-98    Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN75406.1|  hypothetical protein VITISV_010510                     295   3e-98    Vitis vinifera
gb|ABK22035.1|  unknown                                                 295   4e-98    Picea sitchensis
ref|XP_006833300.1|  hypothetical protein AMTR_s00109p00039990          295   5e-98    Amborella trichopoda
ref|XP_002284408.1|  PREDICTED: ras-related protein Rab7                295   5e-98    Vitis vinifera
ref|XP_008792342.1|  PREDICTED: ras-related protein Rab7                295   5e-98    Phoenix dactylifera
gb|KDO48898.1|  hypothetical protein CISIN_1g028654mg                   294   5e-98    Citrus sinensis [apfelsine]
ref|XP_010916758.1|  PREDICTED: ras-related protein Rab7-like           295   6e-98    Elaeis guineensis
sp|Q9XER8.1|RAB7_GOSHI  RecName: Full=Ras-related protein Rab7          295   6e-98    Gossypium hirsutum [American cotton]
ref|XP_004961378.1|  PREDICTED: ras-related protein Rab7-like iso...    295   6e-98    Setaria italica
ref|XP_010498755.1|  PREDICTED: ras-related protein RABG3b-like         295   6e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010062470.1|  PREDICTED: ras-related protein Rab7                295   6e-98    Eucalyptus grandis [rose gum]
emb|CDX99311.1|  BnaC05g34260D                                          295   7e-98    
emb|CDY05073.1|  BnaC03g28710D                                          295   7e-98    
ref|XP_008795048.1|  PREDICTED: ras-related protein Rab7                295   7e-98    
ref|XP_009613203.1|  PREDICTED: ras-related protein Rab7                295   7e-98    Nicotiana tomentosiformis
ref|XP_006305619.1|  hypothetical protein CARUB_v10010306mg             295   7e-98    Capsella rubella
ref|NP_175638.1|  RAB GTPase homolog G3D                                295   8e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298560.1|  hypothetical protein CARUB_v10014644mg             294   8e-98    
ref|XP_006475629.1|  PREDICTED: ras-related protein RABG3d-like i...    294   1e-97    Citrus sinensis [apfelsine]
ref|XP_002509475.1|  protein with unknown function                      294   1e-97    Ricinus communis
ref|XP_010535164.1|  PREDICTED: ras-related protein RABG3c-like         294   1e-97    Tarenaya hassleriana [spider flower]
ref|XP_009134161.1|  PREDICTED: ras-related protein RABG3a-like         294   1e-97    Brassica rapa
ref|XP_008810026.1|  PREDICTED: ras-related protein Rab7-like           294   1e-97    Phoenix dactylifera
ref|XP_006392939.1|  hypothetical protein EUTSA_v10011782mg             294   1e-97    Eutrema salsugineum [saltwater cress]
emb|CDX90732.1|  BnaA03g24120D                                          294   1e-97    
gb|KDP46241.1|  hypothetical protein JCGZ_10081                         294   1e-97    Jatropha curcas
ref|XP_007042216.1|  RAB GTPase G3F isoform 1                           294   1e-97    Theobroma cacao [chocolate]
gb|KJB47407.1|  hypothetical protein B456_008G028300                    293   1e-97    Gossypium raimondii
ref|XP_006423246.1|  hypothetical protein CICLE_v10029292mg             294   1e-97    Citrus clementina [clementine]
ref|XP_010254883.1|  PREDICTED: ras-related protein Rab7                294   2e-97    Nelumbo nucifera [Indian lotus]
dbj|BAJ90488.1|  predicted protein                                      294   2e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010479732.1|  PREDICTED: ras-related protein RABG3d-like         294   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_002313053.1|  RAS-related GTP-binding family protein             294   2e-97    Populus trichocarpa [western balsam poplar]
gb|KJB47405.1|  hypothetical protein B456_008G028300                    294   2e-97    Gossypium raimondii
ref|XP_003631644.1|  PREDICTED: ras-related protein Rab7                293   2e-97    Vitis vinifera
ref|XP_003606887.1|  Ras-related protein Rab7                           293   2e-97    Medicago truncatula
ref|XP_010465997.1|  PREDICTED: ras-related protein RABG3f-like         293   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_004302908.1|  PREDICTED: ras-related protein Rab7                293   2e-97    Fragaria vesca subsp. vesca
ref|XP_006298561.1|  hypothetical protein CARUB_v10014644mg             293   2e-97    Capsella rubella
gb|KHG22203.1|  Ras-related Rab7                                        293   2e-97    Gossypium arboreum [tree cotton]
ref|XP_009353621.1|  PREDICTED: ras-related protein Rab7-like           293   2e-97    Pyrus x bretschneideri [bai li]
ref|NP_001269169.1|  ras-related protein Rab-7b                         293   2e-97    Cucumis sativus [cucumbers]
ref|XP_010249722.1|  PREDICTED: ras-related protein Rab7                293   2e-97    Nelumbo nucifera [Indian lotus]
sp|Q40787.1|RAB7_CENCI  RecName: Full=Ras-related protein Rab7          293   3e-97    Cenchrus ciliaris [African foxtail grass]
gb|KHN39776.1|  Ras-related protein Rab7                                292   3e-97    Glycine soja [wild soybean]
ref|XP_011037540.1|  PREDICTED: ras-related protein Rab7                293   3e-97    Populus euphratica
ref|XP_010548050.1|  PREDICTED: ras-related protein Rab7-like           293   3e-97    Tarenaya hassleriana [spider flower]
emb|CBI32577.3|  unnamed protein product                                295   3e-97    Vitis vinifera
emb|CDO98034.1|  unnamed protein product                                293   3e-97    Coffea canephora [robusta coffee]
gb|AJD79413.1|  small GTP-binding protein                               293   4e-97    Aeluropus lagopoides
ref|XP_003568099.1|  PREDICTED: ras-related protein Rab7-like           293   4e-97    Brachypodium distachyon [annual false brome]
ref|NP_001238418.1|  uncharacterized protein LOC100305642               293   4e-97    Glycine max [soybeans]
ref|XP_007135678.1|  hypothetical protein PHAVU_010G149200g             293   4e-97    Phaseolus vulgaris [French bean]
emb|CDO97063.1|  unnamed protein product                                293   4e-97    Coffea canephora [robusta coffee]
emb|CAB39639.1|  rab7-like protein                                      293   5e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006475628.1|  PREDICTED: ras-related protein RABG3d-like i...    293   5e-97    Citrus sinensis [apfelsine]
ref|XP_011021948.1|  PREDICTED: ras-related protein Rab7-like           293   5e-97    Populus euphratica
ref|XP_004969959.1|  PREDICTED: ras-related protein Rab7-like           293   5e-97    Setaria italica
gb|ACJ83887.1|  unknown                                                 293   5e-97    Medicago truncatula
ref|XP_004507422.1|  PREDICTED: ras-related protein Rab7-like           293   5e-97    Cicer arietinum [garbanzo]
gb|KHG11476.1|  Ras-related Rab7                                        293   5e-97    Gossypium arboreum [tree cotton]
gb|AJG06867.1|  Rab GTPase                                              293   5e-97    Nicotiana benthamiana
ref|XP_003568095.1|  PREDICTED: ras-related protein Rab7                293   5e-97    Brachypodium distachyon [annual false brome]
gb|AFU91386.1|  small GTP binding protein                               292   6e-97    Arachis hypogaea [goober]
gb|EEC79597.1|  hypothetical protein OsI_20781                          292   6e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_011093588.1|  PREDICTED: ras-related protein Rab7                292   6e-97    Sesamum indicum [beniseed]
gb|AAV90623.1|  Rab7                                                    292   6e-97    Cenchrus americanus [bulrush millet]
ref|NP_001056046.1|  Os05g0516600                                       292   6e-97    
gb|ABQ65168.1|  Rab7                                                    292   7e-97    Prosopis juliflora [algorrobo]
ref|XP_011088375.1|  PREDICTED: ras-related protein Rab7                292   7e-97    Sesamum indicum [beniseed]
ref|XP_006451166.1|  hypothetical protein CICLE_v10009505mg             291   7e-97    
gb|KCW53703.1|  hypothetical protein EUGRSUZ_J02962                     291   7e-97    Eucalyptus grandis [rose gum]
gb|AFK41965.1|  unknown                                                 292   8e-97    Lotus japonicus
emb|CDX95493.1|  BnaC01g33850D                                          292   8e-97    
ref|XP_002883153.1|  hypothetical protein ARALYDRAFT_898258             292   8e-97    Arabidopsis lyrata subsp. lyrata
ref|XP_009112339.1|  PREDICTED: ras-related protein RABG3f-like i...    292   8e-97    Brassica rapa
ref|NP_001237217.1|  uncharacterized protein LOC100305824               292   8e-97    Glycine max [soybeans]
gb|EYU32929.1|  hypothetical protein MIMGU_mgv1a013930mg                292   8e-97    Erythranthe guttata [common monkey flower]
ref|XP_003537879.1|  PREDICTED: ras-related protein Rab7 isoformX1      292   9e-97    Glycine max [soybeans]
emb|CDY61984.1|  BnaC03g73830D                                          292   9e-97    Brassica napus [oilseed rape]
ref|XP_007217763.1|  hypothetical protein PRUPE_ppa011513mg             292   9e-97    Prunus persica
ref|XP_009374176.1|  PREDICTED: ras-related protein Rab7-like           292   9e-97    Pyrus x bretschneideri [bai li]
gb|EPS69035.1|  hypothetical protein M569_05734                         292   9e-97    Genlisea aurea
ref|XP_007048144.1|  RAB GTPase G3A                                     292   9e-97    
sp|P31022.1|RAB7_PEA  RecName: Full=Ras-related protein Rab7            292   1e-96    Pisum sativum [garden pea]
dbj|BAJ95468.1|  predicted protein                                      292   1e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008392063.1|  PREDICTED: ras-related protein Rab7                292   1e-96    
gb|AAA74118.1|  putative                                                292   1e-96    Nicotiana tabacum [American tobacco]
ref|XP_006451167.1|  hypothetical protein CICLE_v10009505mg             291   1e-96    
sp|O24461.1|RAB7_PRUAR  RecName: Full=Ras-related protein Rab7          291   1e-96    Prunus armeniaca
gb|KDP33678.1|  hypothetical protein JCGZ_07249                         291   1e-96    Jatropha curcas
ref|XP_011092778.1|  PREDICTED: ras-related protein Rab7-like           291   1e-96    Sesamum indicum [beniseed]
ref|XP_004486740.1|  PREDICTED: ras-related protein Rab7-like           291   1e-96    
ref|XP_010690900.1|  PREDICTED: ras-related protein Rab7                291   1e-96    Beta vulgaris subsp. vulgaris [field beet]
emb|CDX87890.1|  BnaC06g09520D                                          291   1e-96    
ref|NP_001169258.1|  hypothetical protein                               291   1e-96    Zea mays [maize]
ref|XP_009144857.1|  PREDICTED: ras-related protein RABG3d-like         291   1e-96    Brassica rapa
ref|XP_003604484.1|  Ras-related protein Rab7                           291   2e-96    Medicago truncatula
ref|XP_009589594.1|  PREDICTED: ras-related protein RABG3f              291   2e-96    Nicotiana tomentosiformis
ref|XP_008348511.1|  PREDICTED: ras-related protein Rab7                291   2e-96    
ref|XP_007200529.1|  hypothetical protein PRUPE_ppa011555mg             291   2e-96    Prunus persica
gb|EYU37787.1|  hypothetical protein MIMGU_mgv1a013928mg                291   2e-96    Erythranthe guttata [common monkey flower]
ref|NP_001274838.1|  uncharacterized protein LOC102577689               291   2e-96    Solanum tuberosum [potatoes]
ref|XP_002306097.1|  RAS-related GTP-binding family protein             291   2e-96    
ref|XP_002532185.1|  protein with unknown function                      291   2e-96    
ref|XP_004967425.1|  PREDICTED: ras-related protein Rab7-like           291   2e-96    Setaria italica
ref|NP_001190694.1|  RAB GTPase homolog G3A                             291   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009611771.1|  PREDICTED: ras-related protein Rab7                291   3e-96    Nicotiana tomentosiformis
ref|XP_007159766.1|  hypothetical protein PHAVU_002G265500g             291   3e-96    Phaseolus vulgaris [French bean]
gb|AJG06868.1|  Rab GTPase                                              291   3e-96    Nicotiana benthamiana
gb|KFK38961.1|  hypothetical protein AALP_AA3G182500                    291   3e-96    Arabis alpina [alpine rockcress]
ref|XP_010033868.1|  PREDICTED: ras-related protein Rab7-like           291   3e-96    Eucalyptus grandis [rose gum]
ref|XP_004235664.1|  PREDICTED: ras-related protein Rab7                290   3e-96    Solanum lycopersicum
ref|NP_001056165.1|  Os05g0536900                                       291   3e-96    
gb|AFK48509.1|  unknown                                                 290   3e-96    Lotus japonicus
ref|XP_007013164.1|  RAB GTPase G3D                                     290   3e-96    
gb|KJB70463.1|  hypothetical protein B456_011G074700                    290   4e-96    Gossypium raimondii
gb|EYU42624.1|  hypothetical protein MIMGU_mgv1a013915mg                290   4e-96    Erythranthe guttata [common monkey flower]
ref|XP_006451168.1|  hypothetical protein CICLE_v10009505mg             290   4e-96    Citrus clementina [clementine]
ref|XP_008649936.1|  PREDICTED: ras-related protein Rab7-like           290   4e-96    Zea mays [maize]
ref|XP_010503795.1|  PREDICTED: ras-related protein RABG3c-like         290   5e-96    Camelina sativa [gold-of-pleasure]
gb|EEC79531.1|  hypothetical protein OsI_20631                          290   5e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_009760995.1|  PREDICTED: ras-related protein RABG3f              290   5e-96    Nicotiana sylvestris
ref|NP_001154217.1|  RAB GTPase homolog G3A                             290   5e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003597752.1|  Ras-related protein Rab7                           290   5e-96    Medicago truncatula
ref|XP_008654528.1|  PREDICTED: hypothetical protein isoform X1         290   6e-96    Zea mays [maize]
ref|XP_009107142.1|  PREDICTED: ras-related protein RABG3d-like         290   6e-96    Brassica rapa
ref|XP_010551185.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    290   6e-96    
ref|XP_009135600.1|  PREDICTED: ras-related protein RABG3f-like         290   6e-96    Brassica rapa
ref|XP_009147699.1|  PREDICTED: ras-related protein RABG3d              290   6e-96    Brassica rapa
gb|KJB32489.1|  hypothetical protein B456_005G242800                    290   6e-96    Gossypium raimondii
gb|KJB79201.1|  hypothetical protein B456_013G037800                    290   6e-96    Gossypium raimondii
ref|XP_004299097.1|  PREDICTED: ras-related protein Rab7                290   7e-96    Fragaria vesca subsp. vesca
ref|XP_006298562.1|  hypothetical protein CARUB_v10014645mg             290   7e-96    Capsella rubella
ref|XP_009345733.1|  PREDICTED: ras-related protein Rab7                290   8e-96    Pyrus x bretschneideri [bai li]
ref|XP_006406560.1|  hypothetical protein EUTSA_v10021531mg             290   8e-96    Eutrema salsugineum [saltwater cress]
ref|NP_001042470.1|  Os01g0227300                                       290   9e-96    
gb|ACF81772.1|  unknown                                                 290   9e-96    Zea mays [maize]
ref|XP_010049675.1|  PREDICTED: ras-related protein Rab7-like           289   1e-95    Eucalyptus grandis [rose gum]
ref|XP_006643935.1|  PREDICTED: ras-related protein Rab7-like           289   1e-95    Oryza brachyantha
emb|CAA98170.1|  RAB7C                                                  289   1e-95    Lotus japonicus
emb|CDM82386.1|  unnamed protein product                                289   1e-95    Triticum aestivum [Canadian hard winter wheat]
gb|AAO67728.1|  small GTP binding protein                               289   1e-95    Oryza sativa Indica Group [Indian rice]
dbj|BAJ96120.1|  predicted protein                                      289   1e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK32858.1|  hypothetical protein AALP_AA6G296000                    289   1e-95    Arabis alpina [alpine rockcress]
gb|KJB18683.1|  hypothetical protein B456_003G064900                    289   2e-95    Gossypium raimondii
gb|AFK42743.1|  unknown                                                 289   2e-95    Lotus japonicus
ref|XP_003630119.1|  Ras-related protein Rab7                           289   2e-95    Medicago truncatula
ref|XP_003565900.1|  PREDICTED: ras-related protein Rab7                289   2e-95    Brachypodium distachyon [annual false brome]
gb|AFK36786.1|  unknown                                                 288   2e-95    Medicago truncatula
ref|NP_001150039.1|  ras-related protein Rab7                           288   2e-95    Zea mays [maize]
ref|XP_006406878.1|  hypothetical protein EUTSA_v10021533mg             288   2e-95    Eutrema salsugineum [saltwater cress]
gb|KHN29120.1|  Ras-related protein Rab7                                288   3e-95    Glycine soja [wild soybean]
gb|KJB32492.1|  hypothetical protein B456_005G242800                    288   3e-95    Gossypium raimondii
ref|XP_010534720.1|  PREDICTED: ras-related protein RABG3f              288   3e-95    Tarenaya hassleriana [spider flower]
ref|XP_007042217.1|  RAB GTPase G3F isoform 2                           287   3e-95    
ref|NP_188231.1|  RAB GTPase-like protein G3C                           288   4e-95    
ref|XP_002882978.1|  hypothetical protein ARALYDRAFT_479064             288   4e-95    
ref|XP_009800528.1|  PREDICTED: ras-related protein Rab7-like           287   5e-95    
ref|XP_010487455.1|  PREDICTED: ras-related protein RABG3c              287   6e-95    
ref|XP_006303286.1|  hypothetical protein CARUB_v10010068mg             289   6e-95    
ref|NP_565521.1|  RAB GTPase-like protein 7A                            288   6e-95    
gb|ABK15561.1|  small GTPase Rab2                                       287   7e-95    
ref|XP_003568013.1|  PREDICTED: ras-related protein Rab7-like           287   7e-95    
ref|XP_003525083.1|  PREDICTED: ras-related protein Rab7-like           287   8e-95    
ref|XP_003057987.1|  predicted protein                                  286   1e-94    
ref|NP_001242593.1|  uncharacterized protein LOC100787120               286   2e-94    
ref|XP_005847261.1|  hypothetical protein CHLNCDRAFT_35566              286   2e-94    
ref|NP_188512.1|  Ras-related protein RABG3f                            286   3e-94    
ref|XP_002501516.1|  ras-related gtp-binding protein                    286   3e-94    
ref|XP_004504012.1|  PREDICTED: ras-related protein Rab7-like           285   3e-94    
emb|CDY68571.1|  BnaC06g41280D                                          285   3e-94    
ref|XP_005651795.1|  Rab7/RabG-family small GTPase                      285   4e-94    
gb|KFK36023.1|  hypothetical protein AALP_AA4G067800                    285   5e-94    
ref|XP_010555333.1|  PREDICTED: ras-related protein RABG2-like is...    285   5e-94    
ref|XP_010472189.1|  PREDICTED: ras-related protein RABG2-like          285   7e-94    
ref|XP_010531417.1|  PREDICTED: ras-related protein RABG2               285   9e-94    
gb|KJB32491.1|  hypothetical protein B456_005G242800                    284   1e-93    
emb|CDY46234.1|  BnaCnng13850D                                          284   1e-93    
ref|XP_004961377.1|  PREDICTED: ras-related protein Rab7-like iso...    285   1e-93    
ref|XP_010479363.1|  PREDICTED: ras-related protein RABG3e-like         284   1e-93    
ref|XP_010461768.1|  PREDICTED: ras-related protein RABG3e              284   2e-93    
ref|XP_010416943.1|  PREDICTED: ras-related protein RABG2 isoform X1    284   2e-93    
ref|XP_010429106.1|  PREDICTED: ras-related protein RABG2-like          283   2e-93    
ref|XP_006393270.1|  hypothetical protein EUTSA_v10011767mg             283   2e-93    
ref|XP_002306355.1|  hypothetical protein POPTR_0005s08730g             283   3e-93    
ref|XP_010555331.1|  PREDICTED: ras-related protein RABG2-like is...    285   3e-93    
ref|XP_006654709.1|  PREDICTED: ras-related protein Rab7-like           283   3e-93    
ref|XP_001691181.1|  small rab-related GTPase                           283   4e-93    
ref|XP_011400596.1|  Ras-related protein Rab7                           290   4e-93    
gb|AAZ91462.1|  RAB7                                                    281   5e-93    
ref|XP_010688212.1|  PREDICTED: ras-related protein Rab7A               282   5e-93    
emb|CDX76964.1|  BnaC08g35500D                                          282   6e-93    
ref|XP_009117363.1|  PREDICTED: ras-related protein RABG2 isoform X1    282   6e-93    
ref|XP_006404641.1|  hypothetical protein EUTSA_v10000322mg             282   6e-93    
ref|XP_001784264.1|  Rab7/RabG-family small GTPase                      282   7e-93    
ref|XP_010500472.1|  PREDICTED: ras-related protein RABG3e-like         282   7e-93    
sp|P93267.1|RAB7_MESCR  RecName: Full=Ras-related protein Rab7A         282   8e-93    
ref|XP_009140310.1|  PREDICTED: ras-related protein RABG2-like          282   1e-92    
ref|XP_001763478.1|  Rab7/RabG-family small GTPase                      281   1e-92    
gb|AAM60858.1|  GTP binding protein, putative                           281   1e-92    
ref|XP_009107310.1|  PREDICTED: ras-related protein RABG3e              281   2e-92    
ref|XP_010667858.1|  PREDICTED: ras-related protein RABG3c              281   2e-92    
emb|CDX77257.1|  BnaC08g03020D                                          281   2e-92    
gb|KJB35050.1|  hypothetical protein B456_006G098100                    280   4e-92    
gb|KDO45864.1|  hypothetical protein CISIN_1g028305mg                   280   9e-92    
ref|XP_004148452.1|  PREDICTED: ras-related protein Rab7-like           279   1e-91    
ref|XP_008457907.1|  PREDICTED: ras-related protein Rab7-like           279   1e-91    
ref|NP_175355.1|  RAB GTPase homolog G3E                                279   1e-91    
ref|XP_006427978.1|  hypothetical protein CICLE_v10026484mg             279   1e-91    
ref|XP_010089429.1|  Ras-related protein Rab7                           280   2e-91    
gb|KJB32488.1|  hypothetical protein B456_005G242800                    278   2e-91    
ref|XP_002880403.1|  hypothetical protein ARALYDRAFT_481052             278   2e-91    
ref|XP_006582994.1|  PREDICTED: ras-related protein Rab7-like iso...    279   2e-91    
ref|XP_010645814.1|  PREDICTED: ras-related protein Rab7 isoform X2     277   3e-91    
gb|KJB32490.1|  hypothetical protein B456_005G242800                    277   4e-91    
emb|CDP12884.1|  unnamed protein product                                276   2e-90    
ref|XP_011001607.1|  PREDICTED: ras-related protein Rab7                275   4e-90    
ref|XP_001769909.1|  Rab7/RabG-family small GTPase                      275   5e-90    
ref|XP_002304199.1|  hypothetical protein POPTR_0003s05230g             275   5e-90    
gb|KCW71068.1|  hypothetical protein EUGRSUZ_F04166                     275   6e-90    
gb|EMT22668.1|  Ras-related protein Rab7                                275   7e-90    
gb|EYU24050.1|  hypothetical protein MIMGU_mgv1a022149mg                274   8e-90    
gb|AAA74119.1|  putative                                                274   9e-90    
ref|XP_010455367.1|  PREDICTED: ras-related protein RABG3a-like         272   4e-89    
ref|XP_010098071.1|  Ras-related protein Rab7                           270   1e-88    
ref|XP_010924745.1|  PREDICTED: ras-related protein Rab7-like iso...    270   2e-88    
sp|P36864.1|YPTV5_VOLCA  RecName: Full=GTP-binding protein yptV5        270   3e-88    
gb|EFA74910.1|  Rab GTPase                                              270   4e-88    
dbj|GAM28079.1|  hypothetical protein SAMD00019534_112550               270   6e-88    
ref|XP_002299707.1|  Ras-related GTP-binding family protein             270   6e-88    
ref|XP_002457090.1|  hypothetical protein SORBIDRAFT_03g001085          270   7e-88    
ref|XP_645911.1|  Rab GTPase                                            268   1e-87    
ref|XP_010096185.1|  Ras-related protein Rab7                           268   2e-87    
gb|EMS52758.1|  Ras-related protein Rab7                                267   2e-87    
ref|XP_003288620.1|  hypothetical protein DICPUDRAFT_92126              268   2e-87    
ref|XP_008338652.1|  PREDICTED: ras-related protein Rab7-like           268   2e-87    
ref|XP_010086929.1|  Ras-related protein Rab7                           268   4e-87    
gb|EMT06597.1|  Ras-related protein Rab7                                266   6e-87    
ref|XP_005833366.1|  hypothetical protein GUITHDRAFT_152339             266   8e-87    
gb|KDE03538.1|  Ras-like protein Rab-7a                                 266   1e-86    
gb|AFW78721.1|  hypothetical protein ZEAMMB73_253903                    266   1e-86    
gb|AAT39219.1|  putative GTPase                                         265   2e-86    
ref|XP_007512342.1|  unknown                                            265   2e-86    
ref|XP_011010163.1|  PREDICTED: ras-related protein Rab7-like           265   2e-86    
ref|XP_009764141.1|  PREDICTED: ras-related protein Rab7 isoform X2     265   3e-86    
ref|XP_006295011.1|  hypothetical protein CARUB_v10024082mg             264   7e-86    
ref|XP_006416165.1|  hypothetical protein EUTSA_v10008896mg             261   1e-85    
gb|EMS56035.1|  Ras-related protein Rab7                                263   1e-85    
ref|NP_001118357.1|  RAB GTPase-like protein 7A                         263   2e-85    
emb|CDS07106.1|  Putative Ras-like protein Rab7                         263   2e-85    
ref|XP_007217762.1|  hypothetical protein PRUPE_ppa011513mg             262   3e-85    
gb|KHN38231.1|  Ras-related protein Rab7                                263   3e-85    
gb|KJB28942.1|  hypothetical protein B456_005G076500                    261   4e-85    
gb|KHG29098.1|  Ras-related Rab7                                        263   4e-85    
ref|XP_001554031.1|  GTPase Rab7                                        261   8e-85    
emb|CEP16385.1|  hypothetical protein                                   261   9e-85    
ref|XP_009112347.1|  PREDICTED: ras-related protein RABG3f-like i...    261   9e-85    
ref|XP_009629178.1|  PREDICTED: ras-related protein Rab7-like iso...    261   9e-85    
gb|ERZ95109.1|  hypothetical protein GLOINDRAFT_341407                  261   1e-84    
gb|ESZ98388.1|  putative Rab small monomeric GTPase Rab7                261   1e-84    
gb|EPB92205.1|  Ras-like protein Rab7                                   261   2e-84    
ref|XP_007674321.1|  hypothetical protein BAUCODRAFT_23209              261   2e-84    
emb|CEG64951.1|  Putative Vacuolar biogenesis protein                   261   2e-84    
ref|XP_007042218.1|  RAB GTPase G3F isoform 3                           259   2e-84    
ref|XP_008730132.1|  hypothetical protein G647_07596                    260   2e-84    
gb|KDQ19730.1|  hypothetical protein BOTBODRAFT_152205                  260   2e-84    
gb|EUC65480.1|  Rab small monomeric GTPase                              260   3e-84    
ref|XP_009629177.1|  PREDICTED: ras-related protein Rab7-like iso...    261   3e-84    
ref|XP_007760804.1|  Ras-like protein Rab7                              260   3e-84    
emb|CDH49194.1|  probable gtpase rab7 protein                           260   3e-84    
ref|XP_008077693.1|  P-loop containing nucleoside triphosphate hy...    260   4e-84    
gb|KDQ30579.1|  hypothetical protein PLEOSDRAFT_1053760                 259   4e-84    
ref|XP_007288970.1|  ras-related protein-like protein                   259   5e-84    
emb|CDH49017.1|  rab small monomeric gtpase                             259   5e-84    
emb|CEL58228.1|  Ras-related protein Rab-7a OS=Canis familiaris G...    259   5e-84    
gb|KIW33779.1|  hypothetical protein PV07_00603                         259   6e-84    
ref|XP_007001020.1|  hypothetical protein TREMEDRAFT_42329              259   6e-84    
gb|KIW85999.1|  hypothetical protein Z517_01393                         259   6e-84    
ref|XP_006696898.1|  rab small monomeric GTPase-like protein            259   6e-84    
ref|XP_007860204.1|  hypothetical protein GLOTRDRAFT_30516              259   7e-84    
gb|AAP13582.1|AF407337_1  Ras-related protein Rab7                      259   7e-84    
gb|KIK04287.1|  hypothetical protein K443DRAFT_676046                   259   7e-84    
gb|KDQ63853.1|  hypothetical protein JAAARDRAFT_29900                   259   7e-84    
ref|XP_001873286.1|  predicted protein                                  259   7e-84    
gb|KIW60359.1|  hypothetical protein PV05_00584                         259   7e-84    
ref|XP_002390448.1|  hypothetical protein MPER_10266                    259   8e-84    
ref|XP_003037096.1|  hypothetical protein SCHCODRAFT_72805              259   8e-84    
gb|EIE86939.1|  vacuolar biogenesis protein                             259   8e-84    
gb|KIW40197.1|  hypothetical protein PV06_07415                         259   8e-84    
gb|KDR85204.1|  hypothetical protein GALMADRAFT_233890                  259   8e-84    
ref|XP_001828916.1|  RAB small monomeric GTPase                         259   9e-84    
gb|KII93461.1|  hypothetical protein PLICRDRAFT_100219                  259   9e-84    
gb|KIP12632.1|  hypothetical protein PHLGIDRAFT_17667                   259   9e-84    
gb|ACI33008.1|  Ras-related protein Rab-7a                              259   9e-84    
ref|XP_007763290.1|  hypothetical protein CONPUDRAFT_114884             259   1e-83    
gb|KFX86757.1|  hypothetical protein V490_08873                         259   1e-83    
ref|XP_007378481.1|  hypothetical protein PUNSTDRAFT_48509              258   1e-83    
ref|XP_007265626.1|  hypothetical protein FOMMEDRAFT_19344              258   1e-83    
gb|EMD41676.1|  hypothetical protein CERSUDRAFT_79308                   258   1e-83    
gb|KIY69657.1|  hypothetical protein CYLTODRAFT_420477                  258   1e-83    
gb|KHJ30019.1|  putative ras-like protein rab7                          258   1e-83    
gb|KIO30772.1|  hypothetical protein M407DRAFT_242036                   258   1e-83    
gb|AFW83742.2|  hypothetical protein ZEAMMB73_052378                    258   1e-83    
ref|XP_007312720.1|  hypothetical protein SERLADRAFT_455120             258   1e-83    
ref|XP_009803444.1|  PREDICTED: ras-related protein Rab7-like iso...    258   1e-83    
ref|XP_567629.1|  RAB small monomeric GTPase                            258   1e-83    
ref|XP_007586997.1|  putative rab small monomeric gtpase protein        258   2e-83    
gb|KEQ81474.1|  ras-related protein-like protein                        258   2e-83    
gb|KFY09191.1|  hypothetical protein V491_08344                         258   2e-83    
gb|KJA26133.1|  hypothetical protein HYPSUDRAFT_37015                   258   2e-83    
gb|ELR10626.1|  Ras-like protein Rab7                                   258   2e-83    
ref|NP_001140557.1|  hypothetical protein                               258   2e-83    
gb|AFR94117.1|  RAB small monomeric GTPase                              258   2e-83    
ref|XP_007390352.1|  hypothetical protein PHACADRAFT_247132             258   2e-83    
gb|EMS22715.1|  Ras-related protein Rab-7A                              258   2e-83    
ref|XP_007594490.1|  Ras-like protein Rab7                              258   2e-83    
ref|XP_009541373.1|  hypothetical protein HETIRDRAFT_413792             258   2e-83    
ref|XP_006454515.1|  hypothetical protein AGABI2DRAFT_133199            258   2e-83    
gb|EKG15620.1|  Ras GTPase                                              258   2e-83    
gb|KIW03878.1|  hypothetical protein PV09_05173                         258   2e-83    
ref|XP_003050527.1|  predicted protein                                  258   2e-83    
gb|KHO00342.1|  Ras-related protein Rab7                                258   2e-83    
ref|XP_007274041.1|  rab small monomeric gtpase                         258   2e-83    
gb|EPT04167.1|  hypothetical protein FOMPIDRAFT_1021900                 258   2e-83    
gb|KIJ68762.1|  hypothetical protein HYDPIDRAFT_81983                   258   2e-83    
gb|KIM48003.1|  hypothetical protein M413DRAFT_439699                   258   2e-83    
gb|KIY45374.1|  hypothetical protein FISHEDRAFT_76555                   258   2e-83    
gb|KIJ21453.1|  hypothetical protein PAXINDRAFT_64035                   258   2e-83    
ref|XP_007024172.1|  RAB GTPase G3D isoform 2                           256   2e-83    
gb|KIK47882.1|  hypothetical protein CY34DRAFT_147157                   258   2e-83    
ref|XP_006678151.1|  hypothetical protein BATDEDRAFT_87536              258   2e-83    
ref|XP_007721689.1|  Ras-like protein Rab7                              258   3e-83    
gb|KIJ45488.1|  hypothetical protein M422DRAFT_250807                   258   3e-83    
gb|KIM34254.1|  hypothetical protein M408DRAFT_92908                    258   3e-83    
ref|XP_009269712.1|  Ras-related protein Rab-7a                         258   3e-83    
gb|KIM84585.1|  hypothetical protein PILCRDRAFT_96728                   258   3e-83    
gb|ELU11591.1|  hypothetical protein CAPTEDRAFT_21782                   258   3e-83    
ref|XP_007307505.1|  hypothetical protein STEHIDRAFT_123821             257   3e-83    
gb|KFH46945.1|  Ras-related protein-like protein                        257   3e-83    
ref|XP_007842349.1|  rab small monomeric gtpase                         257   4e-83    
emb|CDO72399.1|  hypothetical protein BN946_scf184977.g98               259   4e-83    
gb|EPS64447.1|  hypothetical protein M569_10334                         258   4e-83    
ref|XP_961487.1|  GTP-binding protein ypt7                              257   4e-83    
gb|ADE10079.1|  Rab7                                                    257   4e-83    
ref|XP_006958085.1|  hypothetical protein WALSEDRAFT_32360              257   4e-83    
gb|KFH73739.1|  Ras-like protein Rab7                                   257   4e-83    
gb|ACN11449.1|  Ras-related protein Rab-7a                              257   4e-83    
ref|XP_003006258.1|  GTP-binding protein ypt7                           257   4e-83    
gb|KEQ67602.1|  ras-related protein-like protein                        257   4e-83    
ref|XP_007880882.1|  hypothetical protein PFL1_05161                    257   5e-83    
gb|EJT99059.1|  hypothetical protein DACRYDRAFT_24137                   257   5e-83    
ref|XP_006464493.1|  PREDICTED: ras-related protein Rab7-like iso...    257   5e-83    
gb|KIV92927.1|  hypothetical protein PV10_04183                         257   5e-83    
ref|XP_003661446.1|  hypothetical protein MYCTH_2300844                 257   5e-83    
ref|XP_007789049.1|  putative ras-like protein rab7 protein             257   5e-83    
ref|XP_011058274.1|  PREDICTED: ras-related protein Rab-7a              257   5e-83    
ref|XP_009803443.1|  PREDICTED: ras-related protein Rab7-like iso...    257   5e-83    
ref|XP_011433497.1|  PREDICTED: ras-related protein Rab-7a              257   5e-83    
ref|XP_007834203.1|  Ras-related protein Rab7                           257   5e-83    
gb|KEF53105.1|  Ras-like protein Rab7                                   257   5e-83    
emb|CCE28550.1|  probable GTPase Rab7 protein                           256   5e-83    
ref|XP_001229066.1|  hypothetical protein CHGG_02550                    257   6e-83    
ref|XP_001239602.1|  conserved hypothetical protein                     257   6e-83    
ref|XP_002567766.1|  Pc21g07250                                         257   6e-83    
ref|XP_001824054.1|  Ras-related protein Rab7                           257   6e-83    
ref|XP_009216461.1|  Ras-like protein Rab7                              257   6e-83    
ref|XP_011141319.1|  PREDICTED: ras-related protein Rab-7a              257   6e-83    
ref|XP_011162103.1|  PREDICTED: ras-related protein Rab-7a              257   6e-83    
ref|XP_011268779.1|  PREDICTED: ras-related protein Rab-7a              257   6e-83    
ref|XP_007733469.1|  Ras-like protein Rab7                              256   6e-83    
ref|XP_001398680.2|  Ras-related protein Rab7                           256   6e-83    
ref|NP_001116983.1|  rab7 GTPase homolog SUrab7                         256   7e-83    
gb|EMF13665.1|  hypothetical protein SEPMUDRAFT_148889                  256   7e-83    
gb|EFZ16723.1|  hypothetical protein SINV_13124                         256   7e-83    
ref|XP_001911098.1|  hypothetical protein                               256   7e-83    



