BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF050B17

Length=641
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796944.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    228   9e-70   Nicotiana sylvestris
ref|XP_009609766.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    223   9e-68   Nicotiana tomentosiformis
ref|XP_009624650.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    218   3e-66   Nicotiana tomentosiformis
ref|XP_009624649.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    218   4e-66   Nicotiana tomentosiformis
ref|XP_009624648.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    218   1e-65   Nicotiana tomentosiformis
ref|XP_006351174.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    218   1e-65   
ref|XP_006351173.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    218   1e-65   Solanum tuberosum [potatoes]
ref|XP_009624646.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    218   1e-65   Nicotiana tomentosiformis
ref|XP_009765732.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    216   2e-65   Nicotiana sylvestris
ref|XP_009765731.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    215   9e-65   Nicotiana sylvestris
ref|XP_009765726.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    215   1e-64   Nicotiana sylvestris
ref|XP_004241817.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    213   5e-64   Solanum lycopersicum
ref|XP_004250366.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       211   3e-63   
emb|CDP18155.1|  unnamed protein product                                209   2e-62   Coffea canephora [robusta coffee]
ref|XP_006353707.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    206   7e-61   
ref|XP_002267287.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    204   2e-60   Vitis vinifera
ref|XP_010665011.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    204   2e-60   Vitis vinifera
ref|XP_010665012.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    204   2e-60   Vitis vinifera
ref|XP_010665010.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    204   3e-60   Vitis vinifera
ref|XP_011074915.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    199   2e-58   Sesamum indicum [beniseed]
ref|XP_011074916.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    199   2e-58   Sesamum indicum [beniseed]
ref|XP_011458440.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    196   1e-57   Fragaria vesca subsp. vesca
ref|XP_004290440.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    196   1e-57   Fragaria vesca subsp. vesca
ref|XP_007201518.1|  hypothetical protein PRUPE_ppa015486mg             196   1e-57   
ref|XP_002534020.1|  protein-tyrosine phosphatase 1, plants, puta...    196   2e-57   Ricinus communis
gb|KCW71046.1|  hypothetical protein EUGRSUZ_F04145                     193   2e-57   Eucalyptus grandis [rose gum]
ref|XP_010094850.1|  Tyrosine-protein phosphatase non-receptor ty...    196   5e-57   
gb|KCW71045.1|  hypothetical protein EUGRSUZ_F04145                     194   5e-57   Eucalyptus grandis [rose gum]
ref|XP_010063788.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       194   2e-56   Eucalyptus grandis [rose gum]
gb|KDP30279.1|  hypothetical protein JCGZ_17149                         193   3e-56   Jatropha curcas
ref|XP_008381998.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    189   1e-55   
ref|XP_008365849.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    190   4e-55   
ref|XP_008381997.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    190   4e-55   
ref|XP_011097272.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    189   6e-55   Sesamum indicum [beniseed]
ref|XP_011097280.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    189   7e-55   Sesamum indicum [beniseed]
ref|XP_009375252.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    189   3e-54   Pyrus x bretschneideri [bai li]
ref|XP_006376320.1|  TYROSINE PHOSPHATASE 1 family protein              188   3e-54   Populus trichocarpa [western balsam poplar]
gb|KDO83955.1|  hypothetical protein CISIN_1g019277mg                   183   4e-53   Citrus sinensis [apfelsine]
ref|XP_006434638.1|  hypothetical protein CICLE_v10001727mg             184   7e-53   Citrus clementina [clementine]
ref|XP_011038164.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       184   8e-53   Populus euphratica
gb|KDO83953.1|  hypothetical protein CISIN_1g019277mg                   184   1e-52   Citrus sinensis [apfelsine]
gb|KDO83951.1|  hypothetical protein CISIN_1g019277mg                   183   1e-52   Citrus sinensis [apfelsine]
gb|KDO83952.1|  hypothetical protein CISIN_1g019277mg                   184   1e-52   Citrus sinensis [apfelsine]
ref|XP_006473220.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    183   1e-52   Citrus sinensis [apfelsine]
ref|XP_008237328.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    181   1e-51   Prunus mume [ume]
gb|EYU23943.1|  hypothetical protein MIMGU_mgv1a010376mg                180   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_008237327.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    181   2e-51   Prunus mume [ume]
ref|XP_008237326.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    181   2e-51   
ref|XP_010521123.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       180   4e-51   Tarenaya hassleriana [spider flower]
gb|EPS61126.1|  hypothetical protein M569_13673                         175   6e-51   Genlisea aurea
ref|XP_010428033.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       177   3e-50   Camelina sativa [gold-of-pleasure]
ref|NP_001237920.1|  tyrosine phosphatase 1                             177   3e-50   Glycine max [soybeans]
ref|XP_006588511.1|  PREDICTED: tyrosine phosphatase 1 isoform X1       177   3e-50   Glycine max [soybeans]
gb|AAT35563.1|  protein tyrosine phosphatase                            176   5e-50   Phaseolus vulgaris [French bean]
ref|XP_010471199.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    176   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009105847.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       176   1e-49   Brassica rapa
gb|KJB35864.1|  hypothetical protein B456_006G131400                    172   1e-49   Gossypium raimondii
ref|XP_008381013.1|  PREDICTED: LOW QUALITY PROTEIN: protein-tyro...    173   2e-49   
emb|CDX96354.1|  BnaA07g29650D                                          175   2e-49   
ref|XP_002887394.1|  hypothetical protein ARALYDRAFT_339406             175   2e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_010415897.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    174   3e-49   Camelina sativa [gold-of-pleasure]
gb|KHG30608.1|  Tyrosine-protein phosphatase non-receptor type 20       174   4e-49   Gossypium arboreum [tree cotton]
gb|KJB35866.1|  hypothetical protein B456_006G131400                    172   6e-49   Gossypium raimondii
gb|KJB35868.1|  hypothetical protein B456_006G131400                    172   7e-49   Gossypium raimondii
gb|KJB35870.1|  hypothetical protein B456_006G131400                    172   8e-49   Gossypium raimondii
ref|XP_010674811.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       174   9e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009348840.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    173   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_007020251.1|  Tyrosine phosphatase 1 isoform 3                   171   1e-48   
gb|KJB35865.1|  hypothetical protein B456_006G131400                    172   1e-48   Gossypium raimondii
ref|XP_004496384.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    172   2e-48   
gb|KJB35872.1|  hypothetical protein B456_006G131400                    172   3e-48   Gossypium raimondii
ref|XP_006606203.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    170   3e-48   Glycine max [soybeans]
ref|XP_007020250.1|  Tyrosine phosphatase 1 isoform 2                   172   3e-48   
ref|XP_007020249.1|  Tyrosine phosphatase 1 isoform 1                   172   3e-48   
gb|KJB35871.1|  hypothetical protein B456_006G131400                    172   3e-48   Gossypium raimondii
ref|XP_006606202.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    171   1e-47   Glycine max [soybeans]
ref|XP_003556188.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    171   1e-47   Glycine max [soybeans]
ref|XP_010256308.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       171   1e-47   Nelumbo nucifera [Indian lotus]
emb|CDX72837.1|  BnaC06g32850D                                          170   2e-47   
emb|CAJ77612.1|  protein tyrosine phosphatase                           169   6e-47   Fagus sylvatica
gb|KHN00785.1|  Tyrosine-protein phosphatase non-receptor type 20       169   6e-47   Glycine soja [wild soybean]
ref|XP_009339078.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    167   2e-46   Pyrus x bretschneideri [bai li]
ref|XP_008454605.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    163   6e-46   
ref|XP_008454604.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    164   1e-45   
ref|XP_008454599.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    164   3e-45   Cucumis melo [Oriental melon]
ref|XP_006390734.1|  hypothetical protein EUTSA_v10018624mg             165   6e-45   
gb|EYU22866.1|  hypothetical protein MIMGU_mgv1a009565mg                160   8e-44   Erythranthe guttata [common monkey flower]
ref|XP_010930782.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       159   2e-43   Elaeis guineensis
gb|KGN44430.1|  hypothetical protein Csa_7G290530                       158   4e-43   Cucumis sativus [cucumbers]
ref|XP_008461479.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    158   4e-43   Cucumis melo [Oriental melon]
ref|XP_008461478.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    158   6e-43   Cucumis melo [Oriental melon]
ref|XP_004139702.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    158   2e-42   Cucumis sativus [cucumbers]
ref|XP_004165623.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    158   2e-42   
ref|XP_008461477.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    158   2e-42   Cucumis melo [Oriental melon]
ref|XP_006829464.1|  hypothetical protein AMTR_s00247p00015290          157   2e-42   
gb|KEH43588.1|  tyrosine phosphatase                                    155   6e-42   Medicago truncatula
gb|KEH43589.1|  tyrosine phosphatase                                    155   7e-42   Medicago truncatula
ref|NP_974127.1|  tyrosine phosphatase 1                                150   2e-40   Arabidopsis thaliana [mouse-ear cress]
gb|ACY78390.1|  protein tyrosine phosphatase 1                          151   2e-40   Phalaenopsis amabilis
ref|XP_008781548.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    152   2e-40   Phoenix dactylifera
ref|NP_177331.1|  tyrosine phosphatase 1                                150   6e-40   Arabidopsis thaliana [mouse-ear cress]
gb|AAC68859.1|  protein tyrosine phosphatase 1                          147   8e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006345138.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    141   5e-38   Solanum tuberosum [potatoes]
ref|XP_009404327.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    143   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA06615.1|  protein tyrosine phosphatase                           142   5e-37   Pisum sativum [garden pea]
ref|XP_007143629.1|  hypothetical protein PHAVU_007G087900g             141   2e-36   Phaseolus vulgaris [French bean]
ref|XP_009390761.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    139   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390760.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    138   2e-35   
ref|XP_010674720.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    124   2e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004299356.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    123   1e-29   Fragaria vesca subsp. vesca
ref|XP_010237888.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    115   9e-27   
dbj|BAJ94079.1|  predicted protein                                      115   1e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98480.1|  predicted protein                                      115   1e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK26026.1|  unknown                                                 114   1e-26   Picea sitchensis
ref|XP_008358192.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    114   2e-26   
ref|XP_009363145.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    114   3e-26   
dbj|BAK00963.1|  predicted protein                                      114   3e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008781549.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    109   4e-25   Phoenix dactylifera
ref|XP_007227330.1|  hypothetical protein PRUPE_ppa016082mg             108   3e-24   
gb|EMT13080.1|  Tyrosine-protein phosphatase non-receptor type 20       104   4e-23   
gb|EAY82439.1|  hypothetical protein OsI_37652                        99.8    2e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_001066289.1|  Os12g0174800                                     99.8    3e-21   
ref|XP_010239266.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    101   5e-21   
tpg|DAA38960.1|  TPA: hypothetical protein ZEAMMB73_106189            98.6    1e-20   
ref|XP_002442903.1|  hypothetical protein SORBIDRAFT_08g004710        96.3    5e-20   Sorghum bicolor [broomcorn]
ref|XP_002966338.1|  hypothetical protein SELMODRAFT_66231            93.6    3e-19   
gb|KJB35867.1|  hypothetical protein B456_006G131400                  92.8    4e-19   Gossypium raimondii
ref|NP_001149088.1|  receptor-type tyrosine-protein phosphatase S     93.2    5e-19   Zea mays [maize]
ref|XP_002978222.1|  hypothetical protein SELMODRAFT_56201            92.8    5e-19   
ref|XP_002450425.1|  hypothetical protein SORBIDRAFT_05g005210        92.8    3e-18   
ref|XP_006664386.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  90.1    4e-18   
gb|ACF86150.1|  unknown                                               90.5    5e-18   Zea mays [maize]
ref|XP_004977238.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  87.0    4e-17   Setaria italica
ref|XP_010238660.1|  PREDICTED: protein-tyrosine-phosphatase PTP1     86.3    8e-17   Brachypodium distachyon [annual false brome]
gb|EMS67302.1|  Tyrosine-protein phosphatase Lar-like protein         85.5    2e-16   Triticum urartu
gb|EEC67788.1|  hypothetical protein OsI_35345                        83.6    9e-16   Oryza sativa Indica Group [Indian rice]
gb|EEE51752.1|  hypothetical protein OsJ_33184                        84.0    9e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006606204.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  80.5    1e-15   
ref|XP_001774836.1|  predicted protein                                82.4    2e-15   
ref|XP_006345139.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  80.1    3e-15   
gb|ABA91789.2|  Protein-tyrosine phosphatase containing protein, ...  82.4    5e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662779.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  80.1    1e-14   Oryza brachyantha
ref|XP_004978856.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  75.9    3e-13   
ref|XP_004978858.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...  75.9    3e-13   
ref|XP_005755886.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.5    4e-13   
ref|XP_009013665.1|  hypothetical protein HELRODRAFT_169572           77.4    7e-13   Helobdella robusta
ref|XP_003964025.1|  PREDICTED: receptor-type tyrosine-protein ph...  77.0    8e-13   
ref|XP_008197461.1|  PREDICTED: tyrosine-protein phosphatase non-...  76.6    1e-12   Tribolium castaneum [rust-red flour beetle]
ref|XP_008280566.1|  PREDICTED: receptor-type tyrosine-protein ph...  76.3    1e-12   Stegastes partitus
ref|XP_006783786.1|  PREDICTED: receptor-type tyrosine-protein ph...  76.3    1e-12   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005474301.1|  PREDICTED: receptor-type tyrosine-protein ph...  76.3    1e-12   Oreochromis niloticus
ref|XP_004551587.1|  PREDICTED: receptor-type tyrosine-protein ph...  76.3    1e-12   Maylandia zebra
ref|XP_008320617.1|  PREDICTED: receptor-type tyrosine-protein ph...  76.3    1e-12   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005727504.1|  PREDICTED: receptor-type tyrosine-protein ph...  76.3    1e-12   Pundamilia nyererei
ref|XP_010742249.1|  PREDICTED: receptor-type tyrosine-protein ph...  76.3    1e-12   Larimichthys crocea [croceine croaker]
ref|XP_010742242.1|  PREDICTED: receptor-type tyrosine-protein ph...  76.3    1e-12   
ref|XP_005474298.1|  PREDICTED: receptor-type tyrosine-protein ph...  76.6    1e-12   
dbj|BAC06424.1|  protein tyrosine phosphatase e                       75.5    2e-12   Oryzias latipes [Japanese rice fish]
ref|XP_008427552.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.9    2e-12   
ref|XP_004579797.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.9    2e-12   Ochotona princeps [southern American pika]
ref|XP_005914222.1|  PREDICTED: receptor-type tyrosine-protein ph...  76.3    2e-12   Haplochromis burtoni
ref|XP_007545405.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.9    2e-12   
ref|XP_005804936.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.9    2e-12   Xiphophorus maculatus
gb|ESA02363.1|  hypothetical protein GLOINDRAFT_334164                74.3    2e-12   
ref|XP_007545404.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.9    2e-12   Poecilia formosa
ref|XP_007545400.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.9    2e-12   Poecilia formosa
ref|XP_008769322.1|  PREDICTED: tyrosine-protein phosphatase non-...  74.3    2e-12   Rattus norvegicus [brown rat]
ref|XP_008427549.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.9    2e-12   Poecilia reticulata
ref|XP_008427551.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.9    2e-12   Poecilia reticulata
ref|XP_005755424.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.1    2e-12   Pundamilia nyererei
ref|XP_010782455.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.5    2e-12   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_004579796.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.9    2e-12   Ochotona princeps [southern American pika]
ref|XP_010782454.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.5    2e-12   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003441817.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.5    3e-12   
ref|XP_004561226.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.5    3e-12   Maylandia zebra
ref|XP_002326005.2|  hypothetical protein POPTR_0019s11590g           72.4    3e-12   
ref|XP_005471474.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.1    3e-12   
ref|XP_011482437.1|  PREDICTED: protein tyrosine phosphatase e is...  75.1    3e-12   Oryzias latipes [Japanese rice fish]
ref|NP_001098558.1|  protein tyrosine phosphatase e                   75.1    3e-12   Oryzias latipes [Japanese rice fish]
ref|XP_004561225.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.1    3e-12   Maylandia zebra
ref|XP_005471473.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.1    3e-12   
dbj|BAD02404.1|  protein tyrosine phosphatase e                       75.1    3e-12   Oryzias latipes [Japanese rice fish]
ref|XP_004561224.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.1    3e-12   Maylandia zebra
ref|XP_005471471.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.1    3e-12   
ref|XP_004561223.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.1    3e-12   Maylandia zebra
gb|ERE91225.1|  tyrosine-protein phosphatase non-receptor type 20...  74.3    4e-12   Cricetulus griseus [Chinese hamsters]
ref|XP_009888039.1|  PREDICTED: receptor-type tyrosine-protein ph...  75.1    5e-12   Charadrius vociferus
gb|EDL88897.1|  protein tyrosine phosphatase, non-receptor type 2...  72.0    5e-12   Rattus norvegicus [brown rat]
ref|XP_009645647.1|  PREDICTED: receptor-type tyrosine-protein ph...  74.7    5e-12   Egretta garzetta
ref|NP_001073618.1|  tyrosine-protein phosphatase non-receptor ty...  73.9    6e-12   Rattus norvegicus [brown rat]
pir||JC8052  protein tyrosine phosphatase epsilon - Japanese medaka   74.3    7e-12
ref|XP_005312032.1|  PREDICTED: tyrosine-protein phosphatase non-...  73.9    7e-12   Chrysemys picta bellii
ref|XP_006976805.1|  PREDICTED: tyrosine-protein phosphatase non-...  73.9    7e-12   
ref|XP_008641244.1|  PREDICTED: receptor-type tyrosine-protein ph...  74.3    7e-12   
emb|CDQ58273.1|  unnamed protein product                              74.3    7e-12   Oncorhynchus mykiss
ref|XP_006518793.1|  PREDICTED: tyrosine-protein phosphatase non-...  71.6    7e-12   Mus musculus [mouse]
ref|XP_007638291.1|  PREDICTED: tyrosine-protein phosphatase non-...  73.6    7e-12   Cricetulus griseus [Chinese hamsters]
ref|XP_007260074.1|  PREDICTED: receptor-type tyrosine-protein ph...  73.9    8e-12   
gb|KHJ75838.1|  Protein-tyrosine phosphatase                          72.0    8e-12   Oesophagostomum dentatum [nodule worm]
ref|XP_005602789.1|  PREDICTED: tyrosine-protein phosphatase non-...  72.8    9e-12   Equus caballus [domestic horse]
gb|EYC21500.1|  hypothetical protein Y032_0019g3860                   72.8    9e-12   Ancylostoma ceylanicum
ref|NP_033004.1|  tyrosine-protein phosphatase non-receptor type 20   73.2    9e-12   Mus musculus [mouse]
gb|EDL24859.1|  protein tyrosine phosphatase, non-receptor type 20    73.2    9e-12   Mus musculus [mouse]
gb|EFX79072.1|  hypothetical protein DAPPUDRAFT_197788                71.6    1e-11   Daphnia pulex
ref|XP_006518792.1|  PREDICTED: tyrosine-protein phosphatase non-...  73.2    1e-11   
ref|XP_011486570.1|  PREDICTED: receptor-type tyrosine-protein ph...  73.6    1e-11   Oryzias latipes [Japanese rice fish]
emb|CBN81571.1|  Receptor-type tyrosine-protein phosphatase epsilon   73.6    1e-11   Dicentrarchus labrax [European sea bass]
dbj|GAM18917.1|  hypothetical protein SAMD00019534_020920             73.2    1e-11   Acytostelium subglobosum LB1
ref|XP_006518791.1|  PREDICTED: tyrosine-protein phosphatase non-...  73.2    1e-11   Mus musculus [mouse]
gb|EYC21499.1|  hypothetical protein Y032_0019g3860                   72.8    1e-11   Ancylostoma ceylanicum
ref|XP_005412656.1|  PREDICTED: tyrosine-protein phosphatase non-...  72.8    1e-11   Chinchilla lanigera
ref|XP_010736225.1|  PREDICTED: receptor-type tyrosine-protein ph...  73.6    1e-11   
ref|XP_008283738.1|  PREDICTED: receptor-type tyrosine-protein ph...  73.6    1e-11   Stegastes partitus
ref|XP_010736150.1|  PREDICTED: receptor-type tyrosine-protein ph...  73.6    1e-11   
gb|ESA01264.1|  hypothetical protein GLOINDRAFT_338068                72.0    1e-11   
ref|XP_004080496.1|  PREDICTED: receptor-type tyrosine-protein ph...  73.6    1e-11   Oryzias latipes [Japanese rice fish]
ref|XP_011486569.1|  PREDICTED: receptor-type tyrosine-protein ph...  73.6    1e-11   Oryzias latipes [Japanese rice fish]
ref|XP_008283734.1|  PREDICTED: receptor-type tyrosine-protein ph...  73.6    1e-11   Stegastes partitus