>gb|KJB59527.1| hypothetical protein B456_009G259500 [Gossypium raimondii]
Length=205

 Score =   330 bits (845),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSMRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWHDEFLKQANPADP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHDEFLKQANPADPRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG +PYFETSAKEDINVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNMPYFETSAKEDINVDAA  168



>ref|XP_009628178.1| PREDICTED: ras-related protein Rab7 [Nicotiana tomentosiformis]
Length=204

 Score =   329 bits (843),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/168 (93%), Positives = 163/168 (97%), Gaps = 1/168 (1%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSMRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVMRSFDNLDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDNLDNWHEEFLKQANPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAKEWC+SKG IPYFETSAKEDINVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKEWCASKG-IPYFETSAKEDINVDAA  167



>ref|XP_004237840.1| PREDICTED: ras-related protein Rab7 [Solanum lycopersicum]
 ref|XP_006359018.1| PREDICTED: ras-related protein Rab7-like [Solanum tuberosum]
Length=204

 Score =   328 bits (842),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/168 (93%), Positives = 163/168 (97%), Gaps = 1/168 (1%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSIRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVMRSFDNLDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDNLDNWHEEFLKQANPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAKEWC+SKG IPYFETSAKEDINVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKEWCTSKG-IPYFETSAKEDINVDAA  167



>ref|XP_009606119.1| PREDICTED: ras-related protein Rab7-like [Nicotiana tomentosiformis]
Length=204

 Score =   328 bits (842),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/168 (93%), Positives = 163/168 (97%), Gaps = 1/168 (1%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMN+YVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSMRRRTLLKVIVLGDSGVGKTSLMNRYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVMRSFDNLDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDNLDNWHEEFLKQANPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAKEWCSSKG IPYFETSAKEDINVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKEWCSSKG-IPYFETSAKEDINVDAA  167



>ref|XP_011074118.1| PREDICTED: ras-related protein Rab7 [Sesamum indicum]
Length=205

 Score =   328 bits (840),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVMRSFD LDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDTLDNWHEEFLKQANPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAKEWC+SKG IPYFETSAKED NVD A
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKEWCASKGNIPYFETSAKEDYNVDPA  168



>ref|XP_009763630.1| PREDICTED: ras-related protein Rab7-like [Nicotiana sylvestris]
Length=204

 Score =   327 bits (839),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 163/168 (97%), Gaps = 1/168 (1%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMN+YVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSMRRRTLLKVIVLGDSGVGKTSLMNRYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVMRSFDNLDNWH+EFLKQ+NP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDNLDNWHEEFLKQSNPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAKEWCSSKG IPYFETSAKEDINVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKEWCSSKG-IPYFETSAKEDINVDAA  167



>gb|AAA74120.1| putative [Nicotiana tabacum]
Length=204

 Score =   327 bits (839),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/168 (93%), Positives = 163/168 (97%), Gaps = 1/168 (1%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMN+YVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSMRRRTLLKVIVLGDSGVGKTSLMNRYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVMRSFDNLDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDNLDNWHEEFLKQANPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAKEWCSSKG IPYFETSAKEDINVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKEWCSSKG-IPYFETSAKEDINVDAA  167



>emb|CDP01135.1| unnamed protein product [Coffea canephora]
Length=205

 Score =   327 bits (838),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVMRSFD LDNWH+EFL+QANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDTLDNWHEEFLRQANPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAKEWC+SKG IPYFETSAKED NVDA+
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKEWCASKGNIPYFETSAKEDYNVDAS  168



>gb|EYU36545.1| hypothetical protein MIMGU_mgv1a013950mg [Erythranthe guttata]
Length=205

 Score =   327 bits (837),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVMRSFD LDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDTLDNWHEEFLKQANPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNKID+DGGNSRVVSEKKAKEWC+SKG IPYFETSAKED NVD A
Sbjct  121  VLLGNKIDIDGGNSRVVSEKKAKEWCASKGNIPYFETSAKEDYNVDPA  168



>emb|CAA98168.1| RAB7A [Lotus japonicus]
Length=205

 Score =   326 bits (836),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWH+EFLKQANP+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHEEFLKQANPSDPRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDYNVDAA  168



>ref|XP_002527104.1| protein with unknown function [Ricinus communis]
 gb|EEF35267.1| protein with unknown function [Ricinus communis]
Length=205

 Score =   325 bits (834),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 154/168 (92%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSVRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVMRSFD LDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDALDNWHEEFLKQANPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAKEWC+SKG IPYFETSAKED NVD A
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKEWCASKGNIPYFETSAKEDYNVDPA  168



>ref|NP_001235371.1| uncharacterized protein LOC100499740 [Glycine max]
 gb|ACU13453.1| unknown [Glycine max]
Length=206

 Score =   325 bits (834),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD L+NWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLENWHEEFLKQANPPDPRAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDYNVDAA  168



>gb|KHN17053.1| Ras-related protein Rab7 [Glycine soja]
Length=206

 Score =   325 bits (834),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD L+NWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLENWHEEFLKQANPPDPRAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDYNVDAA  168



>ref|XP_010063810.1| PREDICTED: ras-related protein Rab7 [Eucalyptus grandis]
 gb|KCW71067.1| hypothetical protein EUGRSUZ_F04166 [Eucalyptus grandis]
Length=205

 Score =   325 bits (834),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSVRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWHDEFLKQANPADP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHDEFLKQANPADPRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKA++WC++KG IPYFETSAKED+NVDA+
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKARDWCAAKGNIPYFETSAKEDVNVDAS  168



>ref|XP_007201851.1| hypothetical protein PRUPE_ppa011579mg [Prunus persica]
 ref|XP_008237447.1| PREDICTED: ras-related protein Rab7 [Prunus mume]
 gb|EMJ03050.1| hypothetical protein PRUPE_ppa011579mg [Prunus persica]
Length=205

 Score =   325 bits (832),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD L+NWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLENWHEEFLKQANPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCTSKGNIPYFETSAKEDYNVDAA  168



>ref|XP_007143599.1| hypothetical protein PHAVU_007G085200g [Phaseolus vulgaris]
 gb|ESW15593.1| hypothetical protein PHAVU_007G085200g [Phaseolus vulgaris]
Length=206

 Score =   325 bits (832),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+ YDVNVM+SFD LDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLAYDVNVMKSFDTLDNWHEEFLKQANPPDPRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDFNVDAA  168



>gb|KJB59938.1| hypothetical protein B456_009G286800 [Gossypium raimondii]
 gb|KJB59939.1| hypothetical protein B456_009G286800 [Gossypium raimondii]
Length=205

 Score =   324 bits (831),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M++RRRTLLKVIVLGDS VGKTSLMNQYVHKKFSQQYKATIGADFVTKELQI+D+ +TLQ
Sbjct  1    MAMRRRTLLKVIVLGDSAVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIEDRLLTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD+LDNWHDEFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDSLDNWHDEFLKQANPTDPRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKEDINVDAA
Sbjct  121  MLLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDINVDAA  168



>ref|XP_003556176.1| PREDICTED: ras-related protein Rab7 [Glycine max]
 sp|Q43463.1|RAB7_SOYBN RecName: Full=Ras-related protein Rab7 [Glycine max]
 gb|AAA34004.1| Rab7p [Glycine max]
 gb|KHN03703.1| Ras-related protein Rab7 [Glycine soja]
Length=206

 Score =   324 bits (831),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD L+NWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLENWHEEFLKQANPPDPRAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC++KG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCAAKGNIPYFETSAKEDYNVDAA  168



>sp|Q41640.1|RAB7_VIGAC RecName: Full=Ras-related protein Rab7 [Vigna aconitifolia]
 gb|AAA34242.1| Rab7p [Vigna aconitifolia]
Length=206

 Score =   324 bits (831),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGD+GVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDTGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+ YDVNVM+SFD LDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLAYDVNVMKSFDTLDNWHEEFLKQANPPDPRSFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDFNVDAA  168



>ref|XP_009342702.1| PREDICTED: ras-related protein Rab7 [Pyrus x bretschneideri]
Length=207

 Score =   324 bits (831),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHEEFLKQANPTDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVD A
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDYNVDGA  168



>ref|XP_010243311.1| PREDICTED: ras-related protein Rab7 [Nelumbo nucifera]
Length=206

 Score =   324 bits (830),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSVRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            +WDTAGQERFQSLGVAFYRGADCCV+VYDVNV+RSFD LDNWH+EFLKQA+P+DP  FPF
Sbjct  61   VWDTAGQERFQSLGVAFYRGADCCVLVYDVNVLRSFDTLDNWHEEFLKQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNK+D+DGGNSRVVSEKKAK+WC+SKG+IPYFETSAKED NVDAA
Sbjct  121  ILLGNKVDIDGGNSRVVSEKKAKDWCASKGSIPYFETSAKEDYNVDAA  168



>ref|XP_006434552.1| hypothetical protein CICLE_v10002522mg [Citrus clementina]
 ref|XP_006473152.1| PREDICTED: ras-related protein Rab7-like [Citrus sinensis]
 gb|ESR47792.1| hypothetical protein CICLE_v10002522mg [Citrus clementina]
Length=204

 Score =   323 bits (829),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +2

Query  119  RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIWD  298
            RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQIWD
Sbjct  3    RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQIWD  62

Query  299  TAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFILL  478
            TAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWH+EFLKQANPADP  FPFILL
Sbjct  63   TAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHEEFLKQANPADPRTFPFILL  122

Query  479  GNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            GNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED+NVDAA
Sbjct  123  GNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDVNVDAA  167



>ref|XP_003636326.1| Ras-related protein Rab7 [Medicago truncatula]
Length=221

 Score =   324 bits (831),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+LRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MALRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWH+EFLKQANP++P+ FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHEEFLKQANPSNPSTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNK+D+DGGNSRVVS+KKAK+WC+SKG +PYFETSAKED+NVDAA
Sbjct  121  ILLGNKVDIDGGNSRVVSDKKAKDWCASKGNVPYFETSAKEDLNVDAA  168



>gb|ACU24093.1| unknown [Glycine max]
Length=206

 Score =   323 bits (829),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD L+NWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLENWHEEFLKQANPPDPRAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNK+D+DGGNSRVVSEKKAK+WC++KG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKVDIDGGNSRVVSEKKAKDWCAAKGNIPYFETSAKEDYNVDAA  168



>ref|XP_008337228.1| PREDICTED: ras-related protein Rab7-like [Malus domestica]
Length=207

 Score =   323 bits (829),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHEEFLKQANPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVD A
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDYNVDGA  168



>ref|XP_010261069.1| PREDICTED: ras-related protein Rab7-like isoform X5 [Nelumbo 
nucifera]
Length=206

 Score =   323 bits (829),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSVRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV+RSFD LDNWH+EFLKQA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVLRSFDTLDNWHEEFLKQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKA++WC+S+G IPYFETSAKED+NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKARDWCASRGNIPYFETSAKEDLNVDAA  168



>gb|ACJ84198.1| unknown [Medicago truncatula]
Length=221

 Score =   324 bits (830),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+LRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MALRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWH+EFLKQANP++P+ FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHEEFLKQANPSNPSTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNK+D+DGGNSRVVS+KKAK+WC+SKG +PYFETSAKED+NVDAA
Sbjct  121  ILLGNKVDIDGGNSRVVSDKKAKDWCASKGNVPYFETSAKEDLNVDAA  168



>ref|XP_003636325.1| Ras-related protein Rab7 [Medicago truncatula]
Length=206

 Score =   323 bits (828),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+LRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MALRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWH+EFLKQANP++P+ FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHEEFLKQANPSNPSTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNK+D+DGGNSRVVS+KKAK+WC+SKG +PYFETSAKED+NVDAA
Sbjct  121  ILLGNKVDIDGGNSRVVSDKKAKDWCASKGNVPYFETSAKEDLNVDAA  168



>ref|XP_002264356.1| PREDICTED: ras-related protein Rab7 isoform X1 [Vitis vinifera]
 ref|XP_010645813.1| PREDICTED: ras-related protein Rab7 isoform X1 [Vitis vinifera]
 emb|CBI29350.3| unnamed protein product [Vitis vinifera]
Length=205

 Score =   323 bits (827),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSARRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVMRSFD LDNWH+EFLKQANP+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDTLDNWHEEFLKQANPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVS+KKA++WC+SKG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSKKKAEDWCASKGNIPYFETSAKEDYNVDAA  168



>ref|XP_004290467.1| PREDICTED: ras-related protein Rab7 [Fragaria vesca subsp. vesca]
Length=205

 Score =   323 bits (827),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+LRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MALRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD L+NWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLENWHEEFLKQANPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDYNVDAA  168



>ref|XP_008361208.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein Rab7-like 
[Malus domestica]
Length=207

 Score =   323 bits (827),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWH+EFLKQA+P DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHEEFLKQABPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVD A
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDYNVDGA  168



>ref|XP_004139780.1| PREDICTED: ras-related protein Rab7-like [Cucumis sativus]
 ref|XP_004161772.1| PREDICTED: ras-related protein Rab7-like [Cucumis sativus]
 ref|XP_008447759.1| PREDICTED: ras-related protein Rab7 isoform X1 [Cucumis melo]
 gb|KGN44144.1| hypothetical protein Csa_7G206950 [Cucumis sativus]
Length=205

 Score =   323 bits (827),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSFRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWHDEFL+QANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHDEFLRQANPPDPRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKA+EWC+SK  IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAREWCASKENIPYFETSAKEDYNVDAA  168



>ref|XP_002300895.1| hypothetical protein POPTR_0002s06310g [Populus trichocarpa]
 gb|ABK95304.1| unknown [Populus trichocarpa]
 gb|EEE80168.1| hypothetical protein POPTR_0002s06310g [Populus trichocarpa]
Length=205

 Score =   322 bits (826),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSTRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVMRSFD LDNWH+EFLKQA P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDTLDNWHEEFLKQATPSDPRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVD A
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDYNVDPA  168



>ref|XP_007019678.1| RAB GTPase G3A isoform 1 [Theobroma cacao]
 gb|EOY16903.1| RAB GTPase G3A isoform 1 [Theobroma cacao]
Length=205

 Score =   322 bits (825),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKE+QIDD+ VTLQ
Sbjct  1    MSVRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKEVQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHEEFLKQANPTDPRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVS+KKA EWC+SKG IPYFETSAKEDINVD A
Sbjct  121  ILLGNKIDIDGGNSRVVSDKKANEWCASKGKIPYFETSAKEDINVDHA  168



>ref|XP_010681464.1| PREDICTED: ras-related protein Rab7 [Beta vulgaris subsp. vulgaris]
Length=205

 Score =   322 bits (824),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSTRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWHDEFLKQANP D   FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHDEFLKQANPPDTKAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKA++WC+S+G IPYFETSAKEDINVD A
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKARDWCASRGNIPYFETSAKEDINVDGA  168



>gb|KJB28941.1| hypothetical protein B456_005G076500 [Gossypium raimondii]
Length=205

 Score =   322 bits (824),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVH KF+QQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSMRRRTLLKVIVLGDSGVGKTSLMNQYVHMKFTQQYKATIGADFVTKELQIDDRDVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD+LDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDSLDNWHEEFLKQANPTDPRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKIDVDGGN+RVVSEKKAK+WC+SK  IPYFETSAKEDINVDAA
Sbjct  121  ILLGNKIDVDGGNTRVVSEKKAKDWCASKENIPYFETSAKEDINVDAA  168



>ref|XP_004489906.1| PREDICTED: ras-related protein Rab7-like [Cicer arietinum]
Length=205

 Score =   322 bits (824),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLR+RTLLKVIVLGDSGVGKTSLMNQYVH KFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRKRTLLKVIVLGDSGVGKTSLMNQYVHNKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD L+NWH+EFLKQANP+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLENWHEEFLKQANPSDPRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCTSKGNIPYFETSAKEDYNVDAA  168



>gb|AFU92144.1| small GTP binding protein [Arachis hypogaea]
Length=205

 Score =   321 bits (823),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 162/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSMRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD+L+NWH+EFLKQANP+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDSLENWHEEFLKQANPSDPRMFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
             +LGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVDAA
Sbjct  121  TVLGNKIDIDGGNSRVVSEKKAKDWCTSKGNIPYFETSAKEDYNVDAA  168



>gb|KDP36048.1| hypothetical protein JCGZ_10014 [Jatropha curcas]
Length=205

 Score =   321 bits (823),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSVRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVMRSFD L+NWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDALENWHEEFLKQANPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPY+ETSAKED NVD A
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYYETSAKEDYNVDPA  168



>gb|ACU17616.1| unknown [Glycine max]
Length=206

 Score =   321 bits (823),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGAD VTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADSVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD L+NWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLENWHEEFLKQANPPDPRAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC++KG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCAAKGNIPYFETSAKEDYNVDAA  168



>gb|KJB28940.1| hypothetical protein B456_005G076500 [Gossypium raimondii]
Length=213

 Score =   321 bits (823),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVH KF+QQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSMRRRTLLKVIVLGDSGVGKTSLMNQYVHMKFTQQYKATIGADFVTKELQIDDRDVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD+LDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDSLDNWHEEFLKQANPTDPRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKIDVDGGN+RVVSEKKAK+WC+SK  IPYFETSAKEDINVDAA
Sbjct  121  ILLGNKIDVDGGNTRVVSEKKAKDWCASKENIPYFETSAKEDINVDAA  168



>ref|XP_004496410.1| PREDICTED: ras-related protein Rab7-like [Cicer arietinum]
Length=206

 Score =   320 bits (821),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVH KFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHNKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD+LDNWH+EFLKQANP D   FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDSLDNWHEEFLKQANPPDTRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDYNVDAA  168



>ref|XP_011026316.1| PREDICTED: ras-related protein Rab7 [Populus euphratica]
Length=205

 Score =   320 bits (820),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSARRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWH+EFLKQA P++P  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHEEFLKQATPSNPRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVD A
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDYNVDPA  168



>gb|EPS71938.1| hypothetical protein M569_02820 [Genlisea aurea]
Length=205

 Score =   318 bits (816),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 160/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSVRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCC++VYDVNV++SFD LDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCILVYDVNVLKSFDALDNWHEEFLKQANPPDPKKFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +L+GNK+DVDGGNSRVVSEKKAKEWC+SKG IPYFETSAKED NVD A
Sbjct  121  MLVGNKVDVDGGNSRVVSEKKAKEWCASKGDIPYFETSAKEDYNVDPA  168



>ref|XP_010261068.1| PREDICTED: ras-related protein RABA4a-like isoform X4 [Nelumbo 
nucifera]
Length=384

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSVRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV+RSFD LDNWH+EFLKQA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVLRSFDTLDNWHEEFLKQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKA++WC+S+G IPYFETSAKED+NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKARDWCASRGNIPYFETSAKEDLNVDAA  168



>ref|XP_010261066.1| PREDICTED: ras-related protein RABA4a-like isoform X3 [Nelumbo 
nucifera]
Length=394

 Score =   325 bits (833),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSVRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV+RSFD LDNWH+EFLKQA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVLRSFDTLDNWHEEFLKQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKA++WC+S+G IPYFETSAKED+NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKARDWCASRGNIPYFETSAKEDLNVDAA  168



>ref|XP_010261065.1| PREDICTED: uncharacterized protein LOC104599986 isoform X2 [Nelumbo 
nucifera]
Length=398

 Score =   325 bits (832),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSVRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV+RSFD LDNWH+EFLKQA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVLRSFDTLDNWHEEFLKQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKA++WC+S+G IPYFETSAKED+NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKARDWCASRGNIPYFETSAKEDLNVDAA  168



>gb|AFK34363.1| unknown [Medicago truncatula]
Length=206

 Score =   318 bits (814),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+LRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MALRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWH+EFLKQANP +P+ FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHEEFLKQANPFNPSTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNK+D+DGGNSRVV +KKAKEWC+SKG +PYFET AKED+NVDAA
Sbjct  121  ILLGNKVDIDGGNSRVVFDKKAKEWCASKGNVPYFETFAKEDLNVDAA  168



>ref|XP_009335165.1| PREDICTED: ras-related protein Rab7 [Pyrus x bretschneideri]
Length=206

 Score =   318 bits (814),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  116  LRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIW  295
            LRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQIW
Sbjct  2    LRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQIW  61

Query  296  DTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFIL  475
            DTAGQERFQSLGV+FYRGADCCV+VYDVNVM+SFD LDNWH+EFLKQANP DP  FPFIL
Sbjct  62   DTAGQERFQSLGVSFYRGADCCVLVYDVNVMKSFDTLDNWHEEFLKQANPPDPKTFPFIL  121

Query  476  LGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            LGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKED NVD A
Sbjct  122  LGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDYNVDGA  167



>ref|XP_010935166.1| PREDICTED: ras-related protein Rab7 [Elaeis guineensis]
Length=205

 Score =   318 bits (814),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKE+ +DD+ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKEILVDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV+RSFD LDNWH+EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVLRSFDTLDNWHEEFLNQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKIDVDGGNSRVVSEKKAKEWC+SKG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDVDGGNSRVVSEKKAKEWCASKGNIPYFETSAKEDYNVDAA  168



>ref|XP_008447760.1| PREDICTED: ras-related protein Rab7 isoform X2 [Cucumis melo]
Length=203

 Score =   317 bits (813),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  116  LRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIW  295
            ++RRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQIW
Sbjct  1    MKRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQIW  60

Query  296  DTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFIL  475
            DTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWHDEFL+QANP DP  FPFIL
Sbjct  61   DTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHDEFLRQANPPDPRTFPFIL  120

Query  476  LGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            LGNKID+DGGNSRVVSEKKA+EWC+SK  IPYFETSAKED NVDAA
Sbjct  121  LGNKIDIDGGNSRVVSEKKAREWCASKENIPYFETSAKEDYNVDAA  166



>ref|XP_003636324.1| Ras-related protein Rab7 [Medicago truncatula]
Length=209

 Score =   317 bits (813),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 164/171 (96%), Gaps = 3/171 (2%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQY---VHKKFSQQYKATIGADFVTKELQIDDQHV  280
            M+LRRRTLLKVIVLGDSGVGKTSLMNQY   VHKKFSQQYKATIGADFVTKELQIDD+ V
Sbjct  1    MALRRRTLLKVIVLGDSGVGKTSLMNQYPLYVHKKFSQQYKATIGADFVTKELQIDDRLV  60

Query  281  TLQIWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTG  460
            TLQIWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD LDNWH+EFLKQANP++P+ 
Sbjct  61   TLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLDNWHEEFLKQANPSNPST  120

Query  461  FPFILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            FPFILLGNK+D+DGGNSRVVS+KKAK+WC+SKG +PYFETSAKED+NVDAA
Sbjct  121  FPFILLGNKVDIDGGNSRVVSDKKAKDWCASKGNVPYFETSAKEDLNVDAA  171



>ref|XP_010261064.1| PREDICTED: uncharacterized protein LOC104599986 isoform X1 [Nelumbo 
nucifera]
Length=407