ref|XP_008283737.1|  PREDICTED: receptor-type tyrosine-protein ph...  73.6    1e-11   Stegastes partitus
ref|XP_005412666.1|  PREDICTED: tyrosine-protein phosphatase non-...  72.4    1e-11   Chinchilla lanigera
ref|XP_005412662.1|  PREDICTED: tyrosine-protein phosphatase non-...  72.0    2e-11   Chinchilla lanigera
ref|XP_005491808.1|  PREDICTED: uncharacterized protein LOC102063787  72.8    2e-11   
ref|XP_010764793.1|  PREDICTED: receptor-type tyrosine-protein ph...  73.2    2e-11   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007451241.1|  PREDICTED: receptor-type tyrosine-protein ph...  73.2    2e-11   Lipotes vexillifer [baiji]
ref|XP_010764792.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.8    2e-11   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010764788.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.8    2e-11   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010168415.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    2e-11   Antrostomus carolinensis
ref|XP_003379118.1|  tyrosine-protein phosphatase non-receptor ty...  72.4    2e-11   Trichinella spiralis
ref|XP_008945457.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    2e-11   Merops nubicus
ref|XP_010764791.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.8    2e-11   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005077756.1|  PREDICTED: tyrosine-protein phosphatase non-...  72.4    2e-11   
ref|XP_010764790.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.8    2e-11   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007451240.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.8    2e-11   Lipotes vexillifer [baiji]
ref|XP_007902010.1|  PREDICTED: tyrosine-protein phosphatase non-...  73.2    2e-11   Callorhinchus milii [Australian ghost shark]
ref|XP_010764789.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.8    2e-11   Notothenia coriiceps [yellowbelly rockcod]
gb|KHJ88348.1|  Protein-tyrosine phosphatase                          68.6    2e-11   Oesophagostomum dentatum [nodule worm]
emb|CAG01030.1|  unnamed protein product                              72.8    2e-11   Tetraodon nigroviridis
ref|XP_004177199.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.8    2e-11   
ref|XP_008435334.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    2e-11   Poecilia reticulata
ref|XP_007562463.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    2e-11   Poecilia formosa
ref|XP_004681103.1|  PREDICTED: tyrosine-protein phosphatase non-...  71.2    3e-11   Condylura cristata
emb|CAQ14261.1|  protein tyrosine phosphatase 1b                      68.6    3e-11   Danio rerio [leopard danio]
ref|XP_008435333.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   Poecilia reticulata
ref|XP_007562462.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   Poecilia formosa
ref|XP_005602786.1|  PREDICTED: tyrosine-protein phosphatase non-...  71.6    3e-11   Equus caballus [domestic horse]
ref|XP_009894702.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   Picoides pubescens
ref|XP_010019842.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   Nestor notabilis
ref|XP_007562456.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   Poecilia formosa
ref|XP_005671255.1|  PREDICTED: tyrosine-protein phosphatase non-...  71.2    3e-11   
ref|XP_007562458.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   Poecilia formosa
emb|CDJ85585.1|  Protein-tyrosine phosphatase domain containing p...  72.0    3e-11   Haemonchus contortus [red stomach worm]
ref|XP_008312334.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008435326.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   Poecilia reticulata
gb|KFV69414.1|  Tyrosine-protein phosphatase non-receptor type 1      71.6    3e-11   Picoides pubescens
ref|XP_010133273.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.0    3e-11   Buceros rhinoceros silvestris
ref|XP_005794710.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   
ref|XP_007562459.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   Poecilia formosa
ref|XP_008435331.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   Poecilia reticulata
ref|XP_008435329.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   Poecilia reticulata
gb|KFM58822.1|  Receptor-type tyrosine-protein phosphatase N2         69.7    3e-11   Stegodyphus mimosarum
ref|XP_007562460.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   Poecilia formosa
ref|XP_008435332.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   Poecilia reticulata
ref|XP_008312333.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.4    3e-11   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008101774.1|  PREDICTED: tyrosine-protein phosphatase non-...  72.0    3e-11   Anolis carolinensis [Carolina anole]
ref|XP_005671254.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.9    3e-11   
gb|EYC26120.1|  hypothetical protein Y032_0011g1571                   71.6    3e-11   Ancylostoma ceylanicum
ref|XP_005671253.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.9    3e-11   
ref|XP_010300360.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.0    4e-11   Balearica regulorum gibbericeps
gb|EYC26121.1|  hypothetical protein Y032_0011g1571                   71.6    4e-11   Ancylostoma ceylanicum
emb|CDQ87853.1|  unnamed protein product                              71.6    4e-11   Oncorhynchus mykiss
ref|XP_010191009.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    4e-11   Mesitornis unicolor
ref|XP_005794709.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.0    4e-11   Xiphophorus maculatus
gb|KHN72357.1|  Tyrosine-protein phosphatase 10D                      71.2    4e-11   Toxocara canis
ref|XP_002120063.1|  PREDICTED: receptor-type tyrosine-protein ph...  72.0    4e-11   Ciona intestinalis [sea vase]
ref|XP_005671252.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.9    4e-11   
gb|ABG89395.1|  protein tyrosine phosphatases epsilon variant 1       71.6    4e-11   Paralichthys olivaceus [bastard halibut]
gb|ABG89396.1|  protein tyrosine phosphatases epsilon variant 2       71.6    4e-11   Paralichthys olivaceus [bastard halibut]
ref|XP_006825167.1|  PREDICTED: receptor-type tyrosine-protein ph...  71.2    5e-11   Saccoglossus kowalevskii
ref|XP_011285925.1|  PREDICTED: receptor-type tyrosine-protein ph...  71.6    5e-11   
ref|XP_010866967.1|  PREDICTED: receptor-type tyrosine-protein ph...  71.6    5e-11   
ref|XP_003359447.1|  PREDICTED: receptor-type tyrosine-protein ph...  71.2    6e-11   
ref|XP_011285924.1|  PREDICTED: receptor-type tyrosine-protein ph...  71.6    6e-11   
emb|CBY24345.1|  unnamed protein product                              71.2    6e-11   
ref|XP_001696901.1|  protein tyrosine phosphatase 3                   69.3    6e-11   
gb|AAX96301.1|  Protein-tyrosine phosphatase                          68.9    6e-11   
ref|XP_010866960.1|  PREDICTED: receptor-type tyrosine-protein ph...  71.2    6e-11   
ref|XP_007664190.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    6e-11   
ref|XP_010866953.1|  PREDICTED: receptor-type tyrosine-protein ph...  71.2    6e-11   
ref|XP_007079790.1|  PREDICTED: receptor-type tyrosine-protein ph...  71.2    6e-11   
ref|XP_005671250.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.9    6e-11   
ref|XP_004617891.1|  PREDICTED: receptor-type tyrosine-protein ph...  71.2    6e-11   
ref|XP_011488525.1|  PREDICTED: tyrosine-protein phosphatase non-...  71.6    7e-11   
gb|KFB37699.1|  AGAP011650-PA-like protein                            71.2    7e-11   
gb|KIH66225.1|  Protein-tyrosine phosphatase                          71.2    7e-11   
gb|EPQ17830.1|  Receptor-type tyrosine-protein phosphatase epsilon    71.2    7e-11   
ref|XP_005671631.1|  PREDICTED: receptor-type tyrosine-protein ph...  71.2    7e-11   
ref|XP_009969278.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    7e-11   
ref|XP_001926667.3|  PREDICTED: receptor-type tyrosine-protein ph...  71.2    7e-11   
ref|XP_007229157.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.9    7e-11   
ref|XP_005882571.1|  PREDICTED: receptor-type tyrosine-protein ph...  71.2    7e-11   
ref|XP_009989492.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    7e-11   
ref|XP_010616526.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.5    7e-11   
ref|XP_008167985.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.9    8e-11   
ref|XP_005048916.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.9    8e-11   
ref|XP_002431379.1|  conserved hypothetical protein                   71.2    8e-11   
ref|XP_010393398.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.9    8e-11   
ref|XP_010616527.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.5    8e-11   
ref|XP_006755042.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.9    8e-11   
gb|EMP42177.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.5    8e-11   
ref|XP_010735703.1|  PREDICTED: tyrosine-protein phosphatase non-...  71.2    8e-11   
ref|XP_006121433.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.9    9e-11   
ref|XP_007069638.1|  PREDICTED: tyrosine-protein phosphatase non-...  69.7    9e-11   
emb|CDJ94181.1|  Protein-tyrosine phosphatase domain containing p...  70.1    9e-11   
gb|KFM80932.1|  Tyrosine-protein phosphatase non-receptor type 4      70.1    9e-11   
pdb|1NWL|A  Chain A, Crystal Structure Of The Ptp1b Complexed Wit...  69.3    9e-11   
ref|XP_005813944.1|  PREDICTED: receptor-type tyrosine-protein ph...  71.2    9e-11   
ref|XP_008119911.1|  PREDICTED: receptor-type tyrosine-protein ph...  71.2    9e-11   
ref|XP_005299704.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.9    9e-11   
ref|XP_005348686.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.1    1e-10   
ref|XP_005299703.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.9    1e-10   
gb|ELU10110.1|  hypothetical protein CAPTEDRAFT_219480                70.5    1e-10   
ref|XP_003741118.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.9    1e-10   
ref|XP_010085935.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_006121430.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.9    1e-10   
ref|XP_005299705.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
gb|KFR01509.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.5    1e-10   
ref|XP_007533194.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.1    1e-10   
ref|XP_006121432.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_010013800.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_007902009.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.9    1e-10   
ref|XP_005102056.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.9    1e-10   
ref|XP_004176888.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-typ...  70.5    1e-10   
ref|XP_002737754.1|  PREDICTED: uncharacterized protein LOC100372485  71.2    1e-10   
ref|XP_006030311.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_007053102.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
gb|EPQ07764.1|  Tyrosine-protein phosphatase non-receptor type 1      70.1    1e-10   
ref|XP_004607604.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.1    1e-10   
ref|XP_002118643.1|  hypothetical protein TRIADDRAFT_34519            68.9    1e-10   
ref|XP_005320829.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_009903137.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.9    1e-10   
gb|KFV70640.1|  Tyrosine-protein phosphatase non-receptor type 21     70.9    1e-10   
gb|KHJ92515.1|  Protein-tyrosine phosphatase                          69.3    1e-10   
ref|XP_004021707.1|  PREDICTED: tyrosine-protein phosphatase non-...  69.7    1e-10   
ref|XP_010713136.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_006262648.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
gb|KFP60493.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.5    1e-10   
gb|KFV79031.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.5    1e-10   
gb|KFV72759.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.5    1e-10   
ref|XP_008580576.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_009905409.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_009958186.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_009942208.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_008631549.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_009873637.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_009633165.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_010950951.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_006207502.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
gb|AAI18292.2|  PTPRE protein                                         70.1    1e-10   
ref|XP_009809310.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
gb|KFZ68784.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.1    1e-10   
ref|XP_010406740.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_005402076.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_005402075.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
gb|KFW92718.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.5    1e-10   
ref|XP_010296998.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
gb|KFQ69271.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.5    1e-10   
ref|XP_009996579.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_009633166.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_007426888.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_004438927.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_003363517.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_008524358.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_010406742.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_010202903.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_003479855.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
gb|KFM06714.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.5    1e-10   
ref|XP_008104892.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_010619099.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
gb|KFO78089.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.1    1e-10   
ref|XP_009693843.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_009506171.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_005236138.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_005144955.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_009328701.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_009478610.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_005149551.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.5    1e-10   
ref|XP_005699435.1|  PREDICTED: tyrosine-protein phosphatase non-...  69.7    1e-10   
ref|XP_009561784.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_005508213.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_009668857.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_009474010.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_009324129.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_005490943.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_005320828.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
ref|XP_009917791.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_010281855.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_010620927.1|  PREDICTED: LOW QUALITY PROTEIN: tyrosine-pro...  69.3    1e-10   
gb|EHB02263.1|  Tyrosine-protein phosphatase non-receptor type 1      69.7    1e-10   
ref|XP_010713134.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
gb|KFQ92013.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.1    1e-10   
ref|XP_005402073.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_007173365.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_005528900.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_010406741.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.5    1e-10   
gb|KFB37706.1|  AGAP011650-PA-like protein                            70.5    1e-10   
ref|XP_009276240.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_004700930.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
gb|KFQ84905.1|  Receptor-type tyrosine-protein phosphatase epsilon    69.7    1e-10   
ref|XP_006207501.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_005402074.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_010580248.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_005144954.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
gb|KFV91771.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.1    1e-10   
gb|KFQ16523.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.1    1e-10   
ref|XP_003479854.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_003206707.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.5    1e-10   
ref|XP_005402070.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
gb|KFW84813.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.1    1e-10   
ref|XP_421821.4|  PREDICTED: receptor-type tyrosine-protein phosp...  70.1    1e-10   
gb|KFQ60035.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.1    1e-10   
ref|XP_010950953.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_004883642.1|  PREDICTED: tyrosine-protein phosphatase non-...  69.7    1e-10   
ref|XP_010154385.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_004020317.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_008926790.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
gb|EJW78615.1|  protein tyrosine phosphatase phi                      69.3    1e-10   
gb|KFP91725.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.1    1e-10   
gb|KFP54146.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.1    1e-10   
ref|XP_004942415.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    1e-10   
ref|XP_009891019.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_009085344.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_005424570.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_004858115.1|  PREDICTED: tyrosine-protein phosphatase non-...  69.7    2e-10   
ref|XP_005899228.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
gb|KFW09375.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.1    2e-10   
ref|XP_010710107.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.5    2e-10   
ref|XP_005602213.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_004942414.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_008524326.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_005979064.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_005225903.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_006179720.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_007173362.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_005602212.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_007173364.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_010568166.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_005979063.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_010996563.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_010857451.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_009574930.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
gb|EMC84125.1|  Receptor-type tyrosine-protein phosphatase epsilon    69.7    2e-10   
gb|KFV52808.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.1    2e-10   
gb|KFW68394.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.1    2e-10   
ref|XP_008489961.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-typ...  70.1    2e-10   
gb|KFB37697.1|  AGAP011650-PA-like protein                            69.7    2e-10   
ref|XP_010818434.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_009923016.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_004438925.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|NP_001192460.1|  receptor-type tyrosine-protein phosphatase e...  70.1    2e-10   
emb|CDP97924.1|  Protein BM-DEP-1, isoform b                          69.7    2e-10   
ref|XP_005225902.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
gb|ETE65823.1|  Receptor-type tyrosine-protein phosphatase epsilon    70.1    2e-10   
ref|XP_006146979.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-typ...  70.1    2e-10   
ref|XP_004020316.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_010619070.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_009073776.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_004265759.1|  PREDICTED: receptor-type tyrosine-protein ph...  69.7    2e-10   
ref|XP_004312896.1|  PREDICTED: receptor-type tyrosine-protein ph...  69.7    2e-10   
ref|XP_010619092.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
ref|XP_010857452.1|  PREDICTED: receptor-type tyrosine-protein ph...  70.1    2e-10   
gb|KDR17243.1|  Tyrosine-protein phosphatase non-receptor type 14     70.1    2e-10   
ref|XP_005698700.1|  PREDICTED: receptor-type tyrosine-protein ph...  69.7    2e-10   
ref|XP_007102841.1|  PREDICTED: receptor-type tyrosine-protein ph...  69.7    2e-10   
ref|XP_004265758.1|  PREDICTED: receptor-type tyrosine-protein ph...  69.7    2e-10   
gb|KFP88596.1|  Tyrosine-protein phosphatase non-receptor type 21     70.1    2e-10   
gb|EPY84872.1|  receptor-type tyrosine-protein phosphatase epsilo...  69.7    2e-10   
emb|CDQ83270.1|  unnamed protein product                              66.2    2e-10   
ref|XP_009080913.1|  PREDICTED: LOW QUALITY PROTEIN: tyrosine-pro...  70.1    2e-10   
emb|CDP97913.1|  Protein BM-DEP-1, isoform m                          70.1    2e-10   
ref|XP_004700929.1|  PREDICTED: receptor-type tyrosine-protein ph...  69.7    2e-10   
ref|XP_005225898.1|  PREDICTED: receptor-type tyrosine-protein ph...  69.7    2e-10   
emb|CDP97919.1|  Protein BM-DEP-1, isoform e                          70.1    2e-10   
emb|CDP97918.1|  Protein BM-DEP-1, isoform d                          70.1    2e-10   
ref|XP_008278071.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.1    2e-10   
ref|XP_008278073.1|  PREDICTED: tyrosine-protein phosphatase non-...  70.1    2e-10   
emb|CDP97912.1|  Protein BM-DEP-1, isoform l                          70.1    2e-10   
emb|CDP97917.1|  Protein BM-DEP-1, isoform k                          70.1    2e-10   
emb|CDP97916.1|  Protein BM-DEP-1, isoform h                          70.1    2e-10   
gb|ELW67269.1|  Receptor-type tyrosine-protein phosphatase epsilon    69.7    2e-10   
emb|CDP97922.1|  Protein BM-DEP-1, isoform j                          70.1    2e-10   
ref|XP_007102840.1|  PREDICTED: receptor-type tyrosine-protein ph...  69.7    2e-10   
emb|CDP97915.1|  Protein BM-DEP-1, isoform g                          70.1    2e-10   
emb|CDP97920.1|  Protein BM-DEP-1, isoform c                          70.1    2e-10   
ref|XP_008273070.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-typ...  69.7    2e-10   
emb|CDP97914.1|  Protein BM-DEP-1, isoform f                          70.1    2e-10   
ref|XP_010597541.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-typ...  69.7    2e-10   
emb|CDP97921.1|  Protein BM-DEP-1, isoform i                          70.1    2e-10   
ref|XP_006879926.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-typ...  69.7    2e-10   
emb|CDP97923.1|  Protein BM-DEP-1, isoform a                          70.1    2e-10   
ref|XP_001899867.1|  Protein-tyrosine phosphatase                     70.1    2e-10   