 Score =   325 bits (832),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 163/168 (97%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSVRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV+RSFD LDNWH+EFLKQA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVLRSFDTLDNWHEEFLKQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKA++WC+S+G IPYFETSAKED+NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKARDWCASRGNIPYFETSAKEDLNVDAA  168



>gb|KHG00821.1| Ras-related Rab7 [Gossypium arboreum]
Length=203

 Score =   317 bits (812),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 161/168 (96%), Gaps = 2/168 (1%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M++RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQI+D+ VTLQ
Sbjct  1    MAMRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIEDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
              DTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD+LDNWHDEFLKQANP DP  FPF
Sbjct  61   --DTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDSLDNWHDEFLKQANPTDPRTFPF  118

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNKID+DGGNSRVVSEKKAK+WC+SKG IPYFETSAKEDINVDAA
Sbjct  119  MLLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDINVDAA  166



>gb|KEH43618.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=207

 Score =   317 bits (812),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MSLRRRTLLKVIVLGDSGVGKTSLMNQYVH KFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHNKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+ YDVNVMRSFD+LD WH+EFLKQANP D   FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLAYDVNVMRSFDSLDTWHEEFLKQANPPDTRAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKA +WC+SKG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKANDWCASKGNIPYFETSAKEDYNVDAA  168



>ref|XP_002307527.1| hypothetical protein POPTR_0005s22070g [Populus trichocarpa]
 gb|ABK95455.1| unknown [Populus trichocarpa]
 gb|EEE94523.1| hypothetical protein POPTR_0005s22070g [Populus trichocarpa]
Length=205

 Score =   317 bits (811),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRRTLLKVIVLGDSG GKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSARRRTLLKVIVLGDSGAGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCC +VYDVNVMRSFD LDNWH+EFLKQANP+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCALVYDVNVMRSFDTLDNWHEEFLKQANPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG I YFETSAKED NVD A
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNILYFETSAKEDYNVDPA  168



>ref|XP_009410766.1| PREDICTED: ras-related protein Rab7-like [Musa acuminata subsp. 
malaccensis]
Length=205

 Score =   317 bits (811),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVHKKF+QQYKATIGADFVTKE+ +DD+ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFTQQYKATIGADFVTKEILVDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV RSFD LDNWHDEFL QA+P+DPT FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVRRSFDTLDNWHDEFLNQASPSDPTTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKIDVDGGNSRVVSEKKAKEWC+S+G +PYFETSAKED NVDAA
Sbjct  121  ILLGNKIDVDGGNSRVVSEKKAKEWCASRGNMPYFETSAKEDYNVDAA  168



>ref|XP_011044829.1| PREDICTED: ras-related protein Rab7-like [Populus euphratica]
Length=205

 Score =   317 bits (811),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/168 (89%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRRTLLKVIVLGDSG GKTSLMNQYVHKKFSQQYKATIGADFVTKEL IDD+ VTLQ
Sbjct  1    MSARRRTLLKVIVLGDSGAGKTSLMNQYVHKKFSQQYKATIGADFVTKELLIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVMRSFD LDNWH+EFLKQANP+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMRSFDTLDNWHEEFLKQANPSDPKAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+SKG I YFETSAKED NVD A
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASKGNILYFETSAKEDYNVDLA  168



>ref|XP_008812295.1| PREDICTED: ras-related protein Rab7 [Phoenix dactylifera]
Length=205

 Score =   315 bits (808),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 148/168 (88%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKE+ +DD+ VTLQ
Sbjct  1    MASRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKEILVDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCC +VYDVNV+RSFD LDNWH+EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCALVYDVNVLRSFDTLDNWHEEFLNQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKIDVDGGNSRVVSEKKAKEWC+SKG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDVDGGNSRVVSEKKAKEWCASKGNIPYFETSAKEDYNVDAA  168



>gb|AFK43592.1| unknown [Lotus japonicus]
Length=205

 Score =   315 bits (807),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 149/168 (89%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRRTLLKVIVLGDSGVGKTSLMNQYVHK+FSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSTRRRTLLKVIVLGDSGVGKTSLMNQYVHKRFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGV+FYRGADCCV+VYDVNVMRSFD LD WH+EFLKQANP D   FPF
Sbjct  61   IWDTAGQERFQSLGVSFYRGADCCVLVYDVNVMRSFDTLDTWHEEFLKQANPPDTRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKA +WC SKG IPYFETSAKED NVDAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKANDWCVSKGNIPYFETSAKEDYNVDAA  168



>ref|XP_006842165.1| hypothetical protein AMTR_s00078p00147080 [Amborella trichopoda]
 gb|ERN03840.1| hypothetical protein AMTR_s00078p00147080 [Amborella trichopoda]
Length=205

 Score =   313 bits (802),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYV+KKFS QYKATIGADFVTKELQI+D+ VTLQ
Sbjct  1    MSMRRRTLLKVIVLGDSGVGKTSLMNQYVNKKFSHQYKATIGADFVTKELQIEDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV++SFDNLDNWH+EFL QA+P DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVLKSFDNLDNWHEEFLNQASPPDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKAK+WC+S G IPYFETSAKED NVD A
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAKDWCASNGNIPYFETSAKEDYNVDPA  168



>ref|XP_010521112.1| PREDICTED: ras-related protein Rab7 [Tarenaya hassleriana]
Length=205

 Score =   311 bits (798),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMN+YV+ KFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSMRRRTLLKVIVLGDSGVGKTSLMNRYVNNKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN ++SFD+LDNWH+EFLKQANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNFIKSFDSLDNWHEEFLKQANPPDPEAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKA+EWC++KG +PYFETSAKED NVD+ 
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKAREWCAAKGRMPYFETSAKEDYNVDSG  168



>ref|XP_010543071.1| PREDICTED: ras-related protein RABG3a [Tarenaya hassleriana]
Length=206

 Score =   309 bits (792),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M++RRRTLLKVIVLGDSGVGKTSLMN+YVH KFSQQYKATIGADFVTKELQI+D+ VTLQ
Sbjct  1    MAMRRRTLLKVIVLGDSGVGKTSLMNRYVHNKFSQQYKATIGADFVTKELQIEDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +VYDVNVMRSFD LDNWH+EFLKQANP+DP  FPF
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDVNVMRSFDTLDNWHEEFLKQANPSDPKSFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNK+D+DGG+SRVVS+KKA +WC+SKG IPYFETSAKED NVD A
Sbjct  121  ILLGNKVDIDGGSSRVVSDKKALDWCASKGNIPYFETSAKEDYNVDEA  168



>emb|CAA98169.1| RAB7B [Lotus japonicus]
Length=205

 Score =   309 bits (791),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRRTLLKVIVLGDSGVGKTSLMNQYVHK+FSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSTRRRTLLKVIVLGDSGVGKTSLMNQYVHKRFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGV+FYRGADCCV+VYDVNVMRSFD LD WH+EFLKQANP D   FPF
Sbjct  61   IWDTAGQERFQSLGVSFYRGADCCVLVYDVNVMRSFDTLDTWHEEFLKQANPPDTRTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKID+DGGNSRVVSEKKA +WC SKG IPYFETSAKED   DAA
Sbjct  121  ILLGNKIDIDGGNSRVVSEKKANDWCVSKGNIPYFETSAKEDYIGDAA  168



>ref|XP_009110129.1| PREDICTED: ras-related protein RABG3b [Brassica rapa]
Length=205

 Score =   306 bits (785),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRR+LLKVIVLGDSGVGKTSLMNQYV+ KFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSMRRRSLLKVIVLGDSGVGKTSLMNQYVNNKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN ++SFD+LDNWH+EFLKQA+P DPT FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNYLKSFDSLDNWHEEFLKQASPRDPTAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNK+D+DGGNSRVVSEKKA+EWC+ KG I Y+ETSAKED NVD +
Sbjct  121  ILLGNKVDIDGGNSRVVSEKKAREWCAQKGNICYYETSAKEDYNVDES  168



>ref|XP_006416164.1| hypothetical protein EUTSA_v10008896mg [Eutrema salsugineum]
 gb|ESQ34517.1| hypothetical protein EUTSA_v10008896mg [Eutrema salsugineum]
Length=176

 Score =   305 bits (781),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVIVLGDSGVGKTSLMNQYV+ KFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSIRRRTLLKVIVLGDSGVGKTSLMNQYVNNKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG+AFYRGADCCV+VYDVN ++SFD+LDNWH+EFLKQA+P DPT FPF
Sbjct  61   IWDTAGQERFQSLGIAFYRGADCCVLVYDVNHLKSFDSLDNWHEEFLKQASPRDPTAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVD  607
            ILLGNK+D+DGGNSRVVSEKKA+ WC+ KG I YFETSAKED NVD
Sbjct  121  ILLGNKVDIDGGNSRVVSEKKARAWCAEKGNILYFETSAKEDYNVD  166



>ref|XP_006303560.1| hypothetical protein CARUB_v10011037mg [Capsella rubella]
 gb|EOA36458.1| hypothetical protein CARUB_v10011037mg [Capsella rubella]
Length=206

 Score =   306 bits (783),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 156/166 (94%), Gaps = 0/166 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVI+LGDSGVGKTSLMNQYV+ KFSQQYKATIGADFVTKELQ+DD+ VTLQ
Sbjct  1    MSMRRRTLLKVILLGDSGVGKTSLMNQYVNNKFSQQYKATIGADFVTKELQVDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN ++SFD+LDNWHDEFLKQA+P DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNYLKSFDSLDNWHDEFLKQASPRDPKAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVD  607
            ILLGNK+D+DGGNSRVVSEKKA+EWC+ KG I YFETSAKED NVD
Sbjct  121  ILLGNKVDIDGGNSRVVSEKKAREWCAEKGNIVYFETSAKEDYNVD  166



>ref|XP_010460036.1| PREDICTED: ras-related protein RABG3b [Camelina sativa]
Length=206

 Score =   304 bits (779),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 156/167 (93%), Gaps = 0/167 (0%)
 Frame = +2

Query  113  SLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQI  292
            S+RRRTLLKVIVLGDSGVGKTSLMNQYV+ KFSQQYKATIGADFVTKELQ+DD+ VTLQI
Sbjct  3    SMRRRTLLKVIVLGDSGVGKTSLMNQYVNNKFSQQYKATIGADFVTKELQVDDRLVTLQI  62

Query  293  WDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFI  472
            WDTAGQERFQSLGVAFYRGADCCV+VYDVN ++SFD+LDNWHDEFLKQA+P DP  FPFI
Sbjct  63   WDTAGQERFQSLGVAFYRGADCCVLVYDVNYLKSFDSLDNWHDEFLKQASPRDPNAFPFI  122

Query  473  LLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            L+GNK+D+DGGNSRVVSEKKA+EWC+ KG I YFETSAKED NVD +
Sbjct  123  LVGNKVDIDGGNSRVVSEKKAREWCAEKGNIVYFETSAKEDYNVDES  169



>emb|CDY41473.1| BnaA08g20750D [Brassica napus]
Length=205

 Score =   304 bits (778),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRR+LLKVIVLGDSGVGKTSLMNQYV  KFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSMRRRSLLKVIVLGDSGVGKTSLMNQYVSNKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN ++SFD+LDNWH+EFLKQA+P DPT FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNYLKSFDSLDNWHEEFLKQASPRDPTAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNK+D+DGGNSRVVSEKKA+EWC+  G I Y+ETSAKED NVD +
Sbjct  121  ILLGNKVDIDGGNSRVVSEKKAREWCAQMGNICYYETSAKEDYNVDES  168



>emb|CAN62813.1| hypothetical protein VITISV_031882 [Vitis vinifera]
Length=205

 Score =   303 bits (777),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+  RRTLLKVIVLGDSGVGKTSLMNQYV+KKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MAAPRRTLLKVIVLGDSGVGKTSLMNQYVYKKFSQQYKATIGADFVTKELQIDDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            +WDTAGQERFQSLG AFYRGADCCV+VYDVNV++SF++L +WH+EFLKQA+PA+P  FPF
Sbjct  61   LWDTAGQERFQSLGSAFYRGADCCVLVYDVNVLKSFESLQSWHEEFLKQADPAEPEXFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSE++A+EWC+S+G IPYFETSAKED NVDAA
Sbjct  121  VVLGNKVDVDGGNSRVVSERRAREWCASRGDIPYFETSAKEDFNVDAA  168



>emb|CDX91688.1| BnaC08g06070D [Brassica napus]
Length=205

 Score =   303 bits (777),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRR+LLKVIVLGDSGVGKTSLMNQYV  KFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSMRRRSLLKVIVLGDSGVGKTSLMNQYVSNKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN ++SFD+LDNWH+EFLKQA+P DPT FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNYLKSFDSLDNWHEEFLKQASPRDPTAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNK+D+DGGNSRVVSEKKA+EWC+ K  I Y+ETSAKED NVD +
Sbjct  121  ILLGNKVDIDGGNSRVVSEKKAREWCAQKENICYYETSAKEDYNVDES  168



>ref|NP_001044060.1| Os01g0714900 [Oryza sativa Japonica Group]
 dbj|BAD87568.1| putative rab7 protein [Oryza sativa Japonica Group]
 dbj|BAF05974.1| Os01g0714900 [Oryza sativa Japonica Group]
 dbj|BAG99278.1| unnamed protein product [Oryza sativa Japonica Group]
Length=207

 Score =   303 bits (775),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  119  RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIWD  298
            RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKE+ I+D+ VTLQIWD
Sbjct  5    RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKEVLIEDRLVTLQIWD  64

Query  299  TAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFILL  478
            TAGQERFQSLGVAFYRGADCCV+VYDVN  RSFD L+ WHDEFL QA+P+DP  FPFILL
Sbjct  65   TAGQERFQSLGVAFYRGADCCVLVYDVNSNRSFDTLNTWHDEFLNQASPSDPKTFPFILL  124

Query  479  GNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            GNKIDVDGG SRVVSEKKA EWCSSKG IPYFETSAKED NVD+A
Sbjct  125  GNKIDVDGGKSRVVSEKKAMEWCSSKGNIPYFETSAKEDRNVDSA  169



>ref|XP_002890529.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66788.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=205

 Score =   303 bits (775),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 155/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+RRRTLLKVI+LGDSGVGKTSLMNQYV+ KFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSIRRRTLLKVIILGDSGVGKTSLMNQYVNNKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN ++SFD+LDNWH EFLK+A+P DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNYLKSFDSLDNWHAEFLKRASPRDPMAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVD  607
            ILLGNK+DVDGGNSRVVSEKKA+EWC+ KG I YFETSAKE+ NVD
Sbjct  121  ILLGNKVDVDGGNSRVVSEKKAREWCAEKGNIVYFETSAKENYNVD  166



>gb|KDP35265.1| hypothetical protein JCGZ_09424 [Jatropha curcas]
Length=207

 Score =   302 bits (774),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS + R LLKVIVLGDSGVGKTSLMNQYV+KKFSQQYKATIGADFVTKELQ+DD+ VTLQ
Sbjct  3    MSTKGRALLKVIVLGDSGVGKTSLMNQYVYKKFSQQYKATIGADFVTKELQVDDKLVTLQ  62

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCCV+VYDVNV+RSF+ L+NWH+EFLKQA+P DP  FPF
Sbjct  63   IWDTAGQERFQSLGAAFYRGADCCVLVYDVNVLRSFETLNNWHEEFLKQADPIDPDAFPF  122

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNKIDVDGGNSRVVS+KKA +WC SKG IPYFETSAKED NVD A
Sbjct  123  ILLGNKIDVDGGNSRVVSQKKAMDWCVSKGNIPYFETSAKEDYNVDEA  170



>ref|XP_007207890.1| hypothetical protein PRUPE_ppa021084mg [Prunus persica]
 gb|EMJ09089.1| hypothetical protein PRUPE_ppa021084mg [Prunus persica]
Length=207

 Score =   302 bits (774),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            +S++RRTLLKVIVLGDSGVGKTSLMNQYV+KKF +QYKATIGADFVTKELQIDD+ VTLQ
Sbjct  3    ISMKRRTLLKVIVLGDSGVGKTSLMNQYVYKKFHRQYKATIGADFVTKELQIDDKLVTLQ  62

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            +WDTAGQERF SLG AFYRGADCCV+VYDVNV +SF+ L NWH+EFLKQA+P DP  FPF
Sbjct  63   VWDTAGQERFHSLGAAFYRGADCCVLVYDVNVSKSFETLQNWHEEFLKQADPTDPEAFPF  122

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNKIDVDGGNSR VSEKKA+EWC+SKG IPYFETSAKED NVD A
Sbjct  123  VLLGNKIDVDGGNSRAVSEKKAREWCASKGNIPYFETSAKEDYNVDEA  170



>ref|XP_002279477.1| PREDICTED: ras-related protein Rab7 isoform X2 [Vitis vinifera]
 emb|CBI21523.3| unnamed protein product [Vitis vinifera]
Length=205

 Score =   302 bits (774),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 159/168 (95%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+  RRTLLKVIVLGDSGVGKTSLMNQYV+KKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MAAPRRTLLKVIVLGDSGVGKTSLMNQYVYKKFSQQYKATIGADFVTKELQIDDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            +WDTAGQERFQSLG AFYRGADCCV+VYDVNV++SF++L +WH+EFLKQA+PA+P  FPF
Sbjct  61   LWDTAGQERFQSLGSAFYRGADCCVLVYDVNVLKSFESLQSWHEEFLKQADPAEPEVFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSE++A+EWC+S+G IPYFETSAKED NVDAA
Sbjct  121  VVLGNKVDVDGGNSRVVSERRAREWCASRGDIPYFETSAKEDFNVDAA  168



>ref|XP_006644616.1| PREDICTED: ras-related protein Rab7-like [Oryza brachyantha]
Length=207

 Score =   302 bits (774),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 152/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  119  RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIWD  298
            RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKE+ I+D+ VTLQIWD
Sbjct  5    RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKEVLIEDRLVTLQIWD  64

Query  299  TAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFILL  478
            TAGQERFQSLGVAFYRGADCCV+VYDVN  RSFD L+ WHDEFL QA+P+DP  FPFILL
Sbjct  65   TAGQERFQSLGVAFYRGADCCVLVYDVNANRSFDTLNTWHDEFLNQASPSDPKTFPFILL  124

Query  479  GNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            GNKIDVDGG SRVVSEKKA EWC+SKG IPYFETSAKED NVD+A
Sbjct  125  GNKIDVDGGKSRVVSEKKAMEWCASKGNIPYFETSAKEDRNVDSA  169



>ref|XP_002872458.1| AtRABG3a [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48717.1| AtRABG3a [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   302 bits (774),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFS QYKATIGADFVTKELQI ++ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSMQYKATIGADFVTKELQIGEKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +VYDVNV+RSFDNL+ WH+EFLKQA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDVNVLRSFDNLETWHEEFLKQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNK+DVDGG+SRVVSEKKA +WC+S G IPYFETSAKED NVD A
Sbjct  121  IVLGNKVDVDGGSSRVVSEKKAADWCASNGNIPYFETSAKEDFNVDEA  168



>gb|KEH43617.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=234

 Score =   303 bits (775),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 157/195 (81%), Gaps = 27/195 (14%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSG---------------------------VGKTSLMNQYVHKKF  208
            MSLRRRTLLKVIVLGDSG                           VGKTSLMNQYVH KF
Sbjct  1    MSLRRRTLLKVIVLGDSGYVPFSLLSLQYRFFHSNHAFSFIFIARVGKTSLMNQYVHNKF  60

Query  209  SQQYKATIGADFVTKELQIDDQHVTLQIWDTAGQERFQSLGVAFYRGADCCVMVYDVNVM  388
            SQQYKATIGADFVTKELQIDD+ VTLQIWDTAGQERFQSLGVAFYRGADCCV+ YDVNVM
Sbjct  61   SQQYKATIGADFVTKELQIDDRLVTLQIWDTAGQERFQSLGVAFYRGADCCVLAYDVNVM  120

Query  389  RSFDNLDNWHDEFLKQANPADPTGFPFILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIP  568
            RSFD+LD WH+EFLKQANP D   FPFILLGNKID+DGGNSRVVSEKKA +WC+SKG IP
Sbjct  121  RSFDSLDTWHEEFLKQANPPDTRAFPFILLGNKIDIDGGNSRVVSEKKANDWCASKGNIP  180