>ref|XP_009796944.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Nicotiana 
sylvestris]
Length=337

 Score =   228 bits (581),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +PFDF  DS P R+VLS DQ RYC EALKV K+KRF APEKIRQEF  LQA RMRAS+M+
Sbjct  14   KPFDFCDDSVPKRVVLSPDQQRYCLEALKVFKDKRFSAPEKIRQEFMILQATRMRASEMK  73

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
            +RC VALDS+NISKNRYTDVLPFD+NRVVL+PCKDYR SA GYINAS I +SE++S+FIA
Sbjct  74   TRCSVALDSVNISKNRYTDVLPFDNNRVVLDPCKDYRPSASGYINASFIKISENLSQFIA  133

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL  TFEDFW M+IQ+RCP I
Sbjct  134  TQGPLPLTFEDFWEMIIQHRCPVI  157



>ref|XP_009609766.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Nicotiana 
tomentosiformis]
Length=337

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            FDFS DS P R+VLS DQ R C EALKV K+KRF APEKIRQEF  LQA RMRAS+M+SR
Sbjct  16   FDFSDDSVPKRVVLSPDQQRCCLEALKVFKDKRFSAPEKIRQEFMILQATRMRASEMKSR  75

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
            C VALDS+NISKNRYTDVLPFD+NRVVL+PCKDYR SA GYINAS I +SE+VS+FIATQ
Sbjct  76   CSVALDSVNISKNRYTDVLPFDNNRVVLDPCKDYRPSASGYINASFIKISENVSQFIATQ  135

Query  576  GPLXNTFEDFWGMVIQNRCPAI  641
            GPL +TFEDFW M+I + CP I
Sbjct  136  GPLPHTFEDFWEMIILHHCPVI  157



>ref|XP_009624650.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X4 
[Nicotiana tomentosiformis]
Length=305

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +P DFS DS P R+VLS DQ  YC EAL   KEKR  +P KI  EF  LQ NR++AS+M+
Sbjct  27   KPLDFSADSVPKRIVLSPDQRSYCLEALTAFKEKRCHSPGKIDSEFSALQKNRLKASEMK  86

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
            SRC VALDS NISKNRYTDVLPFD++RVVL+PCKDYR SARGYINAS +++SE VSRFIA
Sbjct  87   SRCSVALDSTNISKNRYTDVLPFDNSRVVLDPCKDYRPSARGYINASFVSISERVSRFIA  146

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +TFEDFW M+IQNRCP I
Sbjct  147  TQGPLPHTFEDFWEMIIQNRCPVI  170



>ref|XP_009624649.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Nicotiana tomentosiformis]
Length=313

 Score =   218 bits (555),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +P DFS DS P R+VLS DQ  YC EAL   KEKR  +P KI  EF  LQ NR++AS+M+
Sbjct  27   KPLDFSADSVPKRIVLSPDQRSYCLEALTAFKEKRCHSPGKIDSEFSALQKNRLKASEMK  86

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
            SRC VALDS NISKNRYTDVLPFD++RVVL+PCKDYR SARGYINAS +++SE VSRFIA
Sbjct  87   SRCSVALDSTNISKNRYTDVLPFDNSRVVLDPCKDYRPSARGYINASFVSISERVSRFIA  146

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +TFEDFW M+IQNRCP I
Sbjct  147  TQGPLPHTFEDFWEMIIQNRCPVI  170



>ref|XP_009624648.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Nicotiana tomentosiformis]
Length=350

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +P DFS DS P R+VLS DQ  YC EAL   KEKR  +P KI  EF  LQ NR++AS+M+
Sbjct  27   KPLDFSADSVPKRIVLSPDQRSYCLEALTAFKEKRCHSPGKIDSEFSALQKNRLKASEMK  86

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
            SRC VALDS NISKNRYTDVLPFD++RVVL+PCKDYR SARGYINAS +++SE VSRFIA
Sbjct  87   SRCSVALDSTNISKNRYTDVLPFDNSRVVLDPCKDYRPSARGYINASFVSISERVSRFIA  146

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +TFEDFW M+IQNRCP I
Sbjct  147  TQGPLPHTFEDFWEMIIQNRCPVI  170



>ref|XP_006351174.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Solanum tuberosum]
Length=344

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +P DFS DS P R+VLS DQ  +C EALK  KEK+  +P+KI  EF TLQ NR++AS+M+
Sbjct  27   KPLDFSADSVPQRIVLSPDQRSHCLEALKAFKEKKCHSPDKIDSEFSTLQENRLKASEMK  86

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
            SRCLVALDS NISKNRYTDV+PFD+NRVVL+PCKDYR SA+GYINAS I +SE VS+F+A
Sbjct  87   SRCLVALDSTNISKNRYTDVIPFDNNRVVLDPCKDYRPSAKGYINASFIEISEGVSQFVA  146

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +TFEDFW M+IQ RCP I
Sbjct  147  TQGPLAHTFEDFWEMIIQQRCPVI  170



>ref|XP_006351173.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Solanum tuberosum]
Length=349

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +P DFS DS P R+VLS DQ  +C EALK  KEK+  +P+KI  EF TLQ NR++AS+M+
Sbjct  27   KPLDFSADSVPQRIVLSPDQRSHCLEALKAFKEKKCHSPDKIDSEFSTLQENRLKASEMK  86

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
            SRCLVALDS NISKNRYTDV+PFD+NRVVL+PCKDYR SA+GYINAS I +SE VS+F+A
Sbjct  87   SRCLVALDSTNISKNRYTDVIPFDNNRVVLDPCKDYRPSAKGYINASFIEISEGVSQFVA  146

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +TFEDFW M+IQ RCP I
Sbjct  147  TQGPLAHTFEDFWEMIIQQRCPVI  170



>ref|XP_009624646.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009624647.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana tomentosiformis]
Length=358

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +P DFS DS P R+VLS DQ  YC EAL   KEKR  +P KI  EF  LQ NR++AS+M+
Sbjct  27   KPLDFSADSVPKRIVLSPDQRSYCLEALTAFKEKRCHSPGKIDSEFSALQKNRLKASEMK  86

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
            SRC VALDS NISKNRYTDVLPFD++RVVL+PCKDYR SARGYINAS +++SE VSRFIA
Sbjct  87   SRCSVALDSTNISKNRYTDVLPFDNSRVVLDPCKDYRPSARGYINASFVSISERVSRFIA  146

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +TFEDFW M+IQNRCP I
Sbjct  147  TQGPLPHTFEDFWEMIIQNRCPVI  170



>ref|XP_009765732.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Nicotiana sylvestris]
Length=305

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             DFS DS P R+VLS DQ  YC EAL   K+KR+ +P KI  EF  LQ NR++AS+M+SR
Sbjct  29   LDFSADSVPKRIVLSPDQRSYCLEALTAFKDKRYHSPGKIDSEFSALQKNRLKASEMKSR  88

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
            C VALDS NISKNRYTDVLPFD++RVVL+PCKDYR SARGYINAS +++SE VSRFIATQ
Sbjct  89   CSVALDSTNISKNRYTDVLPFDNSRVVLDPCKDYRPSARGYINASFVSISERVSRFIATQ  148

Query  576  GPLXNTFEDFWGMVIQNRCPAI  641
            GPL +TFEDFW M+IQNRCP I
Sbjct  149  GPLPHTFEDFWEMIIQNRCPVI  170



>ref|XP_009765731.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Nicotiana sylvestris]
Length=350

 Score =   215 bits (548),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             DFS DS P R+VLS DQ  YC EAL   K+KR+ +P KI  EF  LQ NR++AS+M+SR
Sbjct  29   LDFSADSVPKRIVLSPDQRSYCLEALTAFKDKRYHSPGKIDSEFSALQKNRLKASEMKSR  88

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
            C VALDS NISKNRYTDVLPFD++RVVL+PCKDYR SARGYINAS +++SE VSRFIATQ
Sbjct  89   CSVALDSTNISKNRYTDVLPFDNSRVVLDPCKDYRPSARGYINASFVSISERVSRFIATQ  148

Query  576  GPLXNTFEDFWGMVIQNRCPAI  641
            GPL +TFEDFW M+IQNRCP I
Sbjct  149  GPLPHTFEDFWEMIIQNRCPVI  170



>ref|XP_009765726.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009765727.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009765728.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009765729.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana sylvestris]
Length=358

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             DFS DS P R+VLS DQ  YC EAL   K+KR+ +P KI  EF  LQ NR++AS+M+SR
Sbjct  29   LDFSADSVPKRIVLSPDQRSYCLEALTAFKDKRYHSPGKIDSEFSALQKNRLKASEMKSR  88

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
            C VALDS NISKNRYTDVLPFD++RVVL+PCKDYR SARGYINAS +++SE VSRFIATQ
Sbjct  89   CSVALDSTNISKNRYTDVLPFDNSRVVLDPCKDYRPSARGYINASFVSISERVSRFIATQ  148

Query  576  GPLXNTFEDFWGMVIQNRCPAI  641
            GPL +TFEDFW M+IQNRCP I
Sbjct  149  GPLPHTFEDFWEMIIQNRCPVI  170



>ref|XP_004241817.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Solanum lycopersicum]
 ref|XP_010322753.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Solanum lycopersicum]
Length=328

 Score =   213 bits (541),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 119/144 (83%), Gaps = 6/144 (4%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +PFDFS DS P R+VLSSDQ RYC E LKV K+KRF APEKIRQEF TLQA RMRAS+M+
Sbjct  16   KPFDFSDDSVPKRVVLSSDQQRYCLEVLKVFKDKRFSAPEKIRQEFMTLQATRMRASEMK  75

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
            SRC +AL+S NISKNRYTDVLPFD+NRVVL+P       ARGYINAS I +SE VS+FIA
Sbjct  76   SRCSMALNSANISKNRYTDVLPFDNNRVVLDP------PARGYINASFIKISEDVSQFIA  129

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +TFEDFW M+IQ+RCP I
Sbjct  130  TQGPLQHTFEDFWEMIIQHRCPVI  153



>ref|XP_004250366.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Solanum lycopersicum]
Length=349

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             DFS DS   R+VLS DQ  +C EALK  K+KR  +P+KI  EF TLQ NR++AS+M+SR
Sbjct  29   LDFSADSVLQRIVLSPDQRSHCLEALKAFKQKRCHSPDKIASEFSTLQENRLKASEMKSR  88

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
            CLVALDS NISKNRYTDV+PFD+NRVVL+PCKDYR SA+GYINAS I +SE VSRF+ATQ
Sbjct  89   CLVALDSTNISKNRYTDVIPFDNNRVVLDPCKDYRPSAKGYINASFIEISEGVSRFVATQ  148

Query  576  GPLXNTFEDFWGMVIQNRCPAI  641
            GPL +TFEDFW M+IQ RCP I
Sbjct  149  GPLAHTFEDFWEMIIQQRCPVI  170



>emb|CDP18155.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            FDFS DS+P + VLS D+LRY SEAL+  K+K F++P+ IRQEF TLQA RM  SDM SR
Sbjct  23   FDFSPDSEPAKFVLSPDELRYSSEALQSFKDKLFKSPQTIRQEFLTLQAKRMSRSDMMSR  82

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
            C VA DS+N  KNRY+DVLPFDSNRVVLNPCKDYR SARGYINAS I  S+ VSRFIATQ
Sbjct  83   CTVAFDSVNRDKNRYSDVLPFDSNRVVLNPCKDYRPSARGYINASFIETSDKVSRFIATQ  142

Query  576  GPLXNTFEDFWGMVIQNRCPAI  641
            G L +TFEDFW M++QN CP I
Sbjct  143  GALPHTFEDFWEMILQNHCPVI  164



>ref|XP_006353707.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Solanum tuberosum]
Length=355

 Score =   206 bits (523),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 116/142 (82%), Gaps = 6/142 (4%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            FDFS DS P R+VLSSDQ R C EALKV K+KRF APE IRQEF TLQA RMRAS+M+SR
Sbjct  45   FDFSDDSVPKRVVLSSDQQRCCLEALKVFKDKRFSAPENIRQEFMTLQATRMRASEMKSR  104

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
            C +AL+S NISKNRYTDVLPFD+NRVVL+P       ARGYINAS I +SE VS+FIATQ
Sbjct  105  CSMALNSTNISKNRYTDVLPFDNNRVVLDP------PARGYINASFIKISEDVSQFIATQ  158

Query  576  GPLXNTFEDFWGMVIQNRCPAI  641
            GPL +TFEDFW M+IQ+RCP I
Sbjct  159  GPLQHTFEDFWEMIIQHRCPVI  180



>ref|XP_002267287.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X4 [Vitis 
vinifera]
Length=339

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 114/146 (78%), Gaps = 4/146 (3%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +PFDFS DS PPRL L+ DQ ++CSEAL+  K+K  Q PEKIRQEF  LQANRMR S+M 
Sbjct  17   KPFDFSPDS-PPRLSLTPDQFKHCSEALRFFKDK-LQMPEKIRQEFAFLQANRMRPSEMM  74

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
              C VALDS+N+SKNRYTDVLPFD  RVVLN CKDYR SARGYINAS I  S  E +SRF
Sbjct  75   RSCTVALDSVNLSKNRYTDVLPFDKTRVVLNSCKDYRPSARGYINASFIETSSTESISRF  134

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGPL +T+EDFW MVIQ  CP I
Sbjct  135  IATQGPLPHTYEDFWEMVIQYHCPVI  160



>ref|XP_010665011.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Vitis 
vinifera]
Length=347

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 114/146 (78%), Gaps = 4/146 (3%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +PFDFS DS PPRL L+ DQ ++CSEAL+  K+K  Q PEKIRQEF  LQANRMR S+M 
Sbjct  17   KPFDFSPDS-PPRLSLTPDQFKHCSEALRFFKDK-LQMPEKIRQEFAFLQANRMRPSEMM  74

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
              C VALDS+N+SKNRYTDVLPFD  RVVLN CKDYR SARGYINAS I  S  E +SRF
Sbjct  75   RSCTVALDSVNLSKNRYTDVLPFDKTRVVLNSCKDYRPSARGYINASFIETSSTESISRF  134

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGPL +T+EDFW MVIQ  CP I
Sbjct  135  IATQGPLPHTYEDFWEMVIQYHCPVI  160



>ref|XP_010665012.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X3 [Vitis 
vinifera]
 emb|CBI18544.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 114/146 (78%), Gaps = 4/146 (3%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +PFDFS DS PPRL L+ DQ ++CSEAL+  K+K  Q PEKIRQEF  LQANRMR S+M 
Sbjct  17   KPFDFSPDS-PPRLSLTPDQFKHCSEALRFFKDK-LQMPEKIRQEFAFLQANRMRPSEMM  74

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
              C VALDS+N+SKNRYTDVLPFD  RVVLN CKDYR SARGYINAS I  S  E +SRF
Sbjct  75   RSCTVALDSVNLSKNRYTDVLPFDKTRVVLNSCKDYRPSARGYINASFIETSSTESISRF  134

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGPL +T+EDFW MVIQ  CP I
Sbjct  135  IATQGPLPHTYEDFWEMVIQYHCPVI  160



>ref|XP_010665010.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Vitis 
vinifera]
Length=350

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 114/146 (78%), Gaps = 4/146 (3%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +PFDFS DS PPRL L+ DQ ++CSEAL+  K+K  Q PEKIRQEF  LQANRMR S+M 
Sbjct  17   KPFDFSPDS-PPRLSLTPDQFKHCSEALRFFKDK-LQMPEKIRQEFAFLQANRMRPSEMM  74

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
              C VALDS+N+SKNRYTDVLPFD  RVVLN CKDYR SARGYINAS I  S  E +SRF
Sbjct  75   RSCTVALDSVNLSKNRYTDVLPFDKTRVVLNSCKDYRPSARGYINASFIETSSTESISRF  134

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGPL +T+EDFW MVIQ  CP I
Sbjct  135  IATQGPLPHTYEDFWEMVIQYHCPVI  160



>ref|XP_011074915.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Sesamum indicum]
Length=346

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  SYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLV  404
            S+DS   RL LS DQLR+CSEAL+  K ++  +P+ IRQEF TLQANR RASDM +RC V
Sbjct  26   SFDSTMQRLPLSVDQLRHCSEALECFKARKCNSPQTIRQEFQTLQANRTRASDMINRCTV  85

Query  405  ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            ALDS+N SKNRYTDVLPFD NRV+L  C DYR SARGYINAS +T SE VSRFIATQGPL
Sbjct  86   ALDSLNYSKNRYTDVLPFDDNRVILKQCTDYRSSARGYINASFVTTSESVSRFIATQGPL  145

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T EDFW M+IQ  CP I
Sbjct  146  SHTSEDFWEMIIQYHCPVI  164



>ref|XP_011074916.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Sesamum indicum]
Length=345

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  SYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLV  404
            S+DS   RL LS DQLR+CSEAL+  K ++  +P+ IRQEF TLQANR RASDM +RC V
Sbjct  26   SFDSTMQRLPLSVDQLRHCSEALECFKARKCNSPQTIRQEFQTLQANRTRASDMINRCTV  85

Query  405  ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            ALDS+N SKNRYTDVLPFD NRV+L  C DYR SARGYINAS +T SE VSRFIATQGPL
Sbjct  86   ALDSLNYSKNRYTDVLPFDDNRVILKQCTDYRSSARGYINASFVTTSESVSRFIATQGPL  145

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T EDFW M+IQ  CP I
Sbjct  146  SHTSEDFWEMIIQYHCPVI  164



>ref|XP_011458440.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=331

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 113/147 (77%), Gaps = 4/147 (3%)
 Frame = +3

Query  210  QPF-DFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDM  386
            +PF  FS DS PPRL LS DQ  YCS+ALK LK+K  Q P +I QEF  LQ  R+ AS+M
Sbjct  4    KPFPSFSADSPPPRLTLSPDQYNYCSQALKFLKDK-LQMPHQINQEFALLQGKRITASEM  62

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSR  560
            +  C VALDS+N+SKNRYTDVLPFD NRVVLN CKDYR  ARGYINAS I+   S ++SR
Sbjct  63   KRSCTVALDSVNVSKNRYTDVLPFDQNRVVLNSCKDYRPEARGYINASFISACSSGNISR  122

Query  561  FIATQGPLXNTFEDFWGMVIQNRCPAI  641
            FIATQGPL +T+EDFW MV++NRCP +
Sbjct  123  FIATQGPLPHTYEDFWEMVLENRCPVV  149



>ref|XP_004290440.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=331

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 113/147 (77%), Gaps = 4/147 (3%)
 Frame = +3

Query  210  QPF-DFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDM  386
            +PF  FS DS PPRL LS DQ  YCS+ALK LK+K  Q P +I QEF  LQ  R+ AS+M
Sbjct  4    KPFPSFSADSPPPRLTLSPDQYNYCSQALKFLKDK-LQMPHQINQEFALLQGKRITASEM  62

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSR  560
            +  C VALDS+N+SKNRYTDVLPFD NRVVLN CKDYR  ARGYINAS I+   S ++SR
Sbjct  63   KRSCTVALDSVNVSKNRYTDVLPFDQNRVVLNSCKDYRPEARGYINASFISACSSGNISR  122

Query  561  FIATQGPLXNTFEDFWGMVIQNRCPAI  641
            FIATQGPL +T+EDFW MV++NRCP +
Sbjct  123  FIATQGPLPHTYEDFWEMVLENRCPVV  149



>ref|XP_007201518.1| hypothetical protein PRUPE_ppa015486mg, partial [Prunus persica]
 gb|EMJ02717.1| hypothetical protein PRUPE_ppa015486mg, partial [Prunus persica]
Length=335

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 113/144 (78%), Gaps = 3/144 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             DFS DS P RLVL+ DQ +YCS+ALK  K+K  Q  + I QEF  LQA R+ +SDM+  
Sbjct  16   LDFSADSPPLRLVLTPDQYKYCSQALKFFKDK-LQTSDHIHQEFAQLQAKRITSSDMKRS  74

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C VALDS+N+SKNRYTDVLPFD+NRVVLN CKDYR SARGYINASLI+   SE +SRFIA
Sbjct  75   CTVALDSVNLSKNRYTDVLPFDTNRVVLNSCKDYRPSARGYINASLISTGSSESISRFIA  134

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MV++ RCP +
Sbjct  135  TQGPLPHTYEDFWEMVLEQRCPVV  158



>ref|XP_002534020.1| protein-tyrosine phosphatase 1, plants, putative [Ricinus communis]
 gb|EEF28361.1| protein-tyrosine phosphatase 1, plants, putative [Ricinus communis]
Length=332

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 111/145 (77%), Gaps = 3/145 (2%)
 Frame = +3

Query  213  PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            PF FS DS PPRL L+SDQL YCSEAL+ LK K  ++P+ I QEF  LQA+R+  S +  
Sbjct  12   PFQFSSDSAPPRLSLTSDQLNYCSEALQFLKHK-LRSPDIITQEFARLQASRLTPSQVAR  70

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFI  566
             C VALD +N SKNRY DV+PFD NRVVLNPCKDYR SA+GYINAS IT   SE++SRFI
Sbjct  71   SCKVALDGVNTSKNRYLDVIPFDENRVVLNPCKDYRSSAKGYINASFITTSSSENISRFI  130

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T+EDFW MVIQ  CP I
Sbjct  131  ATQGPLPHTYEDFWEMVIQCHCPVI  155



>gb|KCW71046.1| hypothetical protein EUGRSUZ_F04145 [Eucalyptus grandis]
Length=240

 Score =   193 bits (490),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             DFS D  PP+  LS DQ R+C+EAL+ LKEK  Q P++++QEFG LQANR+R S+M   
Sbjct  19   LDFSPDP-PPKPALSPDQRRFCAEALRALKEK-LQMPDRMKQEFGRLQANRIRPSEMVRS  76

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C VALD +N SKNRYTDV+P+D  RVVLNPCKDYR +A+GYINAS IT   SE+VSRFIA
Sbjct  77   CTVALDDVNSSKNRYTDVVPYDKTRVVLNPCKDYRPAAKGYINASFITASSSENVSRFIA  136

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW M++Q+RCPAI
Sbjct  137  TQGPLPHTYEDFWEMILQHRCPAI  160



>ref|XP_010094850.1| Tyrosine-protein phosphatase non-receptor type 20 [Morus notabilis]
 gb|EXB57379.1| Tyrosine-protein phosphatase non-receptor type 20 [Morus notabilis]
Length=357

 Score =   196 bits (497),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 113/143 (79%), Gaps = 4/143 (3%)
 Frame = +3

Query  219  DFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRC  398
            +FS DS PPRL L+ DQL++CSEAL   KEK  ++P +I QEFG LQANR+  S+MR  C
Sbjct  13   NFSPDS-PPRLALTPDQLKHCSEALGFFKEK-LRSPHQINQEFGLLQANRITPSEMRRNC  70

Query  399  LVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIAT  572
             VALDS+N+SKNRYTDVLPFD  RVVLN CKDYR SARGYINAS ITV  SE VS FIAT
Sbjct  71   TVALDSVNLSKNRYTDVLPFDQTRVVLNSCKDYRPSARGYINASFITVSSSESVSHFIAT  130

Query  573  QGPLXNTFEDFWGMVIQNRCPAI  641
            QGPL +T+EDFW MVIQ +CP +
Sbjct  131  QGPLPHTYEDFWEMVIQYQCPVV  153



>gb|KCW71045.1| hypothetical protein EUGRSUZ_F04145 [Eucalyptus grandis]
Length=296

 Score =   194 bits (492),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             DFS D  PP+  LS DQ R+C+EAL+ LKEK  Q P++++QEFG LQANR+R S+M   
Sbjct  19   LDFSPDP-PPKPALSPDQRRFCAEALRALKEK-LQMPDRMKQEFGRLQANRIRPSEMVRS  76

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C VALD +N SKNRYTDV+P+D  RVVLNPCKDYR +A+GYINAS IT   SE+VSRFIA
Sbjct  77   CTVALDDVNSSKNRYTDVVPYDKTRVVLNPCKDYRPAAKGYINASFITASSSENVSRFIA  136

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW M++Q+RCPAI
Sbjct  137  TQGPLPHTYEDFWEMILQHRCPAI  160



>ref|XP_010063788.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Eucalyptus grandis]
 ref|XP_010063789.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Eucalyptus grandis]
 ref|XP_010063790.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Eucalyptus grandis]
 ref|XP_010063791.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Eucalyptus grandis]
 gb|KCW71044.1| hypothetical protein EUGRSUZ_F04145 [Eucalyptus grandis]
Length=340

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             DFS D  PP+  LS DQ R+C+EAL+ LKEK  Q P++++QEFG LQANR+R S+M   
Sbjct  19   LDFSPDP-PPKPALSPDQRRFCAEALRALKEK-LQMPDRMKQEFGRLQANRIRPSEMVRS  76

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C VALD +N SKNRYTDV+P+D  RVVLNPCKDYR +A+GYINAS IT   SE+VSRFIA
Sbjct  77   CTVALDDVNSSKNRYTDVVPYDKTRVVLNPCKDYRPAAKGYINASFITASSSENVSRFIA  136

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW M++Q+RCPAI
Sbjct  137  TQGPLPHTYEDFWEMILQHRCPAI  160



>gb|KDP30279.1| hypothetical protein JCGZ_17149 [Jatropha curcas]
Length=339

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 111/144 (77%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F+FS DS PP+L LS+DQ +YCS AL+  KEK  Q P++I QEF  LQ  R   S M   
Sbjct  22   FEFSSDS-PPKLSLSTDQHKYCSRALQFFKEK-LQTPDRITQEFAHLQTTRTTPSQMARS  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C VALD++N+SKNRY DVLPFD NRVVLNPCKDYR SA+GYINASLIT   SE++SRFIA
Sbjct  80   CKVALDNVNVSKNRYMDVLPFDQNRVVLNPCKDYRASAQGYINASLITTSSSENISRFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +TFEDFW M+IQ+ CP I
Sbjct  140  TQGPLPHTFEDFWEMIIQHHCPVI  163



>ref|XP_008381998.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Malus domestica]
Length=275

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
               S D+ PP+L L+ DQ +YCS+ALK+ KEK  Q P+ I+QEF  LQA R+  S+M+  
Sbjct  16   LKVSADAPPPKLALTPDQYKYCSQALKLFKEK-LQMPDHIKQEFAQLQAKRITLSEMKRN  74

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C VALDS+N  KNRYTDV+PFD NRVVLN CKDYR SARGYINASLI    SE +SRFIA
Sbjct  75   CTVALDSVNSGKNRYTDVVPFDKNRVVLNSCKDYRPSARGYINASLIATSSSESISRFIA  134

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MV++ RCP +
Sbjct  135  TQGPLPHTYEDFWEMVLEQRCPVV  158



>ref|XP_008365849.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Malus domestica]
Length=339

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
               S D+ PP+L L+ DQ +YCS+ALK+ KEK  Q P+ I+QEF  LQA R+  S+M+  
Sbjct  16   LKVSADAPPPKLALTPDQYKYCSQALKLFKEK-LQMPDHIKQEFAQLQAKRITLSEMKRN  74

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C VALDS+N  KNRYTDV+PFD NRVVLN CKDYR SARGYINASLI    SE +SRFIA
Sbjct  75   CTVALDSVNSGKNRYTDVVPFDKNRVVLNSCKDYRPSARGYINASLIATSSSESISRFIA  134

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MV++ RCP +
Sbjct  135  TQGPLPHTYEDFWEMVLEQRCPVV  158



>ref|XP_008381997.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Malus domestica]
Length=339

 Score =   190 bits (483),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
               S D+ PP+L L+ DQ +YCS+ALK+ KEK  Q P+ I+QEF  LQA R+  S+M+  
Sbjct  16   LKVSADAPPPKLALTPDQYKYCSQALKLFKEK-LQMPDHIKQEFAQLQAKRITLSEMKRN  74

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C VALDS+N  KNRYTDV+PFD NRVVLN CKDYR SARGYINASLI    SE +SRFIA
Sbjct  75   CTVALDSVNSGKNRYTDVVPFDKNRVVLNSCKDYRPSARGYINASLIATSSSESISRFIA  134

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MV++ RCP +
Sbjct  135  TQGPLPHTYEDFWEMVLEQRCPVV  158



>ref|XP_011097272.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Sesamum indicum]
Length=341

 Score =   189 bits (481),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            + FD S  S P R +LS DQLR+C EALKV K KRF +P+ I  EF  L+A RM A +MR
Sbjct  16   KSFDLSAVSSPKRWLLSEDQLRHCYEALKVFKGKRFGSPQTIHHEFQILEARRMEALEMR  75

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
            SRC VAL+S++  KNRYTDVLPFD NRV+L   KDY+ SA GYINAS +  SE VSRFIA
Sbjct  76   SRCTVALNSVHQRKNRYTDVLPFDDNRVILKQHKDYKPSAMGYINASFVMTSESVSRFIA  135

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL NT EDFW MV+Q  CPAI
Sbjct  136  TQGPLPNTSEDFWEMVLQYHCPAI  159



>ref|XP_011097280.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Sesamum indicum]
Length=340

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            + FD S  S P R +LS DQLR+C EALKV K KRF +P+ I  EF  L+A RM A +MR
Sbjct  16   KSFDLSAVSSPKRWLLSEDQLRHCYEALKVFKGKRFGSPQTIHHEFQILEARRMEALEMR  75

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
            SRC VAL+S++  KNRYTDVLPFD NRV+L   KDY+ SA GYINAS +  SE VSRFIA
Sbjct  76   SRCTVALNSVHQRKNRYTDVLPFDDNRVILKQHKDYKPSAMGYINASFVMTSESVSRFIA  135

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL NT EDFW MV+Q  CPAI
Sbjct  136  TQGPLPNTSEDFWEMVLQYHCPAI  159



>ref|XP_009375252.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009375253.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009348386.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009348387.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
Length=390

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 110/144 (76%), Gaps = 3/144 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
               S DS PP+L L+ DQ +YCS+ALK+ KEK  Q P+ I QEF  LQA R+  ++M+  
Sbjct  67   LKVSADSPPPKLALTPDQYKYCSQALKLFKEK-LQMPDHINQEFAQLQAKRITLAEMKRN  125

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLI--TVSEHVSRFIA  569
            C VALDS+N SKNRYTDV+PFD NRVVLN CKDYR SARGYINASLI  + S+ +SRFIA
Sbjct  126  CTVALDSVNSSKNRYTDVVPFDKNRVVLNSCKDYRPSARGYINASLIATSASKSISRFIA  185

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MV++ RCP +
Sbjct  186  TQGPLPHTYEDFWEMVLEQRCPVV  209



>ref|XP_006376320.1| TYROSINE PHOSPHATASE 1 family protein [Populus trichocarpa]
 gb|ERP54117.1| TYROSINE PHOSPHATASE 1 family protein [Populus trichocarpa]
Length=339

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 113/144 (78%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F+FS D  PP++ LS+DQ ++CSEAL   KEK F+ P++I QEF  LQA+R+  S M   
Sbjct  22   FEFSPDP-PPKISLSTDQYQHCSEALHFFKEK-FRTPKRIAQEFAHLQASRITPSQMARS  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C VALD +N++KNRY DV+PFD NRVVLNPCKDYR SARGYINASLIT   S+++S+FIA
Sbjct  80   CKVALDGVNVNKNRYLDVVPFDQNRVVLNPCKDYRPSARGYINASLITTSSSDNISQFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +TFEDFW M+IQ+ CP I
Sbjct  140  TQGPLPHTFEDFWEMIIQHHCPVI  163



>gb|KDO83955.1| hypothetical protein CISIN_1g019277mg [Citrus sinensis]
Length=278

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 108/146 (74%), Gaps = 2/146 (1%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +PF+FS    PPR+ L++DQ  +CSEAL   KEK      +I QEF  LQA+R++ S+M 
Sbjct  16   KPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMA  75

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRF  563
              C VALD +N+SKNRYTD+LPFD NRVVL  CKDYR +ARGYINASLI+   SE VS+F
Sbjct  76   RGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQF  135

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGPL +T+EDFW MVIQ  CP I
Sbjct  136  IATQGPLPHTYEDFWEMVIQYHCPVI  161



>ref|XP_006434638.1| hypothetical protein CICLE_v10001727mg [Citrus clementina]
 gb|ESR47878.1| hypothetical protein CICLE_v10001727mg [Citrus clementina]
Length=343

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 109/146 (75%), Gaps = 2/146 (1%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +PF+FS    PPR+ L++DQ  +CSEAL   KEK     ++I QEF  LQA+R++ S+M 
Sbjct  16   KPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSQEISQEFARLQASRIKPSEMA  75

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRF  563
              C VALD +N+SKNRYTD+LPFD NRVVL  CKDYR +ARGYINASLI+   SE VS+F
Sbjct  76   RGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQF  135

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGPL +T+EDFW MVIQ  CP I
Sbjct  136  IATQGPLPHTYEDFWEMVIQYHCPVI  161



>ref|XP_011038164.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Populus euphratica]
Length=337

 Score =   184 bits (467),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 110/144 (76%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F+FS D  PPR+ LS DQ ++CSEAL   KEK  + PE+I QEF  LQA+R+  S M   
Sbjct  22   FEFSPDP-PPRISLSDDQYQHCSEALHFFKEK-LRTPERIAQEFAHLQASRITPSQMARS  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLIT--VSEHVSRFIA  569
            C VALD +N++KNRY DV+PFD  RVVLNPCKDYR SARGYINASLIT   S+++SRFIA
Sbjct  80   CKVALDGVNVNKNRYLDVVPFDQYRVVLNPCKDYRPSARGYINASLITNSSSDNISRFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW M+IQ+ CP I
Sbjct  140  TQGPLPHTYEDFWEMIIQHHCPVI  163



>gb|KDO83953.1| hypothetical protein CISIN_1g019277mg [Citrus sinensis]
 gb|KDO83954.1| hypothetical protein CISIN_1g019277mg [Citrus sinensis]
Length=339

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 108/146 (74%), Gaps = 2/146 (1%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +PF+FS    PPR+ L++DQ  +CSEAL   KEK      +I QEF  LQA+R++ S+M 
Sbjct  16   KPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMA  75

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRF  563
              C VALD +N+SKNRYTD+LPFD NRVVL  CKDYR +ARGYINASLI+   SE VS+F
Sbjct  76   RGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQF  135

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGPL +T+EDFW MVIQ  CP I
Sbjct  136  IATQGPLPHTYEDFWEMVIQYHCPVI  161



>gb|KDO83951.1| hypothetical protein CISIN_1g019277mg [Citrus sinensis]
Length=330

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 108/146 (74%), Gaps = 2/146 (1%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +PF+FS    PPR+ L++DQ  +CSEAL   KEK      +I QEF  LQA+R++ S+M 
Sbjct  16   KPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMA  75

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRF  563
              C VALD +N+SKNRYTD+LPFD NRVVL  CKDYR +ARGYINASLI+   SE VS+F
Sbjct  76   RGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQF  135

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGPL +T+EDFW MVIQ  CP I
Sbjct  136  IATQGPLPHTYEDFWEMVIQYHCPVI  161



>gb|KDO83952.1| hypothetical protein CISIN_1g019277mg [Citrus sinensis]
Length=343

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 108/146 (74%), Gaps = 2/146 (1%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +PF+FS    PPR+ L++DQ  +CSEAL   KEK      +I QEF  LQA+R++ S+M 
Sbjct  16   KPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMA  75

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRF  563
              C VALD +N+SKNRYTD+LPFD NRVVL  CKDYR +ARGYINASLI+   SE VS+F
Sbjct  76   RGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQF  135

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGPL +T+EDFW MVIQ  CP I
Sbjct  136  IATQGPLPHTYEDFWEMVIQYHCPVI  161



>ref|XP_006473220.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Citrus sinensis]
Length=343

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 108/146 (74%), Gaps = 2/146 (1%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +PF+FS    PPR+ L++DQ  +CSEAL   KEK      +I QEF  LQA+R++ S+M 
Sbjct  16   KPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMA  75

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRF  563
              C VALD +N+SKNRYTD+LPFD NRVVL  CKDYR +ARGYINASLI+   SE VS+F
Sbjct  76   RGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQF  135

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGPL +T+EDFW MVIQ  CP I
Sbjct  136  IATQGPLPHTYEDFWEMVIQYHCPVI  161



>ref|XP_008237328.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X3 [Prunus 
mume]
Length=336

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 110/144 (76%), Gaps = 3/144 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             DFS DS P RLVL+ DQ +YCS+ALK  K+K  Q  + I QEF  LQA R+ +SDM+  
Sbjct  16   LDFSADSPPLRLVLTPDQYKYCSQALKFFKDK-LQTSDHIHQEFDQLQAKRITSSDMKRS  74

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINA--SLITVSEHVSRFIA  569
            C VALDS+N+SKNRYTDVLPFD+NRVVLN CKDYR SARGYINA     + SE +SRF+A
Sbjct  75   CTVALDSVNLSKNRYTDVLPFDTNRVVLNSCKDYRPSARGYINASFISTSSSESISRFVA  134

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MV++ RCP +
Sbjct  135  TQGPLPHTYEDFWEMVLEQRCPVV  158



>gb|EYU23943.1| hypothetical protein MIMGU_mgv1a010376mg [Erythranthe guttata]
Length=314

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = +3

Query  243  PRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSIN  422
            P + LS DQLR CSEAL+  K ++  +P+ I QEF TLQANRM A +MR+RC VAL S N
Sbjct  2    PMVRLSGDQLRRCSEALECFKSQKVNSPQTIHQEFQTLQANRMGALNMRNRCAVALSSFN  61

Query  423  ISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFED  602
             SKNRYTDVLPFD NRV+LN   DYR SA+GYINAS +  SE+VS FIATQGPL +T ED
Sbjct  62   YSKNRYTDVLPFDENRVILNQSSDYRPSAKGYINASFVKNSENVSGFIATQGPLTHTSED  121

Query  603  FWGMVIQNRCPAI  641
            FW M+IQ RCP I
Sbjct  122  FWEMIIQYRCPVI  134



>ref|XP_008237327.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Prunus 
mume]
Length=346

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 110/144 (76%), Gaps = 3/144 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             DFS DS P RLVL+ DQ +YCS+ALK  K+K  Q  + I QEF  LQA R+ +SDM+  
Sbjct  16   LDFSADSPPLRLVLTPDQYKYCSQALKFFKDK-LQTSDHIHQEFDQLQAKRITSSDMKRS  74

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINA--SLITVSEHVSRFIA  569
            C VALDS+N+SKNRYTDVLPFD+NRVVLN CKDYR SARGYINA     + SE +SRF+A
Sbjct  75   CTVALDSVNLSKNRYTDVLPFDTNRVVLNSCKDYRPSARGYINASFISTSSSESISRFVA  134

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MV++ RCP +
Sbjct  135  TQGPLPHTYEDFWEMVLEQRCPVV  158



>ref|XP_008237326.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Prunus 
mume]
Length=368

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 110/144 (76%), Gaps = 3/144 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             DFS DS P RLVL+ DQ +YCS+ALK  K+K  Q  + I QEF  LQA R+ +SDM+  
Sbjct  16   LDFSADSPPLRLVLTPDQYKYCSQALKFFKDK-LQTSDHIHQEFDQLQAKRITSSDMKRS  74

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINA--SLITVSEHVSRFIA  569
            C VALDS+N+SKNRYTDVLPFD+NRVVLN CKDYR SARGYINA     + SE +SRF+A
Sbjct  75   CTVALDSVNLSKNRYTDVLPFDTNRVVLNSCKDYRPSARGYINASFISTSSSESISRFVA  134

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MV++ RCP +
Sbjct  135  TQGPLPHTYEDFWEMVLEQRCPVV  158