Query  569  YFETSAKEDINVDAA  613
            YFETSAKED NVDAA
Sbjct  181  YFETSAKEDYNVDAA  195



>ref|XP_002973800.1| rab family GTPase [Selaginella moellendorffii]
 ref|XP_002983596.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ15497.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ24755.1| rab family GTPase [Selaginella moellendorffii]
Length=207

 Score =   301 bits (772),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 157/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ R+RTLLK I+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q++D+ VT+Q
Sbjct  1    MASRKRTLLKAIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQVEDRLVTMQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNLDNW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLDNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKED NV+AA
Sbjct  121  IVLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEDYNVEAA  168



>ref|XP_010438119.1| PREDICTED: ras-related protein RABG3a [Camelina sativa]
Length=206

 Score =   301 bits (771),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFS QYKATIGADFVTKELQI ++ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSLQYKATIGADFVTKELQIGEKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +VYDVNV++SFDNL+ WH+EFLKQA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDVNVLKSFDNLETWHEEFLKQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNK+DVDGG+SRVVSEKKA +WC+S G IPYFETSAKED NVD A
Sbjct  121  IVLGNKVDVDGGSSRVVSEKKAADWCASNGNIPYFETSAKEDFNVDEA  168



>ref|XP_006288671.1| hypothetical protein CARUB_v10001979mg [Capsella rubella]
 gb|EOA21569.1| hypothetical protein CARUB_v10001979mg [Capsella rubella]
Length=206

 Score =   301 bits (771),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFS QYKATIGADFVTKELQI ++ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSLQYKATIGADFVTKELQIGEKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +VYDVNV+RSFDNL+ WH+EFLKQA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDVNVLRSFDNLETWHEEFLKQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNK+DVDGG+SRVVSEKKA +WC++ G IPYFETSAKED NVD A
Sbjct  121  IVLGNKVDVDGGSSRVVSEKKAADWCAANGNIPYFETSAKEDFNVDEA  168



>gb|KFK44364.1| hypothetical protein AALP_AA1G247900 [Arabis alpina]
Length=205

 Score =   301 bits (770),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS+R+RTLLKVI+LGDSGVGKTSLMNQYV+ KFSQQYKATIGADFVTKE+QIDD+ VTLQ
Sbjct  1    MSIRKRTLLKVIILGDSGVGKTSLMNQYVNNKFSQQYKATIGADFVTKEIQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN + SFD+LDNWHDEFL +A+P DP GFPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNYLNSFDSLDNWHDEFLNKASPRDPKGFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ILLGNK+D+DGGNSRVVSEKKA EWC  KG I YFETSAKED NVD A
Sbjct  121  ILLGNKVDIDGGNSRVVSEKKAGEWCGEKGNILYFETSAKEDYNVDDA  168



>ref|XP_004969742.1| PREDICTED: ras-related protein Rab7-like [Setaria italica]
Length=206

 Score =   301 bits (770),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  119  RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIWD  298
            RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKE+ I+D+ VTLQIWD
Sbjct  5    RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKEVLIEDRLVTLQIWD  64

Query  299  TAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFILL  478
            TAGQERFQSLGVAFYRGADCCV+VYDVN  RSFD L+ WHDEFL QA+P+DP  FPFILL
Sbjct  65   TAGQERFQSLGVAFYRGADCCVLVYDVNSNRSFDTLNTWHDEFLNQASPSDPKTFPFILL  124

Query  479  GNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            GNKIDVDGG SRVVSEKKA EWC+SKG IPYFETSAKED NVD A
Sbjct  125  GNKIDVDGGKSRVVSEKKAMEWCASKGNIPYFETSAKEDYNVDNA  169



>ref|XP_008232432.1| PREDICTED: ras-related protein Rab7 [Prunus mume]
 ref|XP_008226511.1| PREDICTED: ras-related protein Rab7-like [Prunus mume]
Length=207

 Score =   300 bits (769),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            +S++RRTLLKVIVLGDSGVGKTSLMNQYV+KKF +QYKATIGADFVTKELQIDD+ VTLQ
Sbjct  3    ISMKRRTLLKVIVLGDSGVGKTSLMNQYVYKKFHRQYKATIGADFVTKELQIDDKLVTLQ  62

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            +WDTAGQERF SLG AFYRG+DCCV+VYDVNV +SF+ L NWH+EFLKQA+P DP  FPF
Sbjct  63   VWDTAGQERFHSLGAAFYRGSDCCVLVYDVNVSKSFETLQNWHEEFLKQADPTDPEAFPF  122

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +L+GNKIDVDGGNSR VSEKKA+EWC+SKG IPYFETSAKED NVD A
Sbjct  123  VLIGNKIDVDGGNSRAVSEKKAREWCASKGNIPYFETSAKEDYNVDEA  170



>ref|XP_009399841.1| PREDICTED: ras-related protein Rab7-like [Musa acuminata subsp. 
malaccensis]
Length=208

 Score =   300 bits (768),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQIDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLLQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNKID+DGGNSRVVSEKKAK WC+SKG IPYFETSAKE +NV+AA
Sbjct  121  IVLGNKIDIDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGLNVEAA  168



>ref|NP_192710.1| RAB GTPase homolog G3A [Arabidopsis thaliana]
 sp|Q948K8.1|RAG3A_ARATH RecName: Full=Ras-related protein RABG3a; Short=AtRABG3a; AltName: 
Full=Ras-related protein Rab76; Short=AtRab76 [Arabidopsis 
thaliana]
 dbj|BAB68376.1| AtRab76 [Arabidopsis thaliana]
 dbj|BAF01041.1| AtRab76 [Arabidopsis thaliana]
 gb|ABL66760.1| At4g09720 [Arabidopsis thaliana]
 gb|AEE82783.1| RAB GTPase homolog G3A [Arabidopsis thaliana]
Length=206

 Score =   300 bits (767),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFS QYKATIGADFVTKELQI ++ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSMQYKATIGADFVTKELQIGEKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +VYDVNV+RSFDNL+ WH+EFLKQA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDVNVLRSFDNLETWHEEFLKQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNKIDVDGG+SRVVS+KKA +WC+S G IPYFETSAK+D NVD A
Sbjct  121  IVLGNKIDVDGGSSRVVSDKKAADWCASNGNIPYFETSAKDDFNVDEA  168



>ref|XP_006397152.1| hypothetical protein EUTSA_v10028966mg [Eutrema salsugineum]
 gb|ESQ38605.1| hypothetical protein EUTSA_v10028966mg [Eutrema salsugineum]
Length=206

 Score =   300 bits (767),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFS QYKATIGADFVTKE+QI D+ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSLQYKATIGADFVTKEIQIGDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +VYDVNV++SFD+L+NWH+EFLKQA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDVNVLKSFDSLENWHEEFLKQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNK+D+DGG+SRVVSEKKA +WC+S G IPYFETSAK+D NVD A
Sbjct  121  IVLGNKVDIDGGSSRVVSEKKAADWCASNGNIPYFETSAKQDYNVDEA  168



>dbj|BAJ99564.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CDM83781.1| unnamed protein product [Triticum aestivum]
Length=206

 Score =   300 bits (767),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  119  RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIWD  298
            RRRTLLKVIVLGDSGVGKTSLMNQYVH KFSQQYKATIGADFVTKE+ I+D+ VTLQIWD
Sbjct  5    RRRTLLKVIVLGDSGVGKTSLMNQYVHNKFSQQYKATIGADFVTKEVLIEDRLVTLQIWD  64

Query  299  TAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFILL  478
            TAGQERFQSLGVAFYRGADCCV+VYDVNV +SFD L+ WHDEFL QA+P+DP  FPFILL
Sbjct  65   TAGQERFQSLGVAFYRGADCCVLVYDVNVNKSFDTLNTWHDEFLNQASPSDPKTFPFILL  124

Query  479  GNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            GNKIDVDGG SRVVSEKKA EWCSSKG IPY+ETSAKED NVD A
Sbjct  125  GNKIDVDGGKSRVVSEKKAMEWCSSKGNIPYYETSAKEDYNVDEA  169



>ref|XP_003569676.1| PREDICTED: ras-related protein Rab7 [Brachypodium distachyon]
Length=206

 Score =   300 bits (767),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  119  RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIWD  298
            RRRTLLKVIVLGDSGVGKTSLMNQYVH KFSQQYKATIGADFVTKE+ I+D+ VTLQIWD
Sbjct  5    RRRTLLKVIVLGDSGVGKTSLMNQYVHNKFSQQYKATIGADFVTKEVLIEDRLVTLQIWD  64

Query  299  TAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFILL  478
            TAGQERFQSLGVAFYRGADCCV+VYDVNV RSFD L+ WHDEFL QA+P+DP  FPFILL
Sbjct  65   TAGQERFQSLGVAFYRGADCCVLVYDVNVNRSFDTLNTWHDEFLNQASPSDPKTFPFILL  124

Query  479  GNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            GNKIDVDGG SRVVSEKKA EWCSSKG IPY+ETSAKED NVD A
Sbjct  125  GNKIDVDGGKSRVVSEKKAIEWCSSKGNIPYYETSAKEDYNVDDA  169



>ref|XP_009113550.1| PREDICTED: ras-related protein RABG3a [Brassica rapa]
Length=206

 Score =   300 bits (767),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVH KFS QYKATIGADFVTKELQI D+ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHNKFSLQYKATIGADFVTKELQIGDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +VYD+NV +SFD+LDNWH+EFLKQANP+DP  FPF
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDLNVAKSFDSLDNWHEEFLKQANPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNK+D+DGG SRVVSEKKA +WC+S G IPYFETSAKED NVD A
Sbjct  121  IVLGNKVDIDGGRSRVVSEKKAADWCASNGNIPYFETSAKEDYNVDEA  168



>gb|KFK32051.1| hypothetical protein AALP_AA6G193700 [Arabis alpina]
Length=206

 Score =   299 bits (766),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVH KFS QYKATIGADFVTKELQI D+ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHNKFSLQYKATIGADFVTKELQIADKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +VYDVNV +SFD+L+NWH+EFLKQA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDVNVFKSFDSLENWHEEFLKQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNK+DVDGG+SRVVSEKKA +WC+S G IPYFETSAKED NVD A
Sbjct  121  IVLGNKVDVDGGSSRVVSEKKAADWCASNGNIPYFETSAKEDFNVDEA  168



>emb|CDY48910.1| BnaA09g22850D [Brassica napus]
Length=206

 Score =   299 bits (766),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVH KFS QYKATIGADFVTKELQI D+ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHNKFSLQYKATIGADFVTKELQIGDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +VYD+NV +SFD+LDNWH+EFLKQANP+DP  FPF
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDLNVSKSFDSLDNWHEEFLKQANPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNK+D+DGG SRVVSEKKA +WC+S G IPYFETSAKED NVD A
Sbjct  121  IVLGNKVDIDGGRSRVVSEKKAADWCASNGNIPYFETSAKEDYNVDEA  168



>ref|XP_010421879.1| PREDICTED: ras-related protein RABG3a-like [Camelina sativa]
Length=206

 Score =   299 bits (765),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVH KFS QYKATIGADFVTKELQI ++ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHNKFSLQYKATIGADFVTKELQIGEKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +VYDVNV++SFDNL+ WH+EFLKQA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDVNVLKSFDNLETWHEEFLKQASPSDPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNK+DVDGG+SRVVSEKKA +WC+S G IPYFETSAKED NVD A
Sbjct  121  IVLGNKVDVDGGSSRVVSEKKAADWCASNGNIPYFETSAKEDFNVDEA  168



>ref|XP_002458401.1| hypothetical protein SORBIDRAFT_03g032810 [Sorghum bicolor]
 gb|EES03521.1| hypothetical protein SORBIDRAFT_03g032810 [Sorghum bicolor]
Length=206

 Score =   299 bits (765),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  119  RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIWD  298
            RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKE+ I+D+ VTLQIWD
Sbjct  5    RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKEVLIEDRLVTLQIWD  64

Query  299  TAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFILL  478
            TAGQERFQSLGVAFYRGADCCV+VYDVN  RSFD L+ WHDEFL QA+P+DP  FPFILL
Sbjct  65   TAGQERFQSLGVAFYRGADCCVLVYDVNSNRSFDTLNTWHDEFLNQASPSDPKTFPFILL  124

Query  479  GNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            GNKIDVDGG SRVVS+KKA EWC+SKG IPYFETSAKED NVD A
Sbjct  125  GNKIDVDGGKSRVVSDKKAMEWCASKGNIPYFETSAKEDYNVDNA  169



>ref|XP_009336367.1| PREDICTED: ras-related protein Rab7 [Pyrus x bretschneideri]
Length=207

 Score =   299 bits (765),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +2

Query  113  SLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQI  292
            S++RRTLLKVIVLGDSGVGKTSLMNQYV+KKF++QYKATIGADFVTKELQIDD+ VTLQI
Sbjct  4    SMKRRTLLKVIVLGDSGVGKTSLMNQYVYKKFNRQYKATIGADFVTKELQIDDKLVTLQI  63

Query  293  WDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFI  472
            WDTAGQERF SLG AFYRG+DCCV+VYDVNV +SF+ L NWH+EFLKQA+P DP  FPFI
Sbjct  64   WDTAGQERFHSLGAAFYRGSDCCVLVYDVNVNKSFEALQNWHEEFLKQADPTDPAAFPFI  123

Query  473  LLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            LLGNKID+DGGNSR VSEKKA+EWC++KG IPYFETSAKED NVD A
Sbjct  124  LLGNKIDIDGGNSREVSEKKAREWCAAKGNIPYFETSAKEDYNVDEA  170



>ref|XP_004141770.1| PREDICTED: ras-related protein RABG3d-like isoform 1 [Cucumis 
sativus]
 gb|KGN45377.1| hypothetical protein Csa_7G446920 [Cucumis sativus]
Length=206

 Score =   299 bits (765),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q+DD+  TLQ
Sbjct  1    MASRRRILLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQLDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE +NVDAA
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGLNVDAA  168



>ref|NP_173688.1| GTP-binding protein Rab7 [Arabidopsis thaliana]
 sp|O04157.1|RAG3B_ARATH RecName: Full=Ras-related protein RABG3b; Short=AtRABG3b; AltName: 
Full=Ras-related protein Rab75; Short=AtRab75 [Arabidopsis 
thaliana]
 emb|CAA70951.1| GTP-binding protein Rab7 [Arabidopsis thaliana]
 emb|CAA72904.1| GTP-binding protein Rab7 [Arabidopsis thaliana]
 gb|AAC25512.1| Strong similaity to gb|Y09821 GTP-binding protein Rab7 from A. 
thaliana. EST gb|T76449 comes from this gene [Arabidopsis 
thaliana]
 dbj|BAB68375.1| AtRab75 [Arabidopsis thaliana]
 gb|ABD42987.1| At1g22740 [Arabidopsis thaliana]
 gb|AEE30279.1| GTP-binding protein Rab7 [Arabidopsis thaliana]
Length=203

 Score =   298 bits (764),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRRTLLKVI+LGDSGVGKTSLMNQYV+ KFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MSTRRRTLLKVIILGDSGVGKTSLMNQYVNNKFSQQYKATIGADFVTKELQIDDRLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN ++SF++LDNWH+EFL +A+P DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNHLKSFESLDNWHNEFLTRASPRDPMAFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVD  607
            ILLGNK+D+DGGNSRVVSEKKA+EWC+ KG I YFETSAKED NVD
Sbjct  121  ILLGNKVDIDGGNSRVVSEKKAREWCAEKGNIVYFETSAKEDYNVD  166



>ref|XP_004158989.1| PREDICTED: ras-related protein RABG3d-like isoform 1 [Cucumis 
sativus]
Length=206

 Score =   298 bits (764),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q+DD+  TLQ
Sbjct  1    MASRRRILLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQLDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE +NVDAA
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGLNVDAA  168



>gb|ABK23074.1| unknown [Picea sitchensis]
 gb|ABK26263.1| unknown [Picea sitchensis]
 gb|ACN40095.1| unknown [Picea sitchensis]
 gb|ACN40958.1| unknown [Picea sitchensis]
Length=206

 Score =   298 bits (764),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MSARRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV++SFDNL+NW DEFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVLKSFDNLNNWRDEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGFNVEAA  168



>gb|KHG02230.1| Ras-related Rab7 [Gossypium arboreum]
Length=208

 Score =   298 bits (763),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            +S++RRTLLKVIVLGDSGVGKTSLMNQYV+ KF+QQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  3    VSMKRRTLLKVIVLGDSGVGKTSLMNQYVYNKFNQQYKATIGADFVTKELQIDDKLVTLQ  62

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCCV+V+DVN++RSF+ L+NW +EFLKQA+P+DP  FPF
Sbjct  63   IWDTAGQERFQSLGSAFYRGADCCVIVFDVNILRSFETLNNWREEFLKQADPSDPESFPF  122

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I++GNKID+DGGNSR+VSEKKA++WC+S+G IPYFETSAKED NVD A
Sbjct  123  IVIGNKIDIDGGNSRMVSEKKARDWCASRGNIPYFETSAKEDYNVDEA  170



>ref|XP_011464793.1| PREDICTED: ras-related protein Rab7 [Fragaria vesca subsp. vesca]
Length=210

 Score =   298 bits (763),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +2

Query  113  SLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQI  292
            S++RRTLLKVIVLGDSGVGKTSLMNQYV+KKF +QYKATIGADFVTKELQIDD+ VTLQI
Sbjct  4    SMKRRTLLKVIVLGDSGVGKTSLMNQYVYKKFIRQYKATIGADFVTKELQIDDKLVTLQI  63

Query  293  WDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFI  472
            WDTAGQERF SLG AFYRGADCCV+VYDVNV++SF+ L NWH+EFLKQA+PAD   FPFI
Sbjct  64   WDTAGQERFHSLGAAFYRGADCCVLVYDVNVLKSFETLQNWHEEFLKQADPADTEAFPFI  123

Query  473  LLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            LLGNKID+DGGNSR VSE++A+EWC++KG IPYFETSAKED NVD A
Sbjct  124  LLGNKIDIDGGNSRAVSERRAQEWCAAKGNIPYFETSAKEDYNVDEA  170



>ref|XP_010027761.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein Rab7 [Eucalyptus 
grandis]
Length=206

 Score =   298 bits (763),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 154/166 (93%), Gaps = 0/166 (0%)
 Frame = +2

Query  116  LRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIW  295
            LRRRTLLKVIVLGDSGVGKTSLMNQYV+KKFSQQYKATIGADFVTKELQIDD+ VTLQ+W
Sbjct  4    LRRRTLLKVIVLGDSGVGKTSLMNQYVYKKFSQQYKATIGADFVTKELQIDDKLVTLQVW  63

Query  296  DTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFIL  475
            DTAGQERF SLG AFYRGADCCV+VYDVNV ++F++L NW +EFLKQA+PA P  FPF+L
Sbjct  64   DTAGQERFHSLGAAFYRGADCCVLVYDVNVGKTFESLSNWREEFLKQADPAXPEAFPFVL  123

Query  476  LGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            LGNKID+DGG+SRVVSEK+AKEWC+S+G IPYFETSAKED NVD A
Sbjct  124  LGNKIDIDGGHSRVVSEKRAKEWCASRGNIPYFETSAKEDYNVDEA  169



>ref|XP_008462166.1| PREDICTED: ras-related protein Rab7 [Cucumis melo]
Length=206

 Score =   298 bits (763),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q+DD+  TLQ
Sbjct  1    MASRRRILLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQLDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|XP_009409452.1| PREDICTED: ras-related protein Rab7 [Musa acuminata subsp. malaccensis]
Length=207

 Score =   298 bits (762),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q+DD+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQMDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNKID+DGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  IVLGNKIDIDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_009413819.1| PREDICTED: ras-related protein Rab7-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   298 bits (762),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQIDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNKID+DGGNSRVVS+KKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  IVLGNKIDIDGGNSRVVSQKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_010065394.1| PREDICTED: ras-related protein Rab7 [Eucalyptus grandis]
 gb|KCW62846.1| hypothetical protein EUGRSUZ_G00442 [Eucalyptus grandis]
Length=202

 Score =   298 bits (762),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q+DD+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQLDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE +NV+ A
Sbjct  121  VVIGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGVNVEEA  168



>ref|XP_010652865.1| PREDICTED: ras-related protein Rab7 isoform X1 [Vitis vinifera]
Length=206

 Score =   298 bits (762),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 159/169 (94%), Gaps = 1/169 (1%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+  RRTLLKVIVLGDSGVGKTSLMNQYV+KKFSQQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MAAPRRTLLKVIVLGDSGVGKTSLMNQYVYKKFSQQYKATIGADFVTKELQIDDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLK-QANPADPTGFP  466
            +WDTAGQERFQSLG AFYRGADCCV+VYDVNV++SF++L +WH+EFLK QA+PA+P  FP
Sbjct  61   LWDTAGQERFQSLGSAFYRGADCCVLVYDVNVLKSFESLQSWHEEFLKQQADPAEPEVFP  120

Query  467  FILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            F++LGNK+DVDGGNSRVVSE++A+EWC+S+G IPYFETSAKED NVDAA
Sbjct  121  FVVLGNKVDVDGGNSRVVSERRAREWCASRGDIPYFETSAKEDFNVDAA  169



>ref|XP_010254112.1| PREDICTED: ras-related protein Rab7-like [Nelumbo nucifera]
Length=206

 Score =   297 bits (761),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE INV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGINVEAA  168



>ref|XP_010925847.1| PREDICTED: ras-related protein Rab7-like [Elaeis guineensis]
Length=207

 Score =   297 bits (761),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE INV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEAA  168



>gb|KDP37234.1| hypothetical protein JCGZ_06290 [Jatropha curcas]
Length=207

 Score =   297 bits (761),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+PADP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPADPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|NP_001266750.1| uncharacterized protein LOC101027204 [Zea mays]
 gb|ACN31029.1| unknown [Zea mays]
Length=206

 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  119  RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIWD  298
            RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKE+ I+D+ VTLQIWD
Sbjct  5    RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKEVLIEDRLVTLQIWD  64

Query  299  TAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFILL  478
            TAGQERFQSLGVA YRGADCCV+VYDVN  RSFD L+ WHDEFL QA+P+DP  FPFILL
Sbjct  65   TAGQERFQSLGVALYRGADCCVLVYDVNSNRSFDTLNTWHDEFLNQASPSDPKTFPFILL  124

Query  479  GNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            GNKIDVDGG SRVVS+KKA EWC+SKG IPYFETSAKED NVD A
Sbjct  125  GNKIDVDGGKSRVVSDKKAMEWCASKGNIPYFETSAKEDYNVDNA  169



>ref|XP_008798405.1| PREDICTED: ras-related protein Rab7-like [Phoenix dactylifera]
Length=208

 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE INV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEAA  168



>ref|XP_011100905.1| PREDICTED: ras-related protein Rab7-like [Sesamum indicum]
Length=218

 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M++ +R+LLK+I+LGDSGVGKTSLMNQY+HKKF  QYKATIGADFVTKELQIDD+ VTLQ
Sbjct  1    MTMPKRSLLKIILLGDSGVGKTSLMNQYLHKKFRPQYKATIGADFVTKELQIDDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCC++VYDVNV++SF+ L NWH+EFLKQ +PA+P  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCILVYDVNVLKSFETLQNWHEEFLKQVDPANPETFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +L+GNK+D+DGGNSRVVSEK A+EWC SKG IPYFETSAKED NVDAA
Sbjct  121  VLIGNKVDIDGGNSRVVSEKTAREWCISKGNIPYFETSAKEDYNVDAA  168



>gb|KJB70461.1| hypothetical protein B456_011G074700 [Gossypium raimondii]
 gb|KJB70462.1| hypothetical protein B456_011G074700 [Gossypium raimondii]
Length=185

 Score =   296 bits (757),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q DD+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+V+DVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVHDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  168



>gb|KJB49115.1| hypothetical protein B456_008G101600 [Gossypium raimondii]
Length=188

 Score =   296 bits (757),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            +S +RRTLLKVIVLGDSGVGKTSLMNQYV+ KF+QQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  3    VSKKRRTLLKVIVLGDSGVGKTSLMNQYVYNKFNQQYKATIGADFVTKELQIDDKLVTLQ  62

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +V+DVN++RSF+ L+NW +EFLKQA+P+DP  FPF
Sbjct  63   IWDTAGQERFQSLGSAFYRGADCCAIVFDVNILRSFETLNNWREEFLKQADPSDPESFPF  122

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I++GNKID+DGGNSR+VSEKKA++WC+SKG IPYFETSAKED NVD A
Sbjct  123  IVIGNKIDIDGGNSRMVSEKKARDWCASKGNIPYFETSAKEDYNVDEA  170



>ref|XP_010545703.1| PREDICTED: ras-related protein RABG3d [Tarenaya hassleriana]
Length=206

 Score =   296 bits (758),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQ+V++KFS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MASRRRVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGG SRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKIDVDGGKSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|XP_007024171.1| RAB GTPase G3D isoform 1 [Theobroma cacao]
 gb|EOY26793.1| RAB GTPase G3D isoform 1 [Theobroma cacao]
Length=207

 Score =   296 bits (758),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|XP_002516039.1| protein with unknown function [Ricinus communis]
 gb|EEF46459.1| protein with unknown function [Ricinus communis]
Length=207

 Score =   296 bits (758),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDKLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  168



>gb|AFC93432.1| Ras-like protein [Triticum aestivum]
Length=206

 Score =   296 bits (757),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/165 (85%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  119  RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIWD  298
            RRRTLLKVIVLGDSGVGKTSLMNQYVH KFSQQYKATIGADFV KE+ I+D+ VTLQIWD
Sbjct  5    RRRTLLKVIVLGDSGVGKTSLMNQYVHNKFSQQYKATIGADFVAKEVLIEDRLVTLQIWD  64

Query  299  TAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFILL  478
            TAGQERFQSLGVAFYRGADCCV+VYDVNV +SFD L+ WHDEFL QA+P+DP  FPFILL
Sbjct  65   TAGQERFQSLGVAFYRGADCCVLVYDVNVNKSFDTLNTWHDEFLNQASPSDPKTFPFILL  124

Query  479  GNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            GNKIDVDGG SRVVSEKKA +WCSSKG IPY+ETSAKED NVD A
Sbjct  125  GNKIDVDGGKSRVVSEKKAMDWCSSKGNIPYYETSAKEDYNVDEA  169



>ref|XP_010924742.1| PREDICTED: ras-related protein Rab7-like isoform X1 [Elaeis guineensis]
 ref|XP_010924743.1| PREDICTED: ras-related protein Rab7-like isoform X1 [Elaeis guineensis]
 ref|XP_010924744.1| PREDICTED: ras-related protein Rab7-like isoform X1 [Elaeis guineensis]
Length=207

 Score =   296 bits (757),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLMQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_010915809.1| PREDICTED: ras-related protein Rab7 [Elaeis guineensis]
Length=207

 Score =   296 bits (757),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNKKFSTQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGSNVDAA  168



>gb|KJB49113.1| hypothetical protein B456_008G101600 [Gossypium raimondii]
Length=208

 Score =   296 bits (757),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 156/168 (93%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            +S +RRTLLKVIVLGDSGVGKTSLMNQYV+ KF+QQYKATIGADFVTKELQIDD+ VTLQ
Sbjct  3    VSKKRRTLLKVIVLGDSGVGKTSLMNQYVYNKFNQQYKATIGADFVTKELQIDDKLVTLQ  62

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +V+DVN++RSF+ L+NW +EFLKQA+P+DP  FPF
Sbjct  63   IWDTAGQERFQSLGSAFYRGADCCAIVFDVNILRSFETLNNWREEFLKQADPSDPESFPF  122

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I++GNKID+DGGNSR+VSEKKA++WC+SKG IPYFETSAKED NVD A
Sbjct  123  IVIGNKIDIDGGNSRMVSEKKARDWCASKGNIPYFETSAKEDYNVDEA  170



>ref|XP_009416417.1| PREDICTED: ras-related protein Rab7-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   296 bits (757),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MASRRRKLLKVIILGDSGVGKTSLMNQYVNRKFSIQYKATIGADFLTKEVQIDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNK D+DGGNSRVVSEKKAK WC+SKG IPYFETSAKE INV++A
Sbjct  121  IVLGNKTDIDGGNSRVVSEKKAKHWCTSKGNIPYFETSAKEGINVESA  168



>emb|CAN75406.1| hypothetical protein VITISV_010510 [Vitis vinifera]
Length=207

 Score =   295 bits (756),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>gb|ABK22035.1| unknown [Picea sitchensis]
 gb|ABK26622.1| unknown [Picea sitchensis]
Length=206

 Score =   295 bits (756),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ R+RTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q++D+ VT+Q
Sbjct  1    MATRKRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQVEDRLVTMQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV++SFDNLDNW  EFL QANP DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVIKSFDNLDNWRQEFLIQANPTDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGG+SRVVSEKKAK WC++KG IPYFETSAKED+NV+ A
Sbjct  121  VVLGNKTDVDGGHSRVVSEKKAKMWCAAKGNIPYFETSAKEDMNVEEA  168



>ref|XP_006833300.1| hypothetical protein AMTR_s00109p00039990 [Amborella trichopoda]
 gb|ERM98578.1| hypothetical protein AMTR_s00109p00039990 [Amborella trichopoda]
Length=206

 Score =   295 bits (756),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MSARRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEIQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_002284408.1| PREDICTED: ras-related protein Rab7 [Vitis vinifera]
 emb|CBI36118.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   295 bits (756),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_008792342.1| PREDICTED: ras-related protein Rab7 [Phoenix dactylifera]
Length=207

 Score =   295 bits (756),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGFNVEAA  168



>gb|KDO48898.1| hypothetical protein CISIN_1g028654mg [Citrus sinensis]
Length=185

 Score =   294 bits (753),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKTDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_010916758.1| PREDICTED: ras-related protein Rab7-like [Elaeis guineensis]
Length=207

 Score =   295 bits (755),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK D+DGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKTDIDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGFNVEAA  168



>sp|Q9XER8.1|RAB7_GOSHI RecName: Full=Ras-related protein Rab7 [Gossypium hirsutum]
 gb|AAD22451.1|AF116243_1 RAS-related GTP-binding protein [Gossypium hirsutum]
 gb|KHG17216.1| Ras-related Rab7 [Gossypium arboreum]
 gb|KJB70460.1| hypothetical protein B456_011G074700 [Gossypium raimondii]
Length=207

 Score =   295 bits (755),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q DD+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+V+DVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVHDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|XP_004961378.1| PREDICTED: ras-related protein Rab7-like isoform X2 [Setaria 
italica]
Length=206

 Score =   295 bits (755),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +2

Query  113  SLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQI  292
            S RRRTLLKVIVLGDSGVGKTSLMNQYV+KKFSQQYKATIGADF+TKE+ I+D+ VTLQI
Sbjct  3    SWRRRTLLKVIVLGDSGVGKTSLMNQYVNKKFSQQYKATIGADFLTKEVLIEDKLVTLQI  62

Query  293  WDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFI  472
            WDTAGQERFQSLGVAFYRGADCCV+VYDVNV RSF+ L+ WHDEFL QA+P+DP  FPFI
Sbjct  63   WDTAGQERFQSLGVAFYRGADCCVLVYDVNVKRSFNTLNTWHDEFLNQASPSDPKHFPFI  122

Query  473  LLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            L+GNKID+DGGN R+VSEKKA+EWC+SKG IPYFETSAKED NVD A
Sbjct  123  LVGNKIDLDGGNKRMVSEKKAREWCASKGDIPYFETSAKEDHNVDTA  169



>ref|XP_010498755.1| PREDICTED: ras-related protein RABG3b-like [Camelina sativa]
Length=206

 Score =   295 bits (755),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +2

Query  113  SLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQI  292
            S++RRTLLKVIVLGDSGVGKTSLMNQYV+ KFSQQYKATIGADFVTKELQ+DD+ VTLQI
Sbjct  3    SMQRRTLLKVIVLGDSGVGKTSLMNQYVNNKFSQQYKATIGADFVTKELQVDDRLVTLQI  62

Query  293  WDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFI  472
            WDTAGQERFQSLGVAFYRGADCCV+VYDVN ++SFD+LDNWHDEFL+QA+P DP  F  I
Sbjct  63   WDTAGQERFQSLGVAFYRGADCCVLVYDVNYLKSFDSLDNWHDEFLRQASPRDPNAFXXI  122

Query  473  LLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            L+GNK+D+DGGNSRVVSEKKA+EWC+ KG I YFETSAKED NVD +
Sbjct  123  LVGNKVDIDGGNSRVVSEKKAREWCAEKGNIVYFETSAKEDYNVDES  169



>ref|XP_010062470.1| PREDICTED: ras-related protein Rab7 [Eucalyptus grandis]
 gb|KCW69611.1| hypothetical protein EUGRSUZ_F03029 [Eucalyptus grandis]
Length=207

 Score =   295 bits (755),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLLQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>emb|CDX99311.1| BnaC05g34260D [Brassica napus]
Length=206

 Score =   295 bits (754),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q++D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQVEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +L+GNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VLIGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGTNVEEA  168



>emb|CDY05073.1| BnaC03g28710D [Brassica napus]
Length=206

 Score =   295 bits (754),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFS QYKATIGADFVTKELQI D+ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSLQYKATIGADFVTKELQIGDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +VYDVNV +SFD+L+ WH+EFLKQA+PADP  FPF
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDVNVAKSFDSLETWHEEFLKQASPADPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNK+D+ GG++RVVSE KA +WC+S G+IPYFETSAKED NVD A
Sbjct  121  IVLGNKVDIGGGSTRVVSESKAADWCASNGSIPYFETSAKEDYNVDEA  168



>ref|XP_008795048.1| PREDICTED: ras-related protein Rab7 [Phoenix dactylifera]
Length=207

 Score =   295 bits (754),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNKKFSTQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKTDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|XP_009613203.1| PREDICTED: ras-related protein Rab7 [Nicotiana tomentosiformis]
Length=206

 Score =   295 bits (754),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MAARRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEIQFEDRLYTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SF+NL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNKIDVDGGNSRVVSEKK K WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  IVLGNKIDVDGGNSRVVSEKKVKAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|XP_006305619.1| hypothetical protein CARUB_v10010306mg [Capsella rubella]
 gb|EOA38517.1| hypothetical protein CARUB_v10010306mg [Capsella rubella]
Length=206

 Score =   295 bits (754),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRR LLKVI+LGDSGVGKTSLMNQ+V++KFS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MSSRRRVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRIFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGG SRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKTDVDGGKSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|NP_175638.1| RAB GTPase homolog G3D [Arabidopsis thaliana]
 ref|XP_002894370.1| hypothetical protein ARALYDRAFT_474344 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010500825.1| PREDICTED: ras-related protein RABG3d [Camelina sativa]
 ref|XP_010462064.1| PREDICTED: ras-related protein RABG3d [Camelina sativa]
 sp|Q9C820.1|RAG3D_ARATH RecName: Full=Ras-related protein RABG3d; Short=AtRABG3d; AltName: 
Full=Ras-related protein Rab72; Short=AtRab72 [Arabidopsis 
thaliana]
 gb|AAG51552.1|AC037424_17 GTP-binding protein RAB7D, putative; 63624-64923 [Arabidopsis 
thaliana]
 dbj|BAB68372.1| AtRab72 [Arabidopsis thaliana]
 gb|AAL67057.1| putative GTP-binding protein RAB7D [Arabidopsis thaliana]
 gb|AAM20047.1| putative GTP-binding protein RAB7D [Arabidopsis thaliana]
 gb|EFH70629.1| hypothetical protein ARALYDRAFT_474344 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE32777.1| RAB GTPase homolog G3D [Arabidopsis thaliana]
Length=206

 Score =   295 bits (754),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRR LLKVI+LGDSGVGKTSLMNQ+V++KFS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MSSRRRVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRIFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGG SRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKTDVDGGKSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|XP_006298560.1| hypothetical protein CARUB_v10014644mg [Capsella rubella]
 gb|EOA31458.1| hypothetical protein CARUB_v10014644mg [Capsella rubella]
Length=185

 Score =   294 bits (752),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +L+GNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VLIGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGTNVEEA  168



>ref|XP_006475629.1| PREDICTED: ras-related protein RABG3d-like isoform X2 [Citrus 
sinensis]
Length=187

 Score =   294 bits (752),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKTDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_002509475.1| protein with unknown function [Ricinus communis]
 gb|EEF50862.1| protein with unknown function [Ricinus communis]
Length=206

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE INV+ A
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEA  168



>ref|XP_010535164.1| PREDICTED: ras-related protein RABG3c-like [Tarenaya hassleriana]
Length=206

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQ+V++KFS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MASRRRVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+ YDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLCYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGG SRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKIDVDGGKSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|XP_009134161.1| PREDICTED: ras-related protein RABG3a-like [Brassica rapa]
Length=206

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFS QYKATIGADFVTKELQI D+ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSLQYKATIGADFVTKELQIGDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +VYDVNV +SFD+L+ WH+EFLKQA+PADP  FPF
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDVNVTKSFDSLETWHEEFLKQASPADPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNK+D+ GG++RVVSE KA +WC+S G+IPYFETSAKED NVD A
Sbjct  121  IVLGNKVDIGGGSTRVVSETKAADWCASNGSIPYFETSAKEDYNVDEA  168



>ref|XP_008810026.1| PREDICTED: ras-related protein Rab7-like [Phoenix dactylifera]
Length=207

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVI+LGDSGVGKTS+MNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRTLLKVIILGDSGVGKTSVMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKA  WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAGAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_006392939.1| hypothetical protein EUTSA_v10011782mg [Eutrema salsugineum]
 gb|ESQ30225.1| hypothetical protein EUTSA_v10011782mg [Eutrema salsugineum]
Length=206

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRR LLKVI+LGDSGVGKTSLMNQ+V++KFS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MSSRRRVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRIFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGG SRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKTDVDGGKSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  168



>emb|CDX90732.1| BnaA03g24120D [Brassica napus]
Length=206

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFS QYKATIGADFVTKELQI D+ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSLQYKATIGADFVTKELQIGDKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCC +VYDVNV +SFD+L+ WH+EFLKQA+PADP  FPF
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDVNVAKSFDSLETWHEEFLKQASPADPKTFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNK+D+ GG++RVVSE KA +WC+S G+IPYFETSAKED NVD A
Sbjct  121  IVLGNKVDIGGGSTRVVSETKAADWCASNGSIPYFETSAKEDYNVDEA  168



>gb|KDP46241.1| hypothetical protein JCGZ_10081 [Jatropha curcas]
Length=206

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE INV+ A
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEA  168



>ref|XP_007042216.1| RAB GTPase G3F isoform 1 [Theobroma cacao]
 gb|EOX98047.1| RAB GTPase G3F isoform 1 [Theobroma cacao]
Length=206

 Score =   294 bits (753),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE +NV+ A
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGVNVEEA  168



>gb|KJB47407.1| hypothetical protein B456_008G028300 [Gossypium raimondii]
Length=195

 Score =   293 bits (751),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE +NV+ A
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGVNVEEA  168



>ref|XP_006423246.1| hypothetical protein CICLE_v10029292mg [Citrus clementina]
 ref|XP_006487156.1| PREDICTED: ras-related protein Rab7-like [Citrus sinensis]
 gb|ESR36486.1| hypothetical protein CICLE_v10029292mg [Citrus clementina]
 gb|KDO49102.1| hypothetical protein CISIN_1g028647mg [Citrus sinensis]
Length=206

 Score =   294 bits (752),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE INV+ A
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEA  168



>ref|XP_010254883.1| PREDICTED: ras-related protein Rab7 [Nelumbo nucifera]
Length=206

 Score =   294 bits (752),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV +SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVTKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE INV+ A
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEA  168



>dbj|BAJ90488.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=206

 Score =   294 bits (752),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAK+ INV+ A
Sbjct  121  VLLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKDGINVEEA  168



>ref|XP_010479732.1| PREDICTED: ras-related protein RABG3d-like [Camelina sativa]
Length=206

 Score =   294 bits (752),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRR LLKVI+LGDSGVGKTSLMNQ+V++KFS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MSSRRRVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRIFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGG SRVVSEKKAK WC+S+G IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKTDVDGGKSRVVSEKKAKAWCASRGNIPYFETSAKEGFNVDAA  168