>ref|XP_010521123.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Tarenaya hassleriana]
 ref|XP_010521124.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Tarenaya hassleriana]
 ref|XP_010521125.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Tarenaya hassleriana]
 ref|XP_010521126.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Tarenaya hassleriana]
Length=340

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 110/145 (76%), Gaps = 4/145 (3%)
 Frame = +3

Query  216  FDFS-YDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            FDFS     PPRL L+SDQ+++CSEAL+   +K  + PE I +EF  LQANR+R+S+M+ 
Sbjct  17   FDFSSVYVPPPRLSLTSDQVKHCSEALRFFTDK-LRDPESIAREFAQLQANRIRSSEMQQ  75

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLI--TVSEHVSRFI  566
             C VA++ +N  KNRY DV+PFD+NRVVLNPCKDYR SARGY+NAS I  + SE +S+FI
Sbjct  76   SCTVAMNGVNFDKNRYKDVVPFDNNRVVLNPCKDYRSSARGYVNASFIRASSSESISQFI  135

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV+Q  CP I
Sbjct  136  ATQGPLPHTMEDFWEMVVQQHCPVI  160



>gb|EPS61126.1| hypothetical protein M569_13673, partial [Genlisea aurea]
Length=195

 Score =   175 bits (443),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 105/139 (76%), Gaps = 0/139 (0%)
 Frame = +3

Query  225  SYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLV  404
            S DS+  R  LS++QLRYC EAL+  K KRF +P+ IR EF  +QANR+ A DM++ C V
Sbjct  1    SLDSELLRPPLSAEQLRYCREALEFYKNKRFNSPQAIRHEFQIMQANRLMAWDMKNLCTV  60

Query  405  ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            A  + N+SKNRY+D++PFDSNRVVL    DYR SA+GYINAS +  SE V++FIATQGPL
Sbjct  61   ARHNQNLSKNRYSDIVPFDSNRVVLKQSSDYRSSAKGYINASFVKSSESVTQFIATQGPL  120

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T EDFW M+IQ RCPAI
Sbjct  121  PHTCEDFWEMIIQYRCPAI  139



>ref|XP_010428033.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Camelina sativa]
Length=342

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 107/145 (74%), Gaps = 4/145 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLV-LSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            FDFS    PP ++ LS DQL YC +AL V +EK  + P+ I  EF  LQANR+R ++M  
Sbjct  19   FDFSSADSPPSILSLSPDQLNYCRQALGVFREK-IENPDSIAHEFANLQANRLRPTEMLL  77

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFI  566
             C +A++++NI KNRY DV+PFD+NR+VLNPCKDYR SA GY+NASLI    SE +S+FI
Sbjct  78   SCTLAMNNVNIEKNRYRDVVPFDNNRIVLNPCKDYRSSAEGYVNASLIKTSDSESISQFI  137

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MVIQ+ CP I
Sbjct  138  ATQGPLPHTMEDFWEMVIQHHCPII  162



>ref|NP_001237920.1| tyrosine phosphatase 1 [Glycine max]
 emb|CAA06975.1| tyrosine phosphatase 1 [Glycine max]
 gb|KHN17072.1| Tyrosine-protein phosphatase non-receptor type 6 [Glycine soja]
Length=338

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 108/144 (75%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F+FS D+ P R+ L+SDQ+ +C++AL +LKEK   AP  I QEF  LQANR+  S+MR R
Sbjct  20   FNFSPDN-PSRITLTSDQVNHCTQALNILKEK-LHAPNVITQEFAHLQANRITPSEMRRR  77

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIA  569
            C VA D +N+ KNRYTDVLPFD NRVVL    DYR  A+GYINASL++ S   +VS+FIA
Sbjct  78   CTVAYDDVNLRKNRYTDVLPFDKNRVVLKSSTDYRPEAQGYINASLVSTSSAGNVSQFIA  137

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW M+IQ  CPAI
Sbjct  138  TQGPLQHTYEDFWEMIIQYHCPAI  161



>ref|XP_006588511.1| PREDICTED: tyrosine phosphatase 1 isoform X1 [Glycine max]
Length=336

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 108/144 (75%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F+FS D+ P R+ L+SDQ+ +C++AL +LKEK   AP  I QEF  LQANR+  S+MR R
Sbjct  20   FNFSPDN-PSRITLTSDQVNHCTQALNILKEK-LHAPNVITQEFAHLQANRITPSEMRRR  77

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIA  569
            C VA D +N+ KNRYTDVLPFD NRVVL    DYR  A+GYINASL++ S   +VS+FIA
Sbjct  78   CTVAYDDVNLRKNRYTDVLPFDKNRVVLKSSTDYRPEAQGYINASLVSTSSAGNVSQFIA  137

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW M+IQ  CPAI
Sbjct  138  TQGPLQHTYEDFWEMIIQYHCPAI  161



>gb|AAT35563.1| protein tyrosine phosphatase [Phaseolus vulgaris]
Length=333

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 111/144 (77%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F+FS D+  P + L++DQ+ +C++AL +LKEK   AP  I +EF  LQANR+  S+MR R
Sbjct  18   FNFSPDNPSP-ITLTADQVSHCAQALNLLKEK-LHAPHTITREFAHLQANRITPSEMRRR  75

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIA  569
            C VALD++N+SKNRYTDVLPFDSNRV L    DYR +A+GYINASL++ S   +VS+F+A
Sbjct  76   CTVALDAVNLSKNRYTDVLPFDSNRVALKSSTDYRPAAQGYINASLVSTSSPGNVSQFVA  135

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW M+IQ  CPAI
Sbjct  136  TQGPLPHTYEDFWEMIIQYHCPAI  159



>ref|XP_010471199.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Camelina sativa]
 ref|XP_010471200.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Camelina sativa]
Length=337

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 107/145 (74%), Gaps = 4/145 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLV-LSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            F+FS    PP ++ LS DQL YC +AL V +EK  + P+ I  EF  LQANR+R ++M  
Sbjct  14   FNFSSADSPPSILSLSPDQLNYCRQALGVFREK-IENPDSIAHEFANLQANRLRPTEMLL  72

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFI  566
             C +A++++NI KNRY DV+PFD+NR+VLNPCKDYR SA GY+NASLI    SE +S+FI
Sbjct  73   SCTLAMNNVNIEKNRYRDVVPFDNNRIVLNPCKDYRSSAEGYVNASLIKTSDSESISQFI  132

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MVIQ+ CP I
Sbjct  133  ATQGPLPHTMEDFWEMVIQHHCPII  157



>ref|XP_009105847.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Brassica rapa]
Length=343

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 107/148 (72%), Gaps = 7/148 (5%)
 Frame = +3

Query  216  FDFS-YDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            FDFS  DS PP+L LS DQL YC +ALK+L+EK    P+ I +EF  LQANRM ASDM  
Sbjct  16   FDFSSADSPPPKLSLSPDQLSYCHQALKILREK-ISDPDSIAREFANLQANRMLASDMLR  74

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS-----EHVS  557
               VA++S+N  KNRYTDV+PFD+NRVVLNPCKD R SA GY+NASLI  +     E VS
Sbjct  75   SSTVAINSVNYEKNRYTDVVPFDNNRVVLNPCKDSRSSADGYVNASLIKTTSSSASESVS  134

Query  558  RFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             FIATQGPL +T EDFW MVIQ  CP I
Sbjct  135  EFIATQGPLPHTIEDFWEMVIQQHCPVI  162



>gb|KJB35864.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=220

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22   FVFSADP-PPKISLTPDQFNYCSEALKLFSQK-LQMPDEINREFSHLQANRITPSEMMRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C V  +  N+ KNRY+DV+PFD+NRVVL  CKDYR +A+GYINAS +T   SE++S+FIA
Sbjct  80   CTVGFNGANLDKNRYSDVIPFDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MVIQ  CP I
Sbjct  140  TQGPLPHTYEDFWEMVIQCHCPVI  163



>ref|XP_008381013.1| PREDICTED: LOW QUALITY PROTEIN: protein-tyrosine-phosphatase 
PTP1 [Malus domestica]
Length=275

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 107/144 (74%), Gaps = 3/144 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             + S DS PP+L L+ DQ +YCS+ALK+ K K  Q P+ I QEF  LQA RM +S+M   
Sbjct  16   LNVSGDSPPPKLALTPDQYKYCSQALKLFKGK-LQMPDHINQEFAQLQAKRMTSSEMGRN  74

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASL--ITVSEHVSRFIA  569
            C V LD++N SKNRYTDV+PFD NRVVLN  KDYR SARGYINASL   + SE +SRFIA
Sbjct  75   CTVGLDNVNSSKNRYTDVVPFDKNRVVLNSSKDYRPSARGYINASLITTSSSESISRFIA  134

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MV++ RCP I
Sbjct  135  TQGPLPHTYEDFWEMVLEQRCPVI  158



>emb|CDX96354.1| BnaA07g29650D [Brassica napus]
Length=343

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 107/148 (72%), Gaps = 7/148 (5%)
 Frame = +3

Query  216  FDFS-YDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            FDFS  DS PP+L LS DQL YC +ALK+L+EK    P+ I +EF  LQANRM ASDM  
Sbjct  16   FDFSSADSPPPKLSLSPDQLSYCHQALKILREK-ISDPDSIAREFANLQANRMLASDMLR  74

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS-----EHVS  557
               VA++S+N  KNRYTDV+PFD+NRV+LNPCKD R SA GY+NASLI  +     E VS
Sbjct  75   SSTVAINSVNYEKNRYTDVVPFDNNRVILNPCKDSRSSADGYVNASLIKTTSSSASESVS  134

Query  558  RFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             FIATQGPL +T EDFW MVIQ  CP I
Sbjct  135  EFIATQGPLPHTIEDFWEMVIQQHCPVI  162



>ref|XP_002887394.1| hypothetical protein ARALYDRAFT_339406 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63653.1| hypothetical protein ARALYDRAFT_339406 [Arabidopsis lyrata subsp. 
lyrata]
Length=342

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 105/145 (72%), Gaps = 4/145 (3%)
 Frame = +3

Query  216  FDFS-YDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            FDFS  D+ P +L LS DQL +C +AL V + K  Q P+ I  EF  LQANRM  S+M  
Sbjct  19   FDFSSADAPPSKLSLSPDQLNHCHQALGVFRGK-IQDPDSIAHEFAGLQANRMWPSEMLL  77

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFI  566
               VA++S+NI KNRY+DV+PFD NR+VLNPCKDYR SA+GY+NASLI    SE +S+FI
Sbjct  78   NSTVAMNSVNIEKNRYSDVVPFDKNRIVLNPCKDYRSSAKGYVNASLIKTSDSESISQFI  137

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MVIQ  CP I
Sbjct  138  ATQGPLPHTMEDFWEMVIQQHCPII  162



>ref|XP_010415897.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Camelina sativa]
 ref|XP_010415898.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Camelina sativa]
Length=328

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 106/145 (73%), Gaps = 4/145 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLV-LSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            FDFS    PP ++ LS DQL YC +AL V +EK  Q P+ I  EF  LQANR+R ++M  
Sbjct  14   FDFSSADSPPSILSLSPDQLNYCRQALGVFREK-IQNPDSIAHEFANLQANRLRPTEMLL  72

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFI  566
             C +A++++NI KNRY DV+PFD+NR+VLNPCKD R SA GY+NASLI    SE +S+FI
Sbjct  73   SCTLAMNNVNIEKNRYRDVVPFDNNRIVLNPCKDDRSSAEGYVNASLIKTSDSESISQFI  132

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MVIQ+ CP I
Sbjct  133  ATQGPLPHTMEDFWEMVIQHHCPII  157



>gb|KHG30608.1| Tyrosine-protein phosphatase non-receptor type 20 [Gossypium 
arboreum]
Length=345

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 107/144 (74%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22   FVFSADP-PPKISLTPDQFNYCSEALKLFSQKP-QMPDEINREFSHLQANRITPSEMMRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C V  +  N+ KNRY+DV+PFD+NRVVLN CKDYR +A+GYINAS +T   SE++S+FIA
Sbjct  80   CTVGFNGANLDKNRYSDVIPFDTNRVVLNSCKDYRPTAKGYINASFVTTSSSENISKFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MVIQ  CP I
Sbjct  140  TQGPLPHTYEDFWEMVIQCHCPVI  163



>gb|KJB35866.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
 gb|KJB35869.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=276

 Score =   172 bits (436),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22   FVFSADP-PPKISLTPDQFNYCSEALKLFSQK-LQMPDEINREFSHLQANRITPSEMMRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C V  +  N+ KNRY+DV+PFD+NRVVL  CKDYR +A+GYINAS +T   SE++S+FIA
Sbjct  80   CTVGFNGANLDKNRYSDVIPFDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MVIQ  CP I
Sbjct  140  TQGPLPHTYEDFWEMVIQCHCPVI  163



>gb|KJB35868.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=300

 Score =   172 bits (437),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22   FVFSADP-PPKISLTPDQFNYCSEALKLFSQK-LQMPDEINREFSHLQANRITPSEMMRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C V  +  N+ KNRY+DV+PFD+NRVVL  CKDYR +A+GYINAS +T   SE++S+FIA
Sbjct  80   CTVGFNGANLDKNRYSDVIPFDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MVIQ  CP I
Sbjct  140  TQGPLPHTYEDFWEMVIQCHCPVI  163



>gb|KJB35870.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=280

 Score =   172 bits (436),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22   FVFSADP-PPKISLTPDQFNYCSEALKLFSQK-LQMPDEINREFSHLQANRITPSEMMRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C V  +  N+ KNRY+DV+PFD+NRVVL  CKDYR +A+GYINAS +T   SE++S+FIA
Sbjct  80   CTVGFNGANLDKNRYSDVIPFDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MVIQ  CP I
Sbjct  140  TQGPLPHTYEDFWEMVIQCHCPVI  163



>ref|XP_010674811.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010674859.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Beta vulgaris subsp. 
vulgaris]
Length=340

 Score =   174 bits (440),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 109/143 (76%), Gaps = 4/143 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             DF  +S  P   LSSDQ  YCS AL+ LK+K  + P+ IR+EF +LQ  R+++SDM   
Sbjct  21   IDFPENS--PHFSLSSDQFNYCSRALQSLKQK-LENPQLIRREFDSLQEKRIKSSDMMRL  77

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV-SEHVSRFIAT  572
            C VALD +N++KNRYTDV+PFDS RVVL  CKDYR SA+GYINAS+I   +++ ++FIAT
Sbjct  78   CTVALDPVNLNKNRYTDVIPFDSTRVVLISCKDYRPSAKGYINASIIKAPAQNAAQFIAT  137

Query  573  QGPLXNTFEDFWGMVIQNRCPAI  641
            QGPL +TFEDFW MV+QNRCPAI
Sbjct  138  QGPLSHTFEDFWEMVLQNRCPAI  160



>ref|XP_009348840.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009348841.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009348842.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
Length=339

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             + S DS PP+L L+ DQ +YCS+ALK+ KEK  Q  + I QEF  LQA RM +S+M+  
Sbjct  16   LNVSADSPPPKLALTPDQYKYCSQALKLFKEK-LQMRDHINQEFAQLQAKRMTSSEMKRN  74

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASL--ITVSEHVSRFIA  569
            C VALD++N SKNRYTDV+PFD NRVVLN  KDYR SARGYINASL   + SE +S+FIA
Sbjct  75   CTVALDNVNSSKNRYTDVVPFDKNRVVLNSSKDYRPSARGYINASLITTSSSESISQFIA  134

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MV++ RCP +
Sbjct  135  TQGPLPHTYEDFWEMVLEQRCPVV  158



>ref|XP_007020251.1| Tyrosine phosphatase 1 isoform 3 [Theobroma cacao]
 gb|EOY17476.1| Tyrosine phosphatase 1 isoform 3 [Theobroma cacao]
Length=278

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PPR+ L+  Q  YCS ALK+  EK    P +I +EF  LQANR+R S+M   
Sbjct  20   FVFSAD-YPPRVSLTPSQFNYCSRALKLFSEKLLM-PHEITREFARLQANRIRPSEMARS  77

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C V L+S+N+ KNRY+DV+PFD NRVVLN CKDYR +A+GYINAS +T   SE++S+FIA
Sbjct  78   CTVGLNSVNLDKNRYSDVVPFDKNRVVLNSCKDYRPAAKGYINASFVTTSSSENISQFIA  137

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGP+ +T+EDFW MVIQ  CP I
Sbjct  138  TQGPIPHTYEDFWEMVIQRHCPVI  161



>gb|KJB35865.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=323

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22   FVFSADP-PPKISLTPDQFNYCSEALKLFSQK-LQMPDEINREFSHLQANRITPSEMMRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C V  +  N+ KNRY+DV+PFD+NRVVL  CKDYR +A+GYINAS +T   SE++S+FIA
Sbjct  80   CTVGFNGANLDKNRYSDVIPFDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MVIQ  CP I
Sbjct  140  TQGPLPHTYEDFWEMVIQCHCPVI  163



>ref|XP_004496384.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cicer arietinum]
 ref|XP_004496385.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Cicer arietinum]
Length=331

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 104/136 (76%), Gaps = 3/136 (2%)
 Frame = +3

Query  240  PPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSI  419
            P R+ L+SDQ+++C+EAL +LK+KR + P  I QEF  LQANR+  S+M  RC VAL+S+
Sbjct  24   PTRISLTSDQVKHCTEALALLKDKR-RNPHTISQEFLHLQANRITPSEMTRRCSVALNSV  82

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIATQGPLXNT  593
            NISKNRYTDVLPFD NRVVLN   DYR +A GYINAS I+ S    VS F+ATQGPL +T
Sbjct  83   NISKNRYTDVLPFDKNRVVLNSSSDYRSAALGYINASFISTSSPGTVSEFLATQGPLPHT  142

Query  594  FEDFWGMVIQNRCPAI  641
            +EDFW M+IQ  CPAI
Sbjct  143  YEDFWEMIIQYHCPAI  158



>gb|KJB35872.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=345

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22   FVFSADP-PPKISLTPDQFNYCSEALKLFSQK-LQMPDEINREFSHLQANRITPSEMMRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C V  +  N+ KNRY+DV+PFD+NRVVL  CKDYR +A+GYINAS +T   SE++S+FIA
Sbjct  80   CTVGFNGANLDKNRYSDVIPFDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MVIQ  CP I
Sbjct  140  TQGPLPHTYEDFWEMVIQCHCPVI  163



>ref|XP_006606203.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X4 
[Glycine max]
Length=271

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F+FS D+ P R++L+SDQ+ +C++AL +LKEK    P  I QEF  LQANR+  S+MR R
Sbjct  22   FNFSPDN-PSRIILTSDQVNHCTQALNLLKEK-LHDPHVITQEFAHLQANRITPSEMRRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIA  569
            C VA D++N+SKNRYTDVLPF+ NRVVL    DYR  A+GYINASLI+ S   +VS FIA
Sbjct  80   CTVAYDAVNLSKNRYTDVLPFNKNRVVLKSSTDYRPEAQGYINASLISTSSAGNVSHFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T EDFW M+ Q  CP I
Sbjct  140  TQGPLPHTCEDFWEMITQYHCPVI  163



>ref|XP_007020250.1| Tyrosine phosphatase 1 isoform 2 [Theobroma cacao]
 gb|EOY17475.1| Tyrosine phosphatase 1 isoform 2 [Theobroma cacao]
Length=340

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PPR+ L+  Q  YCS ALK+  EK    P +I +EF  LQANR+R S+M   
Sbjct  20   FVFSAD-YPPRVSLTPSQFNYCSRALKLFSEKLLM-PHEITREFARLQANRIRPSEMARS  77