>ref|XP_002313053.1| RAS-related GTP-binding family protein [Populus trichocarpa]
 ref|XP_011048676.1| PREDICTED: ras-related protein Rab7-like [Populus euphratica]
 gb|ABK94609.1| unknown [Populus trichocarpa]
 gb|EEE87008.1| RAS-related GTP-binding family protein [Populus trichocarpa]
Length=206

 Score =   294 bits (752),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE INV+ A
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEA  168



>gb|KJB47405.1| hypothetical protein B456_008G028300 [Gossypium raimondii]
Length=206

 Score =   294 bits (752),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE +NV+ A
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGVNVEEA  168



>ref|XP_003631644.1| PREDICTED: ras-related protein Rab7 [Vitis vinifera]
 ref|XP_010647868.1| PREDICTED: ras-related protein Rab7 [Vitis vinifera]
 emb|CAN61313.1| hypothetical protein VITISV_013388 [Vitis vinifera]
Length=206

 Score =   293 bits (751),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVS+KKA+ WC+SKG IPYFETSAKE INV+ A
Sbjct  121  VVLGNKVDVDGGNSRVVSDKKARAWCASKGNIPYFETSAKEGINVEEA  168



>ref|XP_003606887.1| Ras-related protein Rab7 [Medicago truncatula]
 gb|AES89084.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=206

 Score =   293 bits (751),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QANP+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQANPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKID+DGGNSRVVSEKKA+ WC++KG IPYFETSAKE INV+ A
Sbjct  121  VVIGNKIDIDGGNSRVVSEKKARAWCAAKGNIPYFETSAKEGINVEEA  168



>ref|XP_010465997.1| PREDICTED: ras-related protein RABG3f-like [Camelina sativa]
Length=207

 Score =   293 bits (751),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +L+GNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VLIGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGTNVEEA  168



>ref|XP_004302908.1| PREDICTED: ras-related protein Rab7 [Fragaria vesca subsp. vesca]
 ref|XP_008342694.1| PREDICTED: ras-related protein Rab7 [Malus domestica]
 ref|XP_009346007.1| PREDICTED: ras-related protein Rab7 [Pyrus x bretschneideri]
Length=207

 Score =   293 bits (751),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVD A
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDDA  168



>ref|XP_006298561.1| hypothetical protein CARUB_v10014644mg [Capsella rubella]
 ref|XP_009145853.1| PREDICTED: ras-related protein RABG3f [Brassica rapa]
 ref|XP_010507165.1| PREDICTED: ras-related protein RABG3f [Camelina sativa]
 ref|XP_010487803.1| PREDICTED: ras-related protein RABG3f [Camelina sativa]
 gb|EOA31459.1| hypothetical protein CARUB_v10014644mg [Capsella rubella]
 gb|KFK30306.1| hypothetical protein AALP_AA7G244800 [Arabis alpina]
 emb|CDX92277.1| BnaA05g21300D [Brassica napus]
Length=206

 Score =   293 bits (751),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +L+GNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VLIGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGTNVEEA  168



>gb|KHG22203.1| Ras-related Rab7 [Gossypium arboreum]
Length=206

 Score =   293 bits (751),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE +NV+ A
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGVNVEEA  168



>ref|XP_009353621.1| PREDICTED: ras-related protein Rab7-like [Pyrus x bretschneideri]
Length=207

 Score =   293 bits (751),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVD A
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDDA  168



>ref|NP_001269169.1| ras-related protein Rab-7b [Cucumis sativus]
 ref|XP_008447038.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein Rab7-like 
[Cucumis melo]
 gb|AAQ72787.1| putative GTP-binding protein [Cucumis sativus]
 gb|KGN44346.1| hypothetical protein Csa_7G267940 [Cucumis sativus]
Length=206

 Score =   293 bits (751),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE INV+ A
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEA  168



>ref|XP_010249722.1| PREDICTED: ras-related protein Rab7 [Nelumbo nucifera]
Length=207

 Score =   293 bits (751),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SF++LDNW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFEHLDNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE INV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKARAWCASKGDIPYFETSAKEGINVEAA  168



>sp|Q40787.1|RAB7_CENCI RecName: Full=Ras-related protein Rab7 [Cenchrus ciliaris]
 gb|AAA85273.1| possible apospory-associated protein [Cenchrus ciliaris]
Length=206

 Score =   293 bits (751),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VLLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGTNVEDA  168



>gb|KHN39776.1| Ras-related protein Rab7 [Glycine soja]
Length=185

 Score =   292 bits (748),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKID+DGGNSRVVSEKKA+ WC+SKG IPYFETSAKE +NV+ A
Sbjct  121  VVIGNKIDIDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGLNVEEA  168



>ref|XP_011037540.1| PREDICTED: ras-related protein Rab7 [Populus euphratica]
 ref|XP_011037541.1| PREDICTED: ras-related protein Rab7 [Populus euphratica]
Length=206

 Score =   293 bits (750),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE +NV+ A
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGVNVEEA  168



>ref|XP_010548050.1| PREDICTED: ras-related protein Rab7-like [Tarenaya hassleriana]
 ref|XP_010548051.1| PREDICTED: ras-related protein Rab7-like [Tarenaya hassleriana]
Length=206

 Score =   293 bits (750),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+QI+D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQIEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SF+NL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I++GNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE +NV+ A
Sbjct  121  IVIGNKIDVDGGNSRVVSEKKARTWCASKGNIPYFETSAKEGMNVEQA  168



>emb|CBI32577.3| unnamed protein product [Vitis vinifera]
Length=253

 Score =   295 bits (755),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  48   MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  107

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  108  IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  167

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVS+KKA+ WC+SKG IPYFETSAKE INV+ A
Sbjct  168  VVLGNKVDVDGGNSRVVSDKKARAWCASKGNIPYFETSAKEGINVEEA  215



>emb|CDO98034.1| unnamed protein product [Coffea canephora]
Length=206

 Score =   293 bits (750),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLYTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SF+NL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNNWREEFLLQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNK+D+DGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  IVLGNKVDIDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGYNVEAA  168



>gb|AJD79413.1| small GTP-binding protein [Aeluropus lagopoides]
Length=206

 Score =   293 bits (750),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MAARRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAK+  NV+ A
Sbjct  121  VLLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKDGTNVEEA  168



>ref|XP_003568099.1| PREDICTED: ras-related protein Rab7-like [Brachypodium distachyon]
Length=206

 Score =   293 bits (749),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAK+ +NV+ A
Sbjct  121  VLLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKDGLNVEEA  168



>ref|NP_001238418.1| uncharacterized protein LOC100305642 [Glycine max]
 ref|XP_007131845.1| hypothetical protein PHAVU_011G046100g [Phaseolus vulgaris]
 gb|ACU13427.1| unknown [Glycine max]
 gb|ESW03839.1| hypothetical protein PHAVU_011G046100g [Phaseolus vulgaris]
 gb|KHN25366.1| Ras-related protein Rab7 [Glycine soja]
Length=206

 Score =   293 bits (749),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKID+DGGNSRVVSEKKA+ WC+SKG IPYFETSAKE INV+ A
Sbjct  121  VVIGNKIDIDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEA  168



>ref|XP_007135678.1| hypothetical protein PHAVU_010G149200g [Phaseolus vulgaris]
 gb|ESW07672.1| hypothetical protein PHAVU_010G149200g [Phaseolus vulgaris]
Length=207

 Score =   293 bits (749),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL++W +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNHWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>emb|CDO97063.1| unnamed protein product [Coffea canephora]
Length=206

 Score =   293 bits (749),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAK+  NV+ A
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKDGTNVEEA  168



>emb|CAB39639.1| rab7-like protein [Arabidopsis thaliana]
 emb|CAB78095.1| rab7-like protein [Arabidopsis thaliana]
Length=208

 Score =   293 bits (749),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 154/170 (91%), Gaps = 2/170 (1%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMN--QYVHKKFSQQYKATIGADFVTKELQIDDQHVT  283
            M+ RRRTLLKVIVLGDSGVGKTSLMN  +YVHKKFS QYKATIGADFVTKELQI ++ VT
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNHFRYVHKKFSMQYKATIGADFVTKELQIGEKLVT  60

Query  284  LQIWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGF  463
            LQIWDTAGQERFQSLG AFYRGADCC +VYDVNV+RSFDNL+ WH+EFLKQA+P+DP  F
Sbjct  61   LQIWDTAGQERFQSLGAAFYRGADCCALVYDVNVLRSFDNLETWHEEFLKQASPSDPKTF  120

Query  464  PFILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            PFI+LGNKIDVDGG+SRVVS+KKA +WC+S G IPYFETSAK+D NVD A
Sbjct  121  PFIVLGNKIDVDGGSSRVVSDKKAADWCASNGNIPYFETSAKDDFNVDEA  170



>ref|XP_006475628.1| PREDICTED: ras-related protein RABG3d-like isoform X1 [Citrus 
sinensis]
 gb|KDO48897.1| hypothetical protein CISIN_1g028654mg [Citrus sinensis]
Length=206

 Score =   293 bits (749),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKTDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_011021948.1| PREDICTED: ras-related protein Rab7-like [Populus euphratica]
Length=211

 Score =   293 bits (749),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +2

Query  116  LRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIW  295
            + RR LLKVIVLGDSGVGKTSLMNQYV+KK+SQQYKATIGADFVTKELQIDD+ VTLQIW
Sbjct  1    MSRRALLKVIVLGDSGVGKTSLMNQYVYKKYSQQYKATIGADFVTKELQIDDKLVTLQIW  60

Query  296  DTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFIL  475
            DTAGQERFQSLG AFYRGADCCV+VYDVN+ +SF+ L+NWH+EF+KQA+P DP  FPFIL
Sbjct  61   DTAGQERFQSLGTAFYRGADCCVLVYDVNIQKSFETLNNWHEEFVKQADPVDPEAFPFIL  120

Query  476  LGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
             GNKIDVDGG+SRVVSEKKA+EWC+S+G IPYFETSAKE  NV  A
Sbjct  121  FGNKIDVDGGSSRVVSEKKAREWCASRGDIPYFETSAKEGYNVHEA  166



>ref|XP_004969959.1| PREDICTED: ras-related protein Rab7-like [Setaria italica]
Length=206

 Score =   293 bits (749),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNK+D+DGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VLLGNKVDIDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGTNVEDA  168



>gb|ACJ83887.1| unknown [Medicago truncatula]
 gb|AFK34698.1| unknown [Medicago truncatula]
Length=206

 Score =   293 bits (749),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVDKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QANP+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQANPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKID+DGGNSRVVSEKKA+ WC++KG IPYFETSAKE INV+ A
Sbjct  121  VVIGNKIDIDGGNSRVVSEKKARAWCAAKGNIPYFETSAKEGINVEEA  168



>ref|XP_004507422.1| PREDICTED: ras-related protein Rab7-like [Cicer arietinum]
Length=206

 Score =   293 bits (749),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SF+NL+NW +EFL QANP+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQANPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKID+DGGNSRVVSEKKA+ WC+SKG IPY+ETSAKE INV+ A
Sbjct  121  VVIGNKIDIDGGNSRVVSEKKARAWCASKGNIPYYETSAKEGINVEEA  168



>gb|KHG11476.1| Ras-related Rab7 [Gossypium arboreum]
Length=207

 Score =   293 bits (749),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE +NV+ A
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGVNVEEA  168



>gb|AJG06867.1| Rab GTPase [Nicotiana benthamiana]
Length=206

 Score =   293 bits (749),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MAARRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEIQFEDRLYTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SF+NL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKIDVDGGNSRVVSEKK K WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVVGNKIDVDGGNSRVVSEKKVKAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|XP_003568095.1| PREDICTED: ras-related protein Rab7 [Brachypodium distachyon]
Length=206

 Score =   293 bits (749),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAK+ +NV+ A
Sbjct  121  VLLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKDGLNVEEA  168



>gb|AFU91386.1| small GTP binding protein [Arachis hypogaea]
Length=206

 Score =   292 bits (748),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNK+D+DGGNSRVVSEKKA+ WC+SKG IPYFETSAKE INV+ A
Sbjct  121  VVIGNKVDIDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEA  168



>gb|EEC79597.1| hypothetical protein OsI_20781 [Oryza sativa Indica Group]
Length=206

 Score =   292 bits (748),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +2

Query  107  VMSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTL  286
            + S RRRTLLKVIVLGDSGVGKTSLMNQYV+KKFSQQYKATIGADFVTKE+ I+D+ VTL
Sbjct  1    MASSRRRTLLKVIVLGDSGVGKTSLMNQYVNKKFSQQYKATIGADFVTKEVLIEDRLVTL  60

Query  287  QIWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFP  466
            QIWDTAGQERFQSLGVAFYRGADCC++VYDVN  RSF+ L+ WHDEFL QA+P+DP  FP
Sbjct  61   QIWDTAGQERFQSLGVAFYRGADCCMLVYDVNAKRSFNALNTWHDEFLTQASPSDPKHFP  120

Query  467  FILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            FILLGNKID+D GN R + EKKAKEWC SKG IPYFETSAKED NVD+A
Sbjct  121  FILLGNKIDIDAGNRRAIPEKKAKEWCVSKGNIPYFETSAKEDYNVDSA  169



>ref|XP_011093588.1| PREDICTED: ras-related protein Rab7 [Sesamum indicum]
Length=206

 Score =   292 bits (748),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRIFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV +SFDNL+NW +EFL QA+PADP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVTKSFDNLNNWREEFLIQASPADPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVS+KKAK WCSSKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSDKKAKAWCSSKGNIPYFETSAKEGFNVEAA  168



>gb|AAV90623.1| Rab7 [Cenchrus americanus]
Length=207

 Score =   292 bits (748),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MATRRRMLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQIDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV +SF+ L+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVTKSFEKLNNWREEFLLQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNKIDVDGGNSR +SEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VLLGNKIDVDGGNSRTISEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|NP_001056046.1| Os05g0516600 [Oryza sativa Japonica Group]
 ref|XP_006654649.1| PREDICTED: ras-related protein Rab7-like [Oryza brachyantha]
 gb|AAT01314.1| putative GTP-binding protein Rab7a [Oryza sativa Japonica Group]
 dbj|BAF17960.1| Os05g0516600 [Oryza sativa Japonica Group]
 dbj|BAG99466.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99522.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64364.1| hypothetical protein OsJ_19205 [Oryza sativa Japonica Group]
Length=206

 Score =   292 bits (748),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAK+  NV+ A
Sbjct  121  VLLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKDGTNVEEA  168



>gb|ABQ65168.1| Rab7 [Prosopis juliflora]
Length=207

 Score =   292 bits (748),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL++W +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNHWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_011088375.1| PREDICTED: ras-related protein Rab7 [Sesamum indicum]
Length=206

 Score =   292 bits (748),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRALLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VVIGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGTNVEEA  168



>ref|XP_006451166.1| hypothetical protein CICLE_v10009505mg [Citrus clementina]
 gb|ESR64406.1| hypothetical protein CICLE_v10009505mg [Citrus clementina]
Length=185

 Score =   291 bits (746),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFY GADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYHGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKTDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>gb|KCW53703.1| hypothetical protein EUGRSUZ_J02962 [Eucalyptus grandis]
Length=185

 Score =   291 bits (746),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQAGPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVD GNSRVVSEKKA+ WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKVDVDNGNSRVVSEKKARAWCASKGNIPYFETSAKEGFNVEAA  168



>gb|AFK41965.1| unknown [Lotus japonicus]
Length=206

 Score =   292 bits (748),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKID+DGGNSRVVSEKKA+ WC+SKG IPYFETSAKE INV+ A
Sbjct  121  VVIGNKIDIDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEA  168



>emb|CDX95493.1| BnaC01g33850D [Brassica napus]
Length=206

 Score =   292 bits (747),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VVIGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGTNVEEA  168



>ref|XP_002883153.1| hypothetical protein ARALYDRAFT_898258 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59412.1| hypothetical protein ARALYDRAFT_898258 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   292 bits (747),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SF+NL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +L+GNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VLIGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGTNVEEA  168



>ref|XP_009112339.1| PREDICTED: ras-related protein RABG3f-like isoform X1 [Brassica 
rapa]
 emb|CDY18548.1| BnaA01g26470D [Brassica napus]
Length=206

 Score =   292 bits (747),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VVIGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGTNVEEA  168



>ref|NP_001237217.1| uncharacterized protein LOC100305824 [Glycine max]
 ref|XP_003529572.1| PREDICTED: ras-related protein Rab7-like isoform X1 [Glycine 
max]
 emb|CAA98171.1| RAB7D [Lotus japonicus]
 gb|ACU13699.1| unknown [Glycine max]
 gb|KHN39351.1| Ras-related protein Rab7 [Glycine soja]
 gb|KHN47821.1| Ras-related protein Rab7 [Glycine soja]
Length=207

 Score =   292 bits (748),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL++W +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNHWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRV+SEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVISEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>gb|EYU32929.1| hypothetical protein MIMGU_mgv1a013930mg [Erythranthe guttata]
Length=206

 Score =   292 bits (747),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRVLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRIFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV +SFDNL+NW +EFL QA+P DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVAKSFDNLNNWREEFLIQASPPDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_003537879.1| PREDICTED: ras-related protein Rab7 isoformX1 [Glycine max]
Length=206

 Score =   292 bits (747),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKID+DGGNSRVVSEKKA+ WC+SKG IPYFETSAKE +NV+ A
Sbjct  121  VVIGNKIDIDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGLNVEEA  168



>emb|CDY61984.1| BnaC03g73830D [Brassica napus]
Length=206

 Score =   292 bits (747),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SF+NL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +L+GNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VLIGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGTNVEEA  168



>ref|XP_007217763.1| hypothetical protein PRUPE_ppa011513mg [Prunus persica]
 ref|XP_008228538.1| PREDICTED: ras-related protein Rab7 [Prunus mume]
 gb|EMJ18962.1| hypothetical protein PRUPE_ppa011513mg [Prunus persica]
Length=207

 Score =   292 bits (747),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SF+NL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVD A
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDDA  168



>ref|XP_009374176.1| PREDICTED: ras-related protein Rab7-like [Pyrus x bretschneideri]
Length=206

 Score =   292 bits (747),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKIDVDGGNSRVVSEKKA+ WC+SKG IPY+ETSAKE INV+ A
Sbjct  121  VVIGNKIDVDGGNSRVVSEKKARAWCASKGNIPYYETSAKEGINVEEA  168



>gb|EPS69035.1| hypothetical protein M569_05734, partial [Genlisea aurea]
Length=216

 Score =   292 bits (748),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q DD+  TLQ
Sbjct  10   MPSRRRALLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFDDRLFTLQ  69

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA P+DP  FPF
Sbjct  70   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQAAPSDPENFPF  129

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKIDVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NV+ A
Sbjct  130  VVIGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGTNVEEA  177



>ref|XP_007048144.1| RAB GTPase G3A [Theobroma cacao]
 gb|EOX92301.1| RAB GTPase G3A [Theobroma cacao]
Length=207

 Score =   292 bits (747),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            +S++RRTLLKVIVLGDSGVGKTSLMNQYV+ KF+QQYKATIGADFVTKELQ+DD+ VTLQ
Sbjct  3    VSMKRRTLLKVIVLGDSGVGKTSLMNQYVYNKFNQQYKATIGADFVTKELQVDDKLVTLQ  62

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLG AFYRGADCCV+VYDVNV+RSF+ L+NW +EFLKQA+P+DP  FPF
Sbjct  63   IWDTAGQERFQSLGSAFYRGADCCVLVYDVNVLRSFETLNNWREEFLKQADPSDPETFPF  122

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I++GNKID+DGGNSR VS KKA++WC+S+G IP FETSAKED NVD A
Sbjct  123  IVIGNKIDIDGGNSREVSVKKARDWCASRGNIPSFETSAKEDYNVDEA  170



>sp|P31022.1|RAB7_PEA RecName: Full=Ras-related protein Rab7 [Pisum sativum]
 emb|CAA46600.1| RAS-related GTP-binding protein [Pisum sativum]
Length=206

 Score =   292 bits (747),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN ++SFDNL+NW +EFL QANP+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSVKSFDNLNNWREEFLIQANPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKID+DGGNSRVVSEKKA+ WC++KG IPYFETSAKE INV+ A
Sbjct  121  VVIGNKIDIDGGNSRVVSEKKARAWCAAKGNIPYFETSAKEGINVEEA  168



>dbj|BAJ95468.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93528.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=206

 Score =   292 bits (747),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQYEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNK+D+DGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VLLGNKVDIDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGTNVEDA  168



>ref|XP_008392063.1| PREDICTED: ras-related protein Rab7 [Malus domestica]
Length=206

 Score =   292 bits (747),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKIDVDGGNSRVVSEKKA+ WC+SKG IPY+ETSAKE INV+ A
Sbjct  121  VVIGNKIDVDGGNSRVVSEKKARAWCASKGNIPYYETSAKEGINVEEA  168



>gb|AAA74118.1| putative [Nicotiana tabacum]
Length=206

 Score =   292 bits (747),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MAARRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEIQFEDRLYTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VY VNVM+SF+NL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYYVNVMKSFENLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            I+LGNKIDVDGGNSRVVSEKK K WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  IVLGNKIDVDGGNSRVVSEKKVKAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|XP_006451167.1| hypothetical protein CICLE_v10009505mg [Citrus clementina]
 gb|ESR64407.1| hypothetical protein CICLE_v10009505mg [Citrus clementina]
Length=187

 Score =   291 bits (745),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFY GADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYHGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKTDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>sp|O24461.1|RAB7_PRUAR RecName: Full=Ras-related protein Rab7 [Prunus armeniaca]
 gb|AAB71504.1| Rab7 GTP binding protein [Prunus armeniaca]
Length=207

 Score =   291 bits (746),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SF+NL+NW +EFL QA P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNNWREEFLIQATPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVD A
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDDA  168



>gb|KDP33678.1| hypothetical protein JCGZ_07249 [Jatropha curcas]
Length=206

 Score =   291 bits (746),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV +SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVGKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_011092778.1| PREDICTED: ras-related protein Rab7-like [Sesamum indicum]
Length=206

 Score =   291 bits (746),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRALLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNK+DVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VVIGNKVDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGTNVEEA  168



>ref|XP_004486740.1| PREDICTED: ras-related protein Rab7-like [Cicer arietinum]
Length=207

 Score =   291 bits (746),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SF+NL++W +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNHWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_010690900.1| PREDICTED: ras-related protein Rab7 [Beta vulgaris subsp. vulgaris]
Length=206

 Score =   291 bits (746),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q DD+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNKIDVDGGNSRVV EKKA+ WC+SKG IPYFETSAKE +NV+ A
Sbjct  121  VVIGNKIDVDGGNSRVVPEKKARAWCASKGNIPYFETSAKEALNVEEA  168



>emb|CDX87890.1| BnaC06g09520D [Brassica napus]
Length=206

 Score =   291 bits (746),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRR LLKVI+LGDSGVGKTSLMNQ+V++KFS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MSSRRRVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRIFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SF+NL+NW +EFL QA P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNNWREEFLIQAGPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGG SRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKTDVDGGKSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|NP_001169258.1| hypothetical protein [Zea mays]
 ref|XP_002440079.1| hypothetical protein SORBIDRAFT_09g025620 [Sorghum bicolor]
 ref|XP_004961498.1| PREDICTED: ras-related protein Rab7-like [Setaria italica]
 ref|XP_008649879.1| PREDICTED: ras-related protein Rab7 [Zea mays]
 gb|ACN32116.1| unknown [Zea mays]
 gb|EES18509.1| hypothetical protein SORBIDRAFT_09g025620 [Sorghum bicolor]
 gb|AFW78720.1| hypothetical protein ZEAMMB73_253903 [Zea mays]
 tpg|DAA41694.1| TPA: hypothetical protein ZEAMMB73_061376 [Zea mays]
Length=206

 Score =   291 bits (746),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAK+  NV+ A
Sbjct  121  VLLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKDGTNVEDA  168



>ref|XP_009144857.1| PREDICTED: ras-related protein RABG3d-like [Brassica rapa]
 emb|CDY45632.1| BnaA05g14990D [Brassica napus]
Length=206

 Score =   291 bits (746),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            MS RRR LLKVI+LGDSGVGKTSLMNQ+V++KFS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MSSRRRVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRIFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SF+NL+NW +EFL QA P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNNWREEFLIQAAPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGG SRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKTDVDGGKSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|XP_003604484.1| Ras-related protein Rab7 [Medicago truncatula]
 gb|ACJ86179.1| unknown [Medicago truncatula]
 gb|AES86681.1| RAB GTPase-like protein A1D [Medicago truncatula]
 gb|AFK35259.1| unknown [Medicago truncatula]
Length=207

 Score =   291 bits (746),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SF+NL++W +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNHWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_009589594.1| PREDICTED: ras-related protein RABG3f [Nicotiana tomentosiformis]
Length=206

 Score =   291 bits (745),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SF+NL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+D+DGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NVD A
Sbjct  121  VVLGNKVDIDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGTNVDEA  168



>ref|XP_008348511.1| PREDICTED: ras-related protein Rab7 [Malus domestica]
Length=207

 Score =   291 bits (745),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKID DGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVD A
Sbjct  121  VVLGNKIDXDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDDA  168



>ref|XP_007200529.1| hypothetical protein PRUPE_ppa011555mg [Prunus persica]
 ref|XP_008236875.1| PREDICTED: ras-related protein Rab7 [Prunus mume]
 gb|EMJ01728.1| hypothetical protein PRUPE_ppa011555mg [Prunus persica]
Length=206

 Score =   291 bits (745),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNK+DVDGGNSRVVSEKKA+ WC+SKG IPY+ETSAKE INV+ A
Sbjct  121  VVIGNKVDVDGGNSRVVSEKKARAWCASKGNIPYYETSAKEGINVEEA  168



>gb|EYU37787.1| hypothetical protein MIMGU_mgv1a013928mg [Erythranthe guttata]
Length=206

 Score =   291 bits (745),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRALLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPTDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNK+DVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VVIGNKVDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGTNVEEA  168



>ref|NP_001274838.1| uncharacterized protein LOC102577689 [Solanum tuberosum]
 ref|XP_004230949.1| PREDICTED: ras-related protein RABG3f [Solanum lycopersicum]
 gb|ABB02623.1| unknown [Solanum tuberosum]
 gb|ABB29958.1| unknown [Solanum tuberosum]
Length=206

 Score =   291 bits (745),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SF+NL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGTNVEEA  168



>ref|XP_002306097.1| RAS-related GTP-binding family protein [Populus trichocarpa]
 ref|XP_006384503.1| hypothetical protein POPTR_0004s16080g [Populus trichocarpa]
 gb|ABK92759.1| unknown [Populus trichocarpa]
 gb|EEE86608.1| RAS-related GTP-binding family protein [Populus trichocarpa]
 gb|ERP62300.1| hypothetical protein POPTR_0004s16080g [Populus trichocarpa]
Length=206

 Score =   291 bits (745),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFD+L+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDHLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE +NV+ A
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGVNVEEA  168



>ref|XP_002532185.1| protein with unknown function [Ricinus communis]
 gb|EEF30203.1| protein with unknown function [Ricinus communis]
Length=209

 Score =   291 bits (745),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = +2

Query  119  RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIWD  298
            +RR LLKVIVLGDSGVGKTSLMNQYV+KKFSQQYKATIGADFVTKELQ++++ VTLQIWD
Sbjct  8    KRRALLKVIVLGDSGVGKTSLMNQYVYKKFSQQYKATIGADFVTKELQLEEKVVTLQIWD  67

Query  299  TAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFILL  478
            TAGQERFQSLG AFYRGADCCV+VYDVNV +SF+ L+NWH+EF+KQA+P  P  FPFILL
Sbjct  68   TAGQERFQSLGSAFYRGADCCVLVYDVNVQKSFETLNNWHEEFIKQADPIYPDAFPFILL  127

Query  479  GNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            GNKID+DGGNSRVVSEKKA+EWC+S G IPYFETSAKED  VD A
Sbjct  128  GNKIDIDGGNSRVVSEKKAREWCASNGGIPYFETSAKEDYGVDEA  172



>ref|XP_004967425.1| PREDICTED: ras-related protein Rab7-like [Setaria italica]
Length=207

 Score =   291 bits (744),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV+K+FS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MATRRRMLLKVIILGDSGVGKTSLMNQYVNKRFSNQYKATIGADFLTKEVQIDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNV +SF+ L+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVTKSFEKLNNWREEFLLQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSR VSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRTVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|NP_001190694.1| RAB GTPase homolog G3A [Arabidopsis thaliana]
 gb|AEE82786.1| RAB GTPase homolog G3A [Arabidopsis thaliana]
Length=211

 Score =   291 bits (745),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 153/173 (88%), Gaps = 5/173 (3%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFS QYKATIGADFVTKELQI ++ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSMQYKATIGADFVTKELQIGEKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQA-----NPADP  454
            IWDTAGQERFQSLG AFYRGADCC +VYDVNV+RSFDNL+ WH+EFLKQA      P+DP
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDVNVLRSFDNLETWHEEFLKQAWNIGMCPSDP  120

Query  455  TGFPFILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
              FPFI+LGNKIDVDGG+SRVVS+KKA +WC+S G IPYFETSAK+D NVD A
Sbjct  121  KTFPFIVLGNKIDVDGGSSRVVSDKKAADWCASNGNIPYFETSAKDDFNVDEA  173



>ref|XP_009611771.1| PREDICTED: ras-related protein Rab7 [Nicotiana tomentosiformis]
 ref|XP_009764140.1| PREDICTED: ras-related protein Rab7 isoform X1 [Nicotiana sylvestris]
Length=205

 Score =   291 bits (744),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLYTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SF+NL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKG-IPYFETSAKEGFNVDAA  167



>ref|XP_007159766.1| hypothetical protein PHAVU_002G265500g [Phaseolus vulgaris]
 gb|ESW31760.1| hypothetical protein PHAVU_002G265500g [Phaseolus vulgaris]
Length=207

 Score =   291 bits (744),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            +S R+RTLLKVIVLGDSGVGKTSLMNQYV++KFSQQYKATIGADFVTKE+Q+DD+ VTLQ
Sbjct  3    ISQRKRTLLKVIVLGDSGVGKTSLMNQYVYRKFSQQYKATIGADFVTKEIQVDDKLVTLQ  62

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERF SLG AFYRGADCCV+VYDVN+ ++FD L+NWHDEFLKQA+  DP  FPF
Sbjct  63   IWDTAGQERFHSLGAAFYRGADCCVLVYDVNIHKTFDTLNNWHDEFLKQADMNDPEAFPF  122

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNKIDVDGGNSR V+EKKA++WC+S+G IPYFETSAKE  NV+ A
Sbjct  123  VLLGNKIDVDGGNSRRVTEKKARDWCASRGNIPYFETSAKEGYNVEEA  170



>gb|AJG06868.1| Rab GTPase [Nicotiana benthamiana]
Length=205

 Score =   291 bits (744),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLYTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SF+NL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKG-IPYFETSAKEGFNVDAA  167



>gb|KFK38961.1| hypothetical protein AALP_AA3G182500 [Arabis alpina]
Length=206

 Score =   291 bits (744),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQ+V++KFS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MASRRRVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+V DVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVNDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGG SRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKTDVDGGKSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  168



>ref|XP_010033868.1| PREDICTED: ras-related protein Rab7-like [Eucalyptus grandis]
 gb|KCW53702.1| hypothetical protein EUGRSUZ_J02962 [Eucalyptus grandis]
Length=207

 Score =   291 bits (744),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQAGPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVD GNSRVVSEKKA+ WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKVDVDNGNSRVVSEKKARAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_004235664.1| PREDICTED: ras-related protein Rab7 [Solanum lycopersicum]
 ref|XP_006343066.1| PREDICTED: ras-related protein Rab7-like [Solanum tuberosum]
Length=205

 Score =   290 bits (743),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 154/168 (92%), Gaps = 1/168 (1%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLYTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SF+NL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKIDVDGGNSRVVSEKKAKAWCASKG-IPYFETSAKEGFNVDAA  167



>ref|NP_001056165.1| Os05g0536900 [Oryza sativa Japonica Group]
 dbj|BAF18079.1| Os05g0536900 [Oryza sativa Japonica Group]
 dbj|BAG97111.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64504.1| hypothetical protein OsJ_19355 [Oryza sativa Japonica Group]
Length=206

 Score =   291 bits (744),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +2

Query  107  VMSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTL  286
            + S RRRTLLKVIVLGDSGVGKTSLMNQYV+KKFSQQYKATIGADFVTKE+ I+D+ VTL
Sbjct  1    MASSRRRTLLKVIVLGDSGVGKTSLMNQYVNKKFSQQYKATIGADFVTKEVLIEDRLVTL  60

Query  287  QIWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFP  466
            QIWDTAGQERFQSLGVAFYRGADCC++VYDVN  RSF+ L+ WHDEFL QA+P+DP  FP
Sbjct  61   QIWDTAGQERFQSLGVAFYRGADCCMLVYDVNAKRSFNALNTWHDEFLTQASPSDPKHFP  120

Query  467  FILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            FILLGNKID+D GN R + EKKAKEWC SKG IPYFETSAK+D NVD+A
Sbjct  121  FILLGNKIDIDAGNRRAIPEKKAKEWCVSKGNIPYFETSAKDDYNVDSA  169



>gb|AFK48509.1| unknown [Lotus japonicus]
Length=207

 Score =   290 bits (743),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+ GDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIIFGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL++W +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNHWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNKIDVDGGNSRV+SEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKIDVDGGNSRVISEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_007013164.1| RAB GTPase G3D [Theobroma cacao]
 gb|EOY30783.1| RAB GTPase G3D [Theobroma cacao]
Length=206

 Score =   290 bits (743),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI++GDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIIVGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRIFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFD+L+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDHLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>gb|KJB70463.1| hypothetical protein B456_011G074700 [Gossypium raimondii]
Length=208

 Score =   290 bits (743),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q DD+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQ-ANPADPTGFP  466
            IWDTAGQERFQSLGVAFYRGADCCV+V+DVNVM+SFDNL+NW +EFL Q A+P+DP  FP
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVHDVNVMKSFDNLNNWREEFLIQVASPSDPENFP  120

Query  467  FILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            F++LGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  FVVLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAA  169



>gb|EYU42624.1| hypothetical protein MIMGU_mgv1a013915mg [Erythranthe guttata]
Length=206

 Score =   290 bits (743),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRR LLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRALLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +++GNK DVDGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VVIGNKTDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGTNVEEA  168



>ref|XP_006451168.1| hypothetical protein CICLE_v10009505mg [Citrus clementina]
 gb|ESR64408.1| hypothetical protein CICLE_v10009505mg [Citrus clementina]
Length=206

 Score =   290 bits (743),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFY GADCCV+VYDVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYHGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  121  VVLGNKTDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  168



>ref|XP_008649936.1| PREDICTED: ras-related protein Rab7-like [Zea mays]
 gb|AFW78900.1| hypothetical protein ZEAMMB73_911919 [Zea mays]
Length=206

 Score =   290 bits (743),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = +2

Query  113  SLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQI  292
            S RRRTLLKVIVLGDSGVGKTSLMNQYV KKFSQQYKATIGADF+TKE+ I D+ VTLQI
Sbjct  3    SWRRRTLLKVIVLGDSGVGKTSLMNQYVSKKFSQQYKATIGADFLTKEVLIGDRLVTLQI  62

Query  293  WDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFI  472
            WDTAGQERFQSLGVAFYRGADCCV+VYDVNV RSF+ LD WHDEFL QA P+DP  FPFI
Sbjct  63   WDTAGQERFQSLGVAFYRGADCCVLVYDVNVKRSFNTLDTWHDEFLNQAGPSDPQRFPFI  122

Query  473  LLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            L+GNKID+DGG+ R+V EKKA+EWC+SKG IPYFETSAKED NVD A
Sbjct  123  LVGNKIDLDGGSKRMVPEKKAREWCASKGDIPYFETSAKEDHNVDTA  169



>ref|XP_010503795.1| PREDICTED: ras-related protein RABG3c-like [Camelina sativa]
Length=206

 Score =   290 bits (742),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRR LLKVI+LGDSGVGKTSLMNQ+V++KFS QYKATIGADF+TKE+QIDD+  TLQ
Sbjct  1    MASRRRVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+V DVNVM+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVNDVNVMKSFDNLNNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK DVDGG SRVVSEKKAK WC+SKG IPYFETSAKE  NVDAA
Sbjct  121  VVLGNKTDVDGGKSRVVSEKKAKAWCASKGNIPYFETSAKERFNVDAA  168



>gb|EEC79531.1| hypothetical protein OsI_20631 [Oryza sativa Indica Group]
Length=206

 Score =   290 bits (742),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNK+DVD GNSRVVSEKKAK WC+SKG IPYFETSAK+  NV+ A
Sbjct  121  VLLGNKVDVDSGNSRVVSEKKAKAWCASKGNIPYFETSAKDGTNVEEA  168



>ref|XP_009760995.1| PREDICTED: ras-related protein RABG3f [Nicotiana sylvestris]
Length=206

 Score =   290 bits (742),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M  RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SF+NL+NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDPENFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            ++LGNK+D+DGGNSRVVSEKKA+ WC+SKG IPYFETSAKE  NV+ A
Sbjct  121  VVLGNKVDIDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGTNVEEA  168



>ref|NP_001154217.1| RAB GTPase homolog G3A [Arabidopsis thaliana]
 gb|AEE82785.1| RAB GTPase homolog G3A [Arabidopsis thaliana]
Length=217

 Score =   290 bits (743),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 154/179 (86%), Gaps = 11/179 (6%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFS QYKATIGADFVTKELQI ++ VTLQ
Sbjct  1    MATRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSMQYKATIGADFVTKELQIGEKLVTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQ-----------  436
            IWDTAGQERFQSLG AFYRGADCC +VYDVNV+RSFDNL+ WH+EFLKQ           
Sbjct  61   IWDTAGQERFQSLGAAFYRGADCCALVYDVNVLRSFDNLETWHEEFLKQAWNIGMWTIAE  120

Query  437  ANPADPTGFPFILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            A+P+DP  FPFI+LGNKIDVDGG+SRVVS+KKA +WC+S G IPYFETSAK+D NVD A
Sbjct  121  ASPSDPKTFPFIVLGNKIDVDGGSSRVVSDKKAADWCASNGNIPYFETSAKDDFNVDEA  179



>ref|XP_003597752.1| Ras-related protein Rab7 [Medicago truncatula]
 gb|AES68003.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=209

 Score =   290 bits (742),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  119  RRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQIWD  298
            RRR LLKVI+LGDSGVGKTSLMNQYV++KFS QYKATIGADF+TKE+Q++D+  TLQIWD
Sbjct  6    RRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQVEDRLFTLQIWD  65

Query  299  TAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPFILL  478
            TAGQERFQSLGVAFYRGADCCV+VYDVNVM+SF+NL++W +EFL QA+P+DP  FPF++L
Sbjct  66   TAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNHWREEFLIQASPSDPENFPFVVL  125

Query  479  GNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            GNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAKE  NV+AA
Sbjct  126  GNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVEAA  170



>ref|XP_008654528.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACL54017.1| unknown [Zea mays]
 gb|AFW82466.1| hypothetical protein ZEAMMB73_831449 [Zea mays]
Length=206

 Score =   290 bits (742),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 0/168 (0%)
 Frame = +2

Query  110  MSLRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDQHVTLQ  289
            M+ RRRTLLKVI+LGDSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +D+  TLQ
Sbjct  1    MASRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ  60

Query  290  IWDTAGQERFQSLGVAFYRGADCCVMVYDVNVMRSFDNLDNWHDEFLKQANPADPTGFPF  469
            IWDTAGQERFQSLGVAFYRGADCCV+VYDVN M+SFDNL NW +EFL QA+P+DP  FPF
Sbjct  61   IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLHNWREEFLIQASPSDPDNFPF  120

Query  470  ILLGNKIDVDGGNSRVVSEKKAKEWCSSKGTIPYFETSAKEDINVDAA  613
            +LLGNK+DVDGGNSRVVSEKKAK WC+SKG IPYFETSAK+  NV+ A
Sbjct  121  VLLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKDGTNVEDA  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660