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C V L+S+N+ KNRY+DV+PFD NRVVLN CKDYR +A+GYINAS +T   SE++S+FIA
Sbjct  78   CTVGLNSVNLDKNRYSDVVPFDKNRVVLNSCKDYRPAAKGYINASFVTTSSSENISQFIA  137

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGP+ +T+EDFW MVIQ  CP I
Sbjct  138  TQGPIPHTYEDFWEMVIQRHCPVI  161



>ref|XP_007020249.1| Tyrosine phosphatase 1 isoform 1 [Theobroma cacao]
 gb|EOY17474.1| Tyrosine phosphatase 1 isoform 1 [Theobroma cacao]
Length=343

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 105/144 (73%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PPR+ L+  Q  YCS ALK+  EK    P +I +EF  LQANR+R S+M   
Sbjct  20   FVFSAD-YPPRVSLTPSQFNYCSRALKLFSEKLLM-PHEITREFARLQANRIRPSEMARS  77

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C V L+S+N+ KNRY+DV+PFD NRVVLN CKDYR +A+GYINAS +T   SE++S+FIA
Sbjct  78   CTVGLNSVNLDKNRYSDVVPFDKNRVVLNSCKDYRPAAKGYINASFVTTSSSENISQFIA  137

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGP+ +T+EDFW MVIQ  CP I
Sbjct  138  TQGPIPHTYEDFWEMVIQRHCPVI  161



>gb|KJB35871.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=350

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22   FVFSADP-PPKISLTPDQFNYCSEALKLFSQK-LQMPDEINREFSHLQANRITPSEMMRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C V  +  N+ KNRY+DV+PFD+NRVVL  CKDYR +A+GYINAS +T   SE++S+FIA
Sbjct  80   CTVGFNGANLDKNRYSDVIPFDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MVIQ  CP I
Sbjct  140  TQGPLPHTYEDFWEMVIQCHCPVI  163



>ref|XP_006606202.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Glycine max]
Length=326

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F+FS D+ P R++L+SDQ+ +C++AL +LKEK    P  I QEF  LQANR+  S+MR R
Sbjct  22   FNFSPDN-PSRIILTSDQVNHCTQALNLLKEK-LHDPHVITQEFAHLQANRITPSEMRRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIA  569
            C VA D++N+SKNRYTDVLPF+ NRVVL    DYR  A+GYINASLI+ S   +VS FIA
Sbjct  80   CTVAYDAVNLSKNRYTDVLPFNKNRVVLKSSTDYRPEAQGYINASLISTSSAGNVSHFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T EDFW M+ Q  CP I
Sbjct  140  TQGPLPHTCEDFWEMITQYHCPVI  163



>ref|XP_003556188.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Glycine max]
 ref|XP_006606201.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Glycine max]
Length=338

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F+FS D+ P R++L+SDQ+ +C++AL +LKEK    P  I QEF  LQANR+  S+MR R
Sbjct  22   FNFSPDN-PSRIILTSDQVNHCTQALNLLKEK-LHDPHVITQEFAHLQANRITPSEMRRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIA  569
            C VA D++N+SKNRYTDVLPF+ NRVVL    DYR  A+GYINASLI+ S   +VS FIA
Sbjct  80   CTVAYDAVNLSKNRYTDVLPFNKNRVVLKSSTDYRPEAQGYINASLISTSSAGNVSHFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T EDFW M+ Q  CP I
Sbjct  140  TQGPLPHTCEDFWEMITQYHCPVI  163



>ref|XP_010256308.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Nelumbo nucifera]
Length=344

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 105/146 (72%), Gaps = 4/146 (3%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +PF+FS D  PPRL LS +QL+YCSEA+  LKEK  + PE ++QEF  LQA R+R  DM 
Sbjct  24   KPFEFSSDP-PPRLSLSPEQLQYCSEAITRLKEK-LRVPELLKQEFDRLQATRIRKYDMM  81

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRF  563
            + C VAL+  N  KNRY DVLPFD NRVVL P +D     R YINAS IT   SE++SRF
Sbjct  82   NSCKVALEYTNKEKNRYLDVLPFDQNRVVLKPSEDSISLGRDYINASFITTSSSENLSRF  141

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGPL +TFEDFW MVIQ RCP I
Sbjct  142  IATQGPLPHTFEDFWEMVIQYRCPVI  167



>emb|CDX72837.1| BnaC06g32850D [Brassica napus]
Length=337

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 105/147 (71%), Gaps = 6/147 (4%)
 Frame = +3

Query  216  FDFS-YDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            FDFS  DS  P+L LS DQL YC +ALK+ +EK    P+ I +EF  LQANRM ASDM  
Sbjct  11   FDFSSADSPLPKLSLSPDQLSYCHQALKIFREK-ISDPDSIAREFANLQANRMLASDMLR  69

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV----SEHVSR  560
               VA++S+N  KNRYTDV+PFD+NRVVLNPCKD R SA GY+NASLI      SE VS 
Sbjct  70   SSTVAINSVNFEKNRYTDVVPFDNNRVVLNPCKDSRSSADGYVNASLIKTSSSSSESVSE  129

Query  561  FIATQGPLXNTFEDFWGMVIQNRCPAI  641
            FIATQGPL +T EDFW MVIQ  CP I
Sbjct  130  FIATQGPLPHTIEDFWEMVIQQHCPVI  156



>emb|CAJ77612.1| protein tyrosine phosphatase [Fagus sylvatica]
Length=330

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 107/142 (75%), Gaps = 4/142 (3%)
 Frame = +3

Query  222  FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
            FS DS PPRL L+ DQ+++CSEAL    +K  Q P  + QEF  LQANR+  S+MR  C 
Sbjct  12   FSPDS-PPRLPLTPDQVQHCSEALTFFIDK-LQMPHILNQEFAHLQANRITPSEMRRSCT  69

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASL--ITVSEHVSRFIATQ  575
            VA D++N++KNRYTDV+PFD NRVVLN CKDYR +A+GYINAS    + SE +S+FIATQ
Sbjct  70   VAFDNVNMNKNRYTDVVPFDKNRVVLNSCKDYRPAAKGYINASFITTSSSESISQFIATQ  129

Query  576  GPLXNTFEDFWGMVIQNRCPAI  641
            GPL  T+EDFW MV+QNRCP +
Sbjct  130  GPLPQTYEDFWEMVMQNRCPVV  151



>gb|KHN00785.1| Tyrosine-protein phosphatase non-receptor type 20 [Glycine soja]
Length=333

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F+FS D+ P R++L+SDQ+ +C++AL +LKEK    P  I QEF  LQANR+  S+MR R
Sbjct  22   FNFSPDN-PSRIILTSDQVNHCTQALNLLKEK-LHDPHVITQEFAHLQANRITPSEMRRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIA  569
            C VA D++N+SKNRY+DVLPF+ NRVVL    DYR  A+GYINASL++ S   +VS FIA
Sbjct  80   CTVAYDAVNLSKNRYSDVLPFNKNRVVLKSSTDYRPEAQGYINASLVSTSSAGNVSHFIA  139

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T EDFW M+ Q  CP I
Sbjct  140  TQGPLPHTCEDFWEMITQYHCPVI  163



>ref|XP_009339078.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009339079.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009339080.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
Length=339

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 107/144 (74%), Gaps = 3/144 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             + S DS PP+L L+ DQ +YCS+ALK+ K K  Q  + I QEF  LQA RM +S+ +  
Sbjct  16   LNVSADSPPPKLALTPDQYKYCSQALKLFKGK-LQMRDHINQEFAQLQAKRMTSSERKRN  74

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASL--ITVSEHVSRFIA  569
            C VALD++N SKNRYTDV+PFD NRVVLN  KDYR SARGYINASL   + SE +S+FIA
Sbjct  75   CTVALDNVNSSKNRYTDVVPFDKNRVVLNSSKDYRPSARGYINASLITTSSSESISQFIA  134

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MV++ RCP +
Sbjct  135  TQGPLPHTYEDFWEMVLEQRCPVV  158



>ref|XP_008454605.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Cucumis melo]
Length=238

 Score =   163 bits (413),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 106/145 (73%), Gaps = 4/145 (3%)
 Frame = +3

Query  213  PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            PF FS DS PP L L+  Q++ CS+AL+   + R Q P+ I QEF  LQA R+ ASDMR 
Sbjct  17   PFIFSPDS-PPTLALTPHQIKLCSQALEAFTD-RLQKPDVINQEFARLQAKRITASDMRR  74

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINA--SLITVSEHVSRFI  566
             C VALD++N++KNRY DVLPFD  RVVL+ CKDYR SARGYINA     + S+ +S+FI
Sbjct  75   SCSVALDNVNVNKNRYMDVLPFDETRVVLDSCKDYRPSARGYINASFISTSSSKSLSKFI  134

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T+EDFW MV Q +CPAI
Sbjct  135  ATQGPLPHTYEDFWEMVFQYKCPAI  159



>ref|XP_008454604.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Cucumis melo]
Length=275

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 106/145 (73%), Gaps = 4/145 (3%)
 Frame = +3

Query  213  PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            PF FS DS PP L L+  Q++ CS+AL+   + R Q P+ I QEF  LQA R+ ASDMR 
Sbjct  17   PFIFSPDS-PPTLALTPHQIKLCSQALEAFTD-RLQKPDVINQEFARLQAKRITASDMRR  74

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINA--SLITVSEHVSRFI  566
             C VALD++N++KNRY DVLPFD  RVVL+ CKDYR SARGYINA     + S+ +S+FI
Sbjct  75   SCSVALDNVNVNKNRYMDVLPFDETRVVLDSCKDYRPSARGYINASFISTSSSKSLSKFI  134

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T+EDFW MV Q +CPAI
Sbjct  135  ATQGPLPHTYEDFWEMVFQYKCPAI  159



>ref|XP_008454599.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
 ref|XP_008454600.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
 ref|XP_008454601.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
 ref|XP_008454603.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
Length=333

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 106/145 (73%), Gaps = 4/145 (3%)
 Frame = +3

Query  213  PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            PF FS DS PP L L+  Q++ CS+AL+   + R Q P+ I QEF  LQA R+ ASDMR 
Sbjct  17   PFIFSPDS-PPTLALTPHQIKLCSQALEAFTD-RLQKPDVINQEFARLQAKRITASDMRR  74

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINA--SLITVSEHVSRFI  566
             C VALD++N++KNRY DVLPFD  RVVL+ CKDYR SARGYINA     + S+ +S+FI
Sbjct  75   SCSVALDNVNVNKNRYMDVLPFDETRVVLDSCKDYRPSARGYINASFISTSSSKSLSKFI  134

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T+EDFW MV Q +CPAI
Sbjct  135  ATQGPLPHTYEDFWEMVFQYKCPAI  159



>ref|XP_006390734.1| hypothetical protein EUTSA_v10018624mg [Eutrema salsugineum]
 gb|ESQ28020.1| hypothetical protein EUTSA_v10018624mg [Eutrema salsugineum]
Length=414

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 104/146 (71%), Gaps = 5/146 (3%)
 Frame = +3

Query  216  FDFS-YDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            FDFS  DS P +L LS DQL YC +AL + ++K     + I +EF  LQANR+  S+M+ 
Sbjct  90   FDFSSADSPPSKLSLSPDQLSYCHKALGIFRDKILDR-DSIAREFANLQANRLWPSEMQL  148

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV---SEHVSRF  563
            RC VA++S+N  KNRYTDV+PFD NRV+LNPCKDYR  A+GY+NAS I     SE VS F
Sbjct  149  RCTVAMNSVNSEKNRYTDVVPFDKNRVLLNPCKDYRSPAKGYVNASFIKTSSSSESVSEF  208

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGPL NT EDFW MVIQ  CP I
Sbjct  209  IATQGPLPNTMEDFWEMVIQQHCPII  234



>gb|EYU22866.1| hypothetical protein MIMGU_mgv1a009565mg [Erythranthe guttata]
Length=338

 Score =   160 bits (406),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 100/140 (71%), Gaps = 2/140 (1%)
 Frame = +3

Query  222  FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
            FS  +   R  LS DQLR CSEALK  ++K   +P+ I  EF  L+ +RM+A D RS C 
Sbjct  23   FSAVTTTQRRALSEDQLRSCSEALKFFQQK-LSSPQSIHHEFQILE-DRMKAFDARSSCT  80

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGP  581
            VALDS+N SKNRY +V+P+D+NRV+LN  KDYR S  GYINAS +  SE VS+FIATQGP
Sbjct  81   VALDSVNSSKNRYDNVIPYDNNRVILNQHKDYRPSPTGYINASFVKASEGVSQFIATQGP  140

Query  582  LXNTFEDFWGMVIQNRCPAI  641
            L +T EDFW MV+Q  CPAI
Sbjct  141  LPHTAEDFWEMVMQYHCPAI  160



>ref|XP_010930782.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Elaeis guineensis]
Length=347

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = +3

Query  213  PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            PFD S D  PP LVLS DQL+YCSEAL   K K+ + P KI QEF  LQ  R+   +M  
Sbjct  29   PFDLSSDPPPP-LVLSRDQLKYCSEALAFFK-KKLKNPAKISQEFDRLQEMRLSKDEMVG  86

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFI  566
            RC VAL   N++KNRY DVLPFD  RVVLN  +D +     YINAS + ++    VSRFI
Sbjct  87   RCGVALQDANLNKNRYIDVLPFDDTRVVLNSSRDNKSLGNDYINASFVKIASGGRVSRFI  146

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL  TFEDFW M+IQ RCP I
Sbjct  147  ATQGPLPETFEDFWEMIIQYRCPVI  171



>gb|KGN44430.1| hypothetical protein Csa_7G290530 [Cucumis sativus]
Length=310

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 103/144 (72%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS DS PP L+L+  Q++ CS+AL+   +K  Q P+ I QEF  LQA R+ AS M  R
Sbjct  62   FIFSPDS-PPTLLLTPHQIKLCSQALEAFTDK-LQKPDVINQEFARLQAKRITASGMGRR  119

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINA--SLITVSEHVSRFIA  569
            C VALD +N+ KNRY DVLPFD  RVVL+ CKDYR SARGYINA     + S+ +S+FIA
Sbjct  120  CSVALDKVNVYKNRYMDVLPFDETRVVLDSCKDYRPSARGYINASFISTSSSKSLSKFIA  179

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MV Q +CPAI
Sbjct  180  TQGPLPHTYEDFWEMVFQYKCPAI  203



>ref|XP_008461479.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Cucumis melo]
Length=311

 Score =   158 bits (399),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 102/142 (72%), Gaps = 4/142 (3%)
 Frame = +3

Query  222  FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
            FS DS PP L L   Q++ CS+AL+   +K  Q P+ I QEF  LQA R+ ASDMR  C 
Sbjct  75   FSPDS-PPTLALKPHQIKLCSQALEAFTDK-LQKPDVINQEFARLQAKRITASDMRRSCS  132

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINA--SLITVSEHVSRFIATQ  575
            VALD++N++KNRY DVLPFD  RVVL+ CKDYR S RGYINA     + S+ +S+FIATQ
Sbjct  133  VALDNVNVNKNRYMDVLPFDETRVVLDSCKDYRPSVRGYINASFISTSSSKSLSKFIATQ  192

Query  576  GPLXNTFEDFWGMVIQNRCPAI  641
            GPL +T+EDFW MV Q +CPAI
Sbjct  193  GPLPHTYEDFWEMVFQYKCPAI  214



>ref|XP_008461478.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Cucumis melo]
Length=330

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 102/142 (72%), Gaps = 4/142 (3%)
 Frame = +3

Query  222  FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
            FS DS PP L L   Q++ CS+AL+   +K  Q P+ I QEF  LQA R+ ASDMR  C 
Sbjct  75   FSPDS-PPTLALKPHQIKLCSQALEAFTDK-LQKPDVINQEFARLQAKRITASDMRRSCS  132

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINA--SLITVSEHVSRFIATQ  575
            VALD++N++KNRY DVLPFD  RVVL+ CKDYR S RGYINA     + S+ +S+FIATQ
Sbjct  133  VALDNVNVNKNRYMDVLPFDETRVVLDSCKDYRPSVRGYINASFISTSSSKSLSKFIATQ  192

Query  576  GPLXNTFEDFWGMVIQNRCPAI  641
            GPL +T+EDFW MV Q +CPAI
Sbjct  193  GPLPHTYEDFWEMVFQYKCPAI  214



>ref|XP_004139702.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Cucumis sativus]
Length=377

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 103/144 (72%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS DS PP L+L+  Q++ CS+AL+   +K  Q P+ I QEF  LQA R+ AS M  R
Sbjct  62   FIFSPDS-PPTLLLTPHQIKLCSQALEAFTDK-LQKPDVINQEFARLQAKRITASGMGRR  119

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINA--SLITVSEHVSRFIA  569
            C VALD +N+ KNRY DVLPFD  RVVL+ CKDYR SARGYINA     + S+ +S+FIA
Sbjct  120  CSVALDKVNVYKNRYMDVLPFDETRVVLDSCKDYRPSARGYINASFISTSSSKSLSKFIA  179

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MV Q +CPAI
Sbjct  180  TQGPLPHTYEDFWEMVFQYKCPAI  203



>ref|XP_004165623.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Cucumis sativus]
Length=377

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 103/144 (72%), Gaps = 4/144 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS DS PP L+L+  Q++ CS+AL+   +K  Q P+ I QEF  LQA R+ AS M  R
Sbjct  62   FIFSPDS-PPTLLLTPHQIKLCSQALEAFTDK-LQKPDVINQEFARLQAKRITASGMGRR  119

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINA--SLITVSEHVSRFIA  569
            C VALD +N+ KNRY DVLPFD  RVVL+ CKDYR SARGYINA     + S+ +S+FIA
Sbjct  120  CSVALDKVNVYKNRYMDVLPFDETRVVLDSCKDYRPSARGYINASFISTSSSKSLSKFIA  179

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T+EDFW MV Q +CPAI
Sbjct  180  TQGPLPHTYEDFWEMVFQYKCPAI  203



>ref|XP_008461477.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
Length=388

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 102/142 (72%), Gaps = 4/142 (3%)
 Frame = +3

Query  222  FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
            FS DS PP L L   Q++ CS+AL+   +K  Q P+ I QEF  LQA R+ ASDMR  C 
Sbjct  75   FSPDS-PPTLALKPHQIKLCSQALEAFTDK-LQKPDVINQEFARLQAKRITASDMRRSCS  132

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINA--SLITVSEHVSRFIATQ  575
            VALD++N++KNRY DVLPFD  RVVL+ CKDYR S RGYINA     + S+ +S+FIATQ
Sbjct  133  VALDNVNVNKNRYMDVLPFDETRVVLDSCKDYRPSVRGYINASFISTSSSKSLSKFIATQ  192

Query  576  GPLXNTFEDFWGMVIQNRCPAI  641
            GPL +T+EDFW MV Q +CPAI
Sbjct  193  GPLPHTYEDFWEMVFQYKCPAI  214



>ref|XP_006829464.1| hypothetical protein AMTR_s00247p00015290 [Amborella trichopoda]
 gb|ERM96880.1| hypothetical protein AMTR_s00247p00015290 [Amborella trichopoda]
Length=345

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = +3

Query  243  PRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSIN  422
            P L L  DQLR+CSEAL +LK K+ Q P K+ QEF  LQANR+R SDM  RC VAL   N
Sbjct  34   PSLTLLPDQLRHCSEALALLK-KKIQTPFKLNQEFDALQANRLRKSDMLRRCQVALQEAN  92

Query  423  ISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIATQGPLXNTF  596
             +KNRY DVLPFD +RVVLN  ++ + S  GYINAS +T +  E + +FIATQGPL  TF
Sbjct  93   ANKNRYGDVLPFDDSRVVLNQNRNNKSSGSGYINASFVTNTSCERLPQFIATQGPLPETF  152

Query  597  EDFWGMVIQNRCPAI  641
            EDFW MVIQ  CP I
Sbjct  153  EDFWEMVIQFHCPVI  167



>gb|KEH43588.1| tyrosine phosphatase [Medicago truncatula]
Length=321

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 98/136 (72%), Gaps = 3/136 (2%)
 Frame = +3

Query  240  PPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSI  419
            P R+ L+SDQ+ +C++AL +LK K  + P+ I QEF  LQANR+  S+   RC VAL+S+
Sbjct  23   PSRIPLTSDQVNHCTKALALLKNK-LRNPDTILQEFLHLQANRITLSESTRRCNVALNSV  81

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIATQGPLXNT  593
            NI+KNRY DV+PFD NRVVLN   DYR  + GYINAS I  S    VS FIATQGPL +T
Sbjct  82   NINKNRYKDVIPFDKNRVVLNSSSDYRSESLGYINASFILTSSTGTVSEFIATQGPLPHT  141

Query  594  FEDFWGMVIQNRCPAI  641
            +EDFW M++Q  CPAI
Sbjct  142  YEDFWEMIMQYNCPAI  157



>gb|KEH43589.1| tyrosine phosphatase [Medicago truncatula]
Length=331

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 98/136 (72%), Gaps = 3/136 (2%)
 Frame = +3

Query  240  PPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSI  419
            P R+ L+SDQ+ +C++AL +LK K  + P+ I QEF  LQANR+  S+   RC VAL+S+
Sbjct  23   PSRIPLTSDQVNHCTKALALLKNK-LRNPDTILQEFLHLQANRITLSESTRRCNVALNSV  81

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIATQGPLXNT  593
            NI+KNRY DV+PFD NRVVLN   DYR  + GYINAS I  S    VS FIATQGPL +T
Sbjct  82   NINKNRYKDVIPFDKNRVVLNSSSDYRSESLGYINASFILTSSTGTVSEFIATQGPLPHT  141

Query  594  FEDFWGMVIQNRCPAI  641
            +EDFW M++Q  CPAI
Sbjct  142  YEDFWEMIMQYNCPAI  157



>ref|NP_974127.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
 gb|AEE35241.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
Length=277

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 92/128 (72%), Gaps = 5/128 (4%)
 Frame = +3

Query  264  DQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYT  443
            DQL +C +AL V + K  Q P+ I  EF  LQANRM  S++     VA++S+N+ KNRY+
Sbjct  36   DQLNHCHQALGVFRGK-IQNPDSIAHEFTGLQANRMWPSELLLNSTVAMNSVNVEKNRYS  94

Query  444  DVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIATQGPLXNTFEDFWGMV  617
            DV+PFD NR+VLNPCKD   SA+GY+NASLI    SE +S+FIATQGPL +T EDFW MV
Sbjct  95   DVVPFDKNRIVLNPCKD--SSAKGYVNASLIKTSESESISQFIATQGPLPHTMEDFWEMV  152

Query  618  IQNRCPAI  641
            IQ  CP I
Sbjct  153  IQQHCPII  160



>gb|ACY78390.1| protein tyrosine phosphatase 1 [Phalaenopsis amabilis]
Length=346

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 96/136 (71%), Gaps = 3/136 (2%)
 Frame = +3

Query  240  PPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSI  419
            PP + LS DQL+ CSEAL + K K    P KI QEF  +Q  R+R  D+  +C VAL + 
Sbjct  36   PPPICLSPDQLKQCSEALAIFKRKLL-TPGKIAQEFDRIQDMRVRKLDVLRKCRVALHAD  94

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIATQGPLXNT  593
            N++KNRY DV+P+DS+RVVLN  ++   S  GYINAS IT   SE +SRFIATQGPL +T
Sbjct  95   NLAKNRYADVIPYDSSRVVLNLTEEDNHSNGGYINASFITAGFSEKLSRFIATQGPLPDT  154

Query  594  FEDFWGMVIQNRCPAI  641
            FEDFW MVIQ RCPAI
Sbjct  155  FEDFWEMVIQYRCPAI  170



>ref|XP_008781548.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Phoenix 
dactylifera]
Length=347

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = +3

Query  213  PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            P D S D  PP L+LS DQL++CSEAL   K K+ + P KI QEF  LQ  R+   +M  
Sbjct  29   PSDLSSDPPPP-LILSRDQLKHCSEALAFFK-KKLKNPAKISQEFDRLQEMRLTKDEMVR  86

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFI  566
            RC VA    N+SKNRY DVLPFD  RVVLN     + S   YINAS +T+  S  VSRFI
Sbjct  87   RCRVAFQDANLSKNRYIDVLPFDDTRVVLNSSSGSKSSGNDYINASFVTIASSGRVSRFI  146

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +TFEDFW M+IQ RCP I
Sbjct  147  ATQGPLPDTFEDFWEMIIQYRCPVI  171



>ref|NP_177331.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
 ref|NP_001031266.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
 sp|O82656.1|PTP1_ARATH RecName: Full=Protein-tyrosine-phosphatase PTP1; AltName: Full=Protein 
tyrosine phosphatase 1; Short=AtPTP1 [Arabidopsis 
thaliana]
 gb|AAF43239.1|AC012654_23 Strong similarity to the tyrosine phosphatase from Arabidopsis 
thaliana gb|AJ006309. EST gb|AA042465 comes from this gene 
[Arabidopsis thaliana]
 emb|CAA06978.1| protein tyrosine phosphatase [Arabidopsis thaliana]
 gb|AAL49899.1| putative protein tyrosine phosphatase [Arabidopsis thaliana]
 gb|AAM51315.1| putative protein tyrosine phosphatase [Arabidopsis thaliana]
 gb|AEE35242.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
 gb|AEE35243.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
Length=340

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 92/128 (72%), Gaps = 5/128 (4%)
 Frame = +3

Query  264  DQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYT  443
            DQL +C +AL V + K  Q P+ I  EF  LQANRM  S++     VA++S+N+ KNRY+
Sbjct  36   DQLNHCHQALGVFRGK-IQNPDSIAHEFTGLQANRMWPSELLLNSTVAMNSVNVEKNRYS  94

Query  444  DVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIATQGPLXNTFEDFWGMV  617
            DV+PFD NR+VLNPCKD   SA+GY+NASLI    SE +S+FIATQGPL +T EDFW MV
Sbjct  95   DVVPFDKNRIVLNPCKD--SSAKGYVNASLIKTSESESISQFIATQGPLPHTMEDFWEMV  152

Query  618  IQNRCPAI  641
            IQ  CP I
Sbjct  153  IQQHCPII  160



>gb|AAC68859.1| protein tyrosine phosphatase 1 [Arabidopsis thaliana]
Length=340

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 91/128 (71%), Gaps = 5/128 (4%)
 Frame = +3

Query  264  DQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYT  443
            DQL +C +AL V + K  Q P+ I  EF  LQANRM  S++     VA++S+N+ KNRY+
Sbjct  36   DQLNHCHQALGVFRGK-IQNPDSIAHEFTGLQANRMWPSELLLNSTVAMNSVNVEKNRYS  94

Query  444  DVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIATQGPLXNTFEDFWGMV  617
            DV+PFD NR+VLNPCKD   SA+GY+NASLI    SE +S+FIATQGPL +T E FW MV
Sbjct  95   DVVPFDKNRIVLNPCKD--SSAKGYVNASLIKTSESESISQFIATQGPLPHTMEAFWEMV  152

Query  618  IQNRCPAI  641
            IQ  CP I
Sbjct  153  IQQHCPII  160



>ref|XP_006345138.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Solanum tuberosum]
Length=187

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/95 (72%), Positives = 79/95 (83%), Gaps = 6/95 (6%)
 Frame = +3

Query  357  QANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLI  536
            QA RMRAS+M+SRC +AL+S NISKNRYTDVLPFD+NRVVL+P       ARGYINAS I
Sbjct  3    QATRMRASEMKSRCSMALNSTNISKNRYTDVLPFDNNRVVLDP------PARGYINASFI  56

Query  537  TVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             +SE VS+FIATQGPL +TFEDFW M+IQ+RCP I
Sbjct  57   KISEDVSQFIATQGPLQHTFEDFWEMIIQHRCPVI  91



>ref|XP_009404327.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Musa acuminata 
subsp. malaccensis]
Length=335

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 91/136 (67%), Gaps = 3/136 (2%)
 Frame = +3

Query  240  PPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSI  419
            PP L  S +QL+YCSEAL   KEK  + P +I QEF  LQ  R    ++  +C VAL   
Sbjct  25   PPPLRPSGEQLKYCSEALDFFKEK-LRTPTRIAQEFHRLQEMRPTMDEIVRKCSVALRDA  83

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIATQGPLXNT  593
            N+ KNRYTD+LPFD+NR+VLN  +D       YINASLI ++  E VS+FIATQGPL  T
Sbjct  84   NLDKNRYTDILPFDNNRIVLNSTRDSTSLRNNYINASLIGLASGEKVSQFIATQGPLPET  143

Query  594  FEDFWGMVIQNRCPAI  641
            FEDFW MV + RCPAI
Sbjct  144  FEDFWEMVFEYRCPAI  159



>emb|CAA06615.1| protein tyrosine phosphatase [Pisum sativum]
Length=332

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 97/136 (71%), Gaps = 3/136 (2%)
 Frame = +3

Query  240  PPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSI  419
            P R+ L+SDQ+++C+EAL +LK K    P  + Q+F  LQ+NR+  S+   +C VAL+S 
Sbjct  24   PSRIPLTSDQIKHCTEALALLKNKL-LNPHTVSQKFFHLQSNRITLSETTKKCHVALNSA  82

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRFIATQGPLXNT  593
            N+SKNRY+DV+PFD NRVVL    DYR  A GYINAS I+ S    VS FIATQGP+ +T
Sbjct  83   NLSKNRYSDVIPFDKNRVVLKSSSDYRSEALGYINASKISTSSPGIVSEFIATQGPMPHT  142

Query  594  FEDFWGMVIQNRCPAI  641
            FEDFW M+IQ  CPAI
Sbjct  143  FEDFWEMMIQYHCPAI  158



>ref|XP_007143629.1| hypothetical protein PHAVU_007G087900g [Phaseolus vulgaris]
 gb|ESW15623.1| hypothetical protein PHAVU_007G087900g [Phaseolus vulgaris]
Length=343

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 87/115 (76%), Gaps = 4/115 (3%)
 Frame = +3

Query  309  KRFQAPEKIRQE--FGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLN  482
            K ++ P  +  +   G ++ANR+  S+MR RC VALD++N+SKNRYTDVLPFDSNRV L 
Sbjct  55   KEWKTPRDLTLDNVIGNIEANRITPSEMRRRCTVALDAVNLSKNRYTDVLPFDSNRVALK  114

Query  483  PCKDYRQSARGYINASLITVSE--HVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
               DYR +A+GYINASL++ S   +VS+F+ATQGPL +T+EDFW M+IQ  CPAI
Sbjct  115  SSTDYRPAAQGYINASLVSTSSPGNVSQFVATQGPLPHTYEDFWEMIIQYHCPAI  169



>ref|XP_009390761.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=336

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 89/145 (61%), Gaps = 4/145 (3%)
 Frame = +3

Query  213  PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            P D   D  PP L LS +Q   CSEAL   K +R + P KI Q F  LQ  R+   +M  
Sbjct  18   PGDLCSDPPPP-LRLSREQHELCSEALAFFK-RRLRTPAKIAQAFDRLQEMRLTKDEMMR  75

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFI  566
            +C VAL   N+ KNRY DVLPFD+NR++L+  K    SA GYINAS I +   E VSRFI
Sbjct  76   KCSVALRDANLVKNRYMDVLPFDNNRIILDSTKGNTSSANGYINASFIGIGTGEKVSRFI  135

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL  T  DFW MV Q+RCP I
Sbjct  136  ATQGPLPETSGDFWEMVFQHRCPVI  160



>ref|XP_009390760.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=337

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 89/145 (61%), Gaps = 4/145 (3%)
 Frame = +3

Query  213  PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            P D   D  PP L LS +Q   CSEAL   K +R + P KI Q F  LQ  R+   +M  
Sbjct  18   PGDLCSDPPPP-LRLSREQHELCSEALAFFK-RRLRTPAKIAQAFDRLQEMRLTKDEMMR  75

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFI  566
            +C VAL   N+ KNRY DVLPFD+NR++L+  K    SA GYINAS I +   E VSRFI
Sbjct  76   KCSVALRDANLVKNRYMDVLPFDNNRIILDSTKGNTSSANGYINASFIGIGTGEKVSRFI  135

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL  T  DFW MV Q+RCP I
Sbjct  136  ATQGPLPETSGDFWEMVFQHRCPVI  160



>ref|XP_010674720.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Beta vulgaris 
subsp. vulgaris]
Length=325

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 93/139 (67%), Gaps = 15/139 (11%)
 Frame = +3

Query  243  PRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR----SRCLVAL  410
            P+L LSSDQ+++C  AL  L  K  ++   I+ EF TL+A  M+ SD+     + C VA+
Sbjct  16   PQLSLSSDQMQHCHHALDYLILK-CESSNLIQHEFETLEAKSMKESDVERLKTTICTVAI  74

Query  411  DSINISKNRYTDVLPFDSN-RVVLNPCKDYRQSARGYINASLITV-SEHVSRFIATQGPL  584
            D +N+ KNRY +VLP+D+N RV+L P        R YINAS +   +++ ++FIATQGPL
Sbjct  75   DDVNLDKNRYPNVLPYDNNNRVILAP--------RDYINASFVKAPAQNAAQFIATQGPL  126

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +TFEDFW MV+QNRCP I
Sbjct  127  PHTFEDFWEMVLQNRCPVI  145



>ref|XP_004299356.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Fragaria vesca 
subsp. vesca]
 ref|XP_004299357.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Fragaria vesca 
subsp. vesca]
Length=356

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 90/144 (63%), Gaps = 11/144 (8%)
 Frame = +3

Query  213  PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            P  FS+  + PR+VL+ DQ ++CS+ALKV K+K    P  I +EF  L    +    +  
Sbjct  42   PEYFSFSPRRPRVVLTPDQHKWCSQALKVFKDK-LDKPGLISREFDELYERAV----VEK  96

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARG-YINASLITVSEHVSRFIA  569
             C V L S N  KNRY ++LPFD +RVVL   K    S+ G YINAS +T S   SRFIA
Sbjct  97   SCNVGLSSANWRKNRYDEILPFDESRVVL---KGRSNSSGGDYINASFVTTS--ASRFIA  151

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL NT+EDFW MV+Q RCP I
Sbjct  152  TQGPLPNTYEDFWEMVMQYRCPVI  175



>ref|XP_010237888.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like, partial [Brachypodium 
distachyon]
Length=440

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 85/145 (59%), Gaps = 16/145 (11%)
 Frame = +3

Query  231  DSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL---  401
            D+ PP   L+ DQ+++C  ALKV  EK+ + P  I QEF  LQ       D+R + L   
Sbjct  137  DAVPPPRTLTRDQVKHCKNALKVF-EKKLKDPAAISQEFRALQ-------DIRKQLLSTQ  188

Query  402  ---VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHV--SRFI  566
               VA +  N  +NRYTDVLPFD  R+ L        ++  YINASLI  ++    ++FI
Sbjct  189  KFTVAQNPANGERNRYTDVLPFDETRIKLQSSTGNETASNDYINASLIKRNDGSDQTKFI  248

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            +TQGPL NTFEDFW MV +N CP I
Sbjct  249  STQGPLVNTFEDFWQMVFENSCPVI  273



>dbj|BAJ94079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 83/145 (57%), Gaps = 5/145 (3%)
 Frame = +3

Query  213  PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            PFD   D  PP L L+ +Q++ C +AL    E+R +  + +  EF  LQ  R    ++  
Sbjct  67   PFDIEAD--PPPLALTPEQIKLCKDALAHF-ERRSKQLDVLSDEFQLLQGMRTMHPELMK  123

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFI  566
               VA D+ N  KNRY DVLPFD  RV L      + S   YINAS +  +E   V+RFI
Sbjct  124  MSSVACDAANREKNRYIDVLPFDDTRVRLKSSATNQISGNDYINASFVKATEDNSVARFI  183

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            +TQGPL  TFEDFW M+ +N+CP I
Sbjct  184  STQGPLVRTFEDFWEMICENQCPVI  208



>dbj|BAJ98480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 83/145 (57%), Gaps = 5/145 (3%)
 Frame = +3

Query  213  PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            PFD   D  PP L L+ +Q++ C +AL    E+R +  + +  EF  LQ  R    ++  
Sbjct  80   PFDIEAD--PPPLALTPEQIKLCKDALAHF-ERRSKQLDVLSDEFQLLQGMRTMHPELMK  136

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFI  566
               VA D+ N  KNRY DVLPFD  RV L      + S   YINAS +  +E   V+RFI
Sbjct  137  MSSVACDAANREKNRYIDVLPFDDTRVRLKSSATNQISGNDYINASFVKATEDNSVARFI  196

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            +TQGPL  TFEDFW M+ +N+CP I
Sbjct  197  STQGPLVRTFEDFWEMICENQCPVI  221



>gb|ABK26026.1| unknown [Picea sitchensis]
Length=358

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 81/134 (60%), Gaps = 3/134 (2%)
 Frame = +3

Query  246  RLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINI  425
            R+ L+  QL  CSE+L +LK K      K  +EF  LQ  R + S+   R  VA  + NI
Sbjct  49   RVALTPAQLNGCSESLNILK-KMCNIHNKTSKEFEMLQMRRAKGSEFMRRTSVARQNGNI  107

Query  426  SKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLIT--VSEHVSRFIATQGPLXNTFE  599
             KNRY DV+PFD  RVVLN  K    +   YINAS I    SE++ +FIATQGPL  T E
Sbjct  108  YKNRYPDVIPFDDTRVVLNYNKRSPCAGSDYINASYIVNPSSENLPKFIATQGPLPETSE  167

Query  600  DFWGMVIQNRCPAI  641
            DFW M+IQ+RCP I
Sbjct  168  DFWQMIIQHRCPVI  181



>ref|XP_008358192.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Malus domestica]
Length=374

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 79/132 (60%), Gaps = 4/132 (3%)
 Frame = +3

Query  246  RLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINI  425
            R+ L+  Q   C+ ALK  K+K  + PE+I +E+  L A  +  S+   RC VAL+++N 
Sbjct  46   RVALTPQQHENCAFALKFFKDK-LRMPEQINREWDQLDAIYITQSEADKRCTVALNTLNF  104

Query  426  SKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFEDF  605
             KNRY + + FD NRVVL  C      A  YINAS IT     S FIATQGPL +TFE F
Sbjct  105  CKNRYDEYVAFDENRVVLKSCA---AGAGDYINASFITTPSSSSCFIATQGPLSHTFEAF  161

Query  606  WGMVIQNRCPAI  641
            W MVIQ RC  I
Sbjct  162  WEMVIQYRCSVI  173



>ref|XP_009363145.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
Length=428

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 79/132 (60%), Gaps = 6/132 (5%)
 Frame = +3

Query  246  RLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINI  425
            R+ L+  Q   C+ ALK  K+K  + PE+I +E+  L A  +  S+   RC VAL+++N 
Sbjct  46   RVALTPQQHENCAFALKFFKDK-LRMPEQINREWDQLDAIYITQSEAEKRCTVALNTLNF  104

Query  426  SKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFEDF  605
             KNRY + + FD NRVVLN C     +A  YINAS I      S FI TQGPL +T E F
Sbjct  105  CKNRYDEYVGFDENRVVLNSC-----TAGDYINASFIATPSSSSCFIVTQGPLSHTLEAF  159

Query  606  WGMVIQNRCPAI  641
            W MVIQNRC  I
Sbjct  160  WEMVIQNRCSVI  171



>dbj|BAK00963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 86/145 (59%), Gaps = 7/145 (5%)
 Frame = +3

Query  213  PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            P D + D  PP  VL+ DQ+++C  ALKV  +K+ + P  I ++FG L A R  +  +  
Sbjct  61   PLDPTAD--PPARVLTPDQVKHCKTALKVF-DKKLKKPAAIFEDFGGLPAIRT-SLQLAQ  116

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFI  566
            +  VA    N  +NRYTDVL FD  R+ L        S+  YINASLI     +H+ +FI
Sbjct  117  KFTVARSPANRERNRYTDVLAFDETRIKLQSSTGSLTSSNDYINASLIKYDDKDHI-KFI  175

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            +TQGPL NTFEDFW MV +N CP I
Sbjct  176  STQGPLVNTFEDFWQMVFENSCPVI  200



>ref|XP_008781549.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008781550.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Phoenix 
dactylifera]
Length=278

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 66/101 (65%), Gaps = 2/101 (2%)
 Frame = +3

Query  345  FGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYIN  524
            +  L+  R+   +M  RC VA    N+SKNRY DVLPFD  RVVLN     + S   YIN
Sbjct  2    YLVLEEMRLTKDEMVRRCRVAFQDANLSKNRYIDVLPFDDTRVVLNSSSGSKSSGNDYIN  61

Query  525  ASLITV--SEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
            AS +T+  S  VSRFIATQGPL +TFEDFW M+IQ RCP I
Sbjct  62   ASFVTIASSGRVSRFIATQGPLPDTFEDFWEMIIQYRCPVI  102



>ref|XP_007227330.1| hypothetical protein PRUPE_ppa016082mg [Prunus persica]
 gb|EMJ28529.1| hypothetical protein PRUPE_ppa016082mg [Prunus persica]
Length=361

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 80/140 (57%), Gaps = 22/140 (16%)
 Frame = +3

Query  222  FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
             +YD  P RL L+  Q +YCS ALK  K+K  + PE+I+Q++  +               
Sbjct  58   LAYDLPPRRLTLAPHQYKYCSLALKFFKDK-LRMPEQIKQDWDHIA--------------  102

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGP  581
            +AL+++N SKN Y D +  D NRVVLN       +A  YINAS IT     S FIATQGP
Sbjct  103  LALNNVNFSKNHYDDYVALDENRVVLN-----YSAAGDYINASFITSCS--SSFIATQGP  155

Query  582  LXNTFEDFWGMVIQNRCPAI  641
            L  TFEDFW MVIQ RC  +
Sbjct  156  LSETFEDFWEMVIQYRCSVV  175



>gb|EMT13080.1| Tyrosine-protein phosphatase non-receptor type 20 [Aegilops tauschii]
Length=296

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 76/127 (60%), Gaps = 3/127 (2%)
 Frame = +3

Query  264  DQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYT  443
            DQ+++C  ALKVL +K  + P  I  +F  L A R  +  +  +  VA    N  +NRYT
Sbjct  3    DQVKHCKTALKVL-DKTLKKPAAIFDDFRGLPAIRT-SLQLAQKFTVARSPANRERNRYT  60

Query  444  DVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH-VSRFIATQGPLXNTFEDFWGMVI  620
            DVLPFD  R+ L      + S+  YINASLI   +   ++FI+TQGPL NTFEDFW MV 
Sbjct  61   DVLPFDETRIKLQSSTGNQTSSNDYINASLIKYDDKDQTKFISTQGPLVNTFEDFWQMVF  120

Query  621  QNRCPAI  641
            +N CP I
Sbjct  121  ENSCPVI  127



>gb|EAY82439.1| hypothetical protein OsI_37652 [Oryza sativa Indica Group]
Length=328

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 80/137 (58%), Gaps = 6/137 (4%)
 Frame = +3

Query  237  QPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDS  416
            +PP   L+ +Q+  C EAL+   E     PE +  EF  LQ   MR   MRS    A ++
Sbjct  27   EPPPPALTPEQVGLCREALEYF-EGMCGRPEAMSDEFRRLQD--MRHELMRSSN-EARNA  82

Query  417  INISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIATQGPLXN  590
             N  KNRY DV+PFD+ RV L      + S+  YINAS I V+E   V++FI+TQGPL  
Sbjct  83   ANREKNRYIDVVPFDTTRVRLKRSTTSQTSSNDYINASFIKVTEDNRVAKFISTQGPLAK  142

Query  591  TFEDFWGMVIQNRCPAI  641
            TF+DFW MV + +CP I
Sbjct  143  TFDDFWEMVYEYQCPVI  159



>ref|NP_001066289.1| Os12g0174800 [Oryza sativa Japonica Group]
 gb|ABA96591.1| Protein-tyrosine phosphatase containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA96592.1| Protein-tyrosine phosphatase containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29308.1| Os12g0174800 [Oryza sativa Japonica Group]
 gb|EAZ19814.1| hypothetical protein OsJ_35396 [Oryza sativa Japonica Group]
 dbj|BAG89053.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=328

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 81/140 (58%), Gaps = 12/140 (9%)
 Frame = +3

Query  237  QPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANR---MRASDMRSRCLVA  407
            +PP   L+ +Q+  C EAL+   E     PE +  EF  LQ  R   MR+S+       A
Sbjct  27   EPPPPALTPEQVGLCREALEYF-EGMCGRPEAMSDEFRRLQDTRHELMRSSNE------A  79

Query  408  LDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIATQGP  581
             ++ N  KNRY DV+PFD+ RV L      + S+  YINAS I V+E   V++FI+TQGP
Sbjct  80   RNAANREKNRYIDVVPFDTTRVRLKRSTTSQTSSNDYINASFIKVTEDNRVAKFISTQGP  139

Query  582  LXNTFEDFWGMVIQNRCPAI  641
            L  TF+DFW MV + +CP I
Sbjct  140  LAKTFDDFWEMVYEYQCPVI  159



>ref|XP_010239266.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Brachypodium 
distachyon]
Length=592

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 81/135 (60%), Gaps = 4/135 (3%)
 Frame = +3

Query  240  PPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSI  419
            PP  +++ DQ++ C +ALKVL +K+ +    I QEF +L A  +R + +  +  VA    
Sbjct  280  PPPQMITPDQVKRCKKALKVL-DKKLRQRATILQEFRSLPA--IRTALLTQKFSVARSPA  336

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV-SEHVSRFIATQGPLXNTF  596
            N  KN YTDVLPFD  R+ L        +   YINAS   + + + ++FI+TQGPL NTF
Sbjct  337  NREKNCYTDVLPFDETRIRLQSSTGNHTAKNDYINASPTKLDNRNQTKFISTQGPLVNTF  396

Query  597  EDFWGMVIQNRCPAI  641
            EDFW MV +N CP I
Sbjct  397  EDFWQMVFENCCPVI  411



>tpg|DAA38960.1| TPA: hypothetical protein ZEAMMB73_106189 [Zea mays]
Length=426

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 80/131 (61%), Gaps = 8/131 (6%)
 Frame = +3

Query  252  VLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISK  431
            +L++D++R C +ALK L +K+   P  + +EF +L   R     ++ +  VA    N  +
Sbjct  217  LLTADEVRLCKQALKAL-DKKVGKPATLTKEFRSLPDIRTELQSVQ-KFSVARKQENRGR  274

Query  432  NRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS-EHVSRFIATQGPLXNTFEDFW  608
            NRYTDVLPFD +RV L        +   YINAS I ++  ++++FI+TQGPL NT EDFW
Sbjct  275  NRYTDVLPFDQSRVQLE-----SSTGNDYINASHIEIAGRNLTKFISTQGPLANTIEDFW  329

Query  609  GMVIQNRCPAI  641
             MV +N CP I
Sbjct  330  QMVYENHCPVI  340



>ref|XP_002442903.1| hypothetical protein SORBIDRAFT_08g004710 [Sorghum bicolor]
 gb|EES16741.1| hypothetical protein SORBIDRAFT_08g004710 [Sorghum bicolor]
Length=335

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 80/145 (55%), Gaps = 13/145 (9%)
 Frame = +3

Query  213  PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
            PFD   D  PPR  LS +Q+  CS+AL   ++K  + P+ +  E+  L   R   +    
Sbjct  33   PFDVDTDP-PPRPELSPEQIGLCSDALARFEDKG-KRPDGLSDEYRKLSGIRHMKT----  86

Query  393  RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRFI  566
               VA   +N  KNRY DVLPFD  RV L+     R     YINAS I  +E+  V+ FI
Sbjct  87   -ISVAHYPVNRGKNRYIDVLPFDDTRVRLSA----RPPNNDYINASFIKATENNRVAPFI  141

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            +TQGPL  TF DFW MV + +CPAI
Sbjct  142  STQGPLVKTFGDFWEMVHEYQCPAI  166



>ref|XP_002966338.1| hypothetical protein SELMODRAFT_66231, partial [Selaginella moellendorffii]
 gb|EFJ32365.1| hypothetical protein SELMODRAFT_66231, partial [Selaginella moellendorffii]
Length=299

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 72/129 (56%), Gaps = 4/129 (3%)
 Frame = +3

Query  255  LSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKN  434
            L+  ++  C EA   +  K  + PE I +EF +L+ + +   ++  +   A  +   +K+
Sbjct  4    LTPAEIAACKEAFDAINWK-LETPESIYREFSSLRLSSLPKRELIGKFKAAASNACYNKD  62

Query  435  RYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGM  614
            RY+DVLPFD  RV+L   K   +S   YINA+ +        FIATQGPL  T  DFW M
Sbjct  63   RYSDVLPFDETRVILRKTK---ESDSDYINANFVESPAFGHSFIATQGPLKTTIADFWEM  119

Query  615  VIQNRCPAI  641
            V+Q RCPAI
Sbjct  120  VMQQRCPAI  128



>gb|KJB35867.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=249

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 2/67 (3%)
 Frame = +3

Query  447  VLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIATQGPLXNTFEDFWGMVI  620
            ++  D+NRVVL  CKDYR +A+GYINAS +T S  E++S+FIATQGPL +T+EDFW MVI
Sbjct  1    MVSVDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIATQGPLPHTYEDFWEMVI  60

Query  621  QNRCPAI  641
            Q  CP I
Sbjct  61   QCHCPVI  67



>ref|NP_001149088.1| receptor-type tyrosine-protein phosphatase S [Zea mays]
 gb|ACG34138.1| receptor-type tyrosine-protein phosphatase S precursor [Zea mays]
Length=351

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 82/146 (56%), Gaps = 11/146 (8%)
 Frame = +3

Query  213  PFDFSYDSQPP-RLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            PFD   D+ PP RL L+ +Q+  C +AL    E + +  + +  EF +L  + +R     
Sbjct  45   PFDV--DTDPPSRLELTPEQIGLCVDALAHF-EYKGKRRDDLSDEFRSLSVSDIRHMKTI  101

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRF  563
            S   VA   +N  KNRY DVLPFD+ RV L      R     YINAS I  +E+  V+ F
Sbjct  102  S---VAHYPVNREKNRYIDVLPFDNTRVQLKSSA--RPPNNDYINASFIKATENNRVATF  156

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            I+TQGPL  TF DFW MV + +CPAI
Sbjct  157  ISTQGPLVKTFGDFWEMVFEYQCPAI  182



>ref|XP_002978222.1| hypothetical protein SELMODRAFT_56201, partial [Selaginella moellendorffii]
 gb|EFJ20879.1| hypothetical protein SELMODRAFT_56201, partial [Selaginella moellendorffii]
Length=299

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 72/129 (56%), Gaps = 4/129 (3%)
 Frame = +3

Query  255  LSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKN  434
            L+  ++  C EA   +  K  + PE I +EF +L+ + +   ++  +   A  +   +K+
Sbjct  4    LTPAEIAACKEAFDAINWK-LERPESIYREFSSLRLSSLPKRELIGKFKAAASNACYNKD  62

Query  435  RYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGM  614
            RY+DVLPFD  RV+L   K   +S   YINA+ +        FIATQGPL  T  DFW M
Sbjct  63   RYSDVLPFDETRVILRKTK---ESDSDYINANFVESPAFGHSFIATQGPLKTTIADFWEM  119

Query  615  VIQNRCPAI  641
            V+Q RCPAI
Sbjct  120  VMQQRCPAI  128



>ref|XP_002450425.1| hypothetical protein SORBIDRAFT_05g005210 [Sorghum bicolor]
 gb|EES09413.1| hypothetical protein SORBIDRAFT_05g005210 [Sorghum bicolor]
Length=526

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 76/128 (59%), Gaps = 12/128 (9%)
 Frame = +3

Query  267  QLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTD  446
            ++R+C +ALK L E +   P K+ +EF +L   R      + +  VA    N  +NRYTD
Sbjct  239  EVRHCKKALKAL-ENKLGKPAKLAKEFYSLPDIRTELQSAQ-KFSVARKQENRGRNRYTD  296

Query  447  VLPFDSNRVVLNPCKDYRQSARG--YINASLITVS-EHVSRFIATQGPLXNTFEDFWGMV  617
            VLPFD  RV L       QS+ G  YINAS I ++  ++++FI+TQGPL NT E+FW MV
Sbjct  297  VLPFDRTRVRL-------QSSTGNDYINASHIEIAGRNLTKFISTQGPLANTIENFWQMV  349

Query  618  IQNRCPAI  641
              N CP I
Sbjct  350  YDNHCPVI  357



>ref|XP_006664386.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like, partial [Oryza 
brachyantha]
Length=284

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 66/118 (56%), Gaps = 13/118 (11%)
 Frame = +3

Query  306  EKRFQAPEKIRQEFGTLQANRMRASDMRSRCL----VALDSINISKNRYTDVLPFDSNRV  473
            E +   P ++  EF        R  DMR+  L     A D  N  KNRY DV+PFD+ RV
Sbjct  5    EGKCARPGEVSDEFS-------RLPDMRNELLKGSNAARDDANRGKNRYFDVVPFDTTRV  57

Query  474  VLNPCKDYRQSARGYINASLITVSE--HVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             L      + S   YINAS I V+E   V++FI+TQGPL  TFEDFW MV + +CPAI
Sbjct  58   RLKQSTSNQSSRNDYINASFINVTEDNRVAKFISTQGPLVQTFEDFWEMVYEYQCPAI  115



>gb|ACF86150.1| unknown [Zea mays]
 tpg|DAA55534.1| TPA: receptor-type tyrosine-protein phosphatase S [Zea mays]
Length=351

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 80/146 (55%), Gaps = 11/146 (8%)
 Frame = +3

Query  213  PFDFSYDSQPP-RLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            PFD   D+ PP R  L+ +Q+  C +AL    E + +  + +  EF +L  + +R     
Sbjct  45   PFDV--DTDPPSRPELTPEQIGLCVDALAHF-EYKGKRRDDLSDEFRSLSVSDIRHMKTI  101

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRF  563
            S   VA   +N  KNRY DVLPFD  RV L      R     YINAS I  +E+  V+ F
Sbjct  102  S---VAHYPVNREKNRYIDVLPFDDTRVQLKSSA--RPPNNDYINASFIKATENNRVATF  156

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            I+TQGPL  TF DFW MV + +CPAI
Sbjct  157  ISTQGPLVKTFGDFWEMVFEYQCPAI  182



>ref|XP_004977238.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Setaria italica]
Length=259

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 52/88 (59%), Gaps = 2/88 (2%)
 Frame = +3

Query  384  MRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVS  557
            +  R  VA   +N  KNRY DVLPFD  RV L        S   YINAS I  +E   V+
Sbjct  3    LMKRISVAHYPVNREKNRYIDVLPFDDTRVKLKSTTTSLTSNNDYINASFIKATEDNSVA  62

Query  558  RFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             FI TQGPL NTFEDFW MV Q +CPAI
Sbjct  63   TFICTQGPLVNTFEDFWEMVYQYQCPAI  90



>ref|XP_010238660.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Brachypodium distachyon]
Length=262

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = +3

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSR  560
            R+R  VA D+ N+ KNRY DVLP+D NRV L      + S+  YINAS I  +E    +R
Sbjct  9    RNRFNVACDATNMGKNRYIDVLPYDDNRVRLKLSTS-QISSNDYINASFIKATEDNRSTR  67

Query  561  FIATQGPLXNTFEDFWGMVIQNRCPAI  641
            FI+TQGPL  TFEDFW MV +N+C  I
Sbjct  68   FISTQGPLVKTFEDFWEMVCENQCRVI  94



>gb|EMS67302.1| Tyrosine-protein phosphatase Lar-like protein [Triticum urartu]
Length=328

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 73/126 (58%), Gaps = 3/126 (2%)
 Frame = +3

Query  267  QLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTD  446
            Q+++C  ALKVL +K  + P  I  +F  L A R      + +  VA    N  +NRYTD
Sbjct  4    QVKHCKTALKVLDKKL-KKPAAIFDDFRGLPAIRTSLQSAQ-KFTVARSPANRERNRYTD  61

Query  447  VLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH-VSRFIATQGPLXNTFEDFWGMVIQ  623
            VL FD  R+ L      + S+  YINASLI   +   ++FI+TQGPL NTFEDFW MV +
Sbjct  62   VLAFDETRIKLQSSTGNQTSSNDYINASLIKYDDKDQTKFISTQGPLVNTFEDFWQMVFE  121

Query  624  NRCPAI  641
            N CP I
Sbjct  122  NSCPVI  127



>gb|EEC67788.1| hypothetical protein OsI_35345 [Oryza sativa Indica Group]
Length=305

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = +3

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHV---SRFIAT  572
             A +  N  KNRY+DV+PFD  RV L P      S+  YINASLI   +     ++FI+T
Sbjct  56   AAQNPANREKNRYSDVMPFDETRVRLKPSASDHPSSNEYINASLIETDDQGQSHTKFIST  115

Query  573  QGPLXNTFEDFWGMVIQNRCPAI  641
            QGPL  TF DFW MV +N+CP I
Sbjct  116  QGPLVKTFGDFWQMVYENQCPVI  138



>gb|EEE51752.1| hypothetical protein OsJ_33184 [Oryza sativa Japonica Group]
Length=342

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 58/98 (59%), Gaps = 8/98 (8%)
 Frame = +3

Query  372  RASDMRS-----RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLI  536
            R +D+R+     +   A +  N  KNRY+DV+PFD  RV L P      S+  YINASLI
Sbjct  43   RCADIRTAFQTGKFTAAQNPANREKNRYSDVMPFDETRVRLKPSASDHPSSNEYINASLI  102

Query  537  TVSEHV---SRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
               +     ++FI+TQGPL  TF DFW MV +N+CP I
Sbjct  103  ETDDQGQSHTKFISTQGPLVKTFGDFWQMVYENQCPVI  140



>ref|XP_006606204.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Glycine max]
Length=119

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 66/112 (59%), Gaps = 10/112 (9%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANR-MRASDM  386
            +  +F  D+  P + L+ DQ+++C EAL  LK+K    PE I  EF  L+ANR +  S+ 
Sbjct  17   EKLNFWLDNPSP-ISLTWDQVKHCREALTSLKDKFDHTPESITHEFKLLEANRAVTESET  75

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV  542
               C VALD  N SKNR+ DV P D NR++L       +S  GYINAS ++V
Sbjct  76   DKICAVALDRDNFSKNRH-DVYPLDKNRIIL-------KSTHGYINASPMSV  119



>ref|XP_001774836.1| predicted protein [Physcomitrella patens]
 gb|EDQ60377.1| predicted protein [Physcomitrella patens]
Length=272

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 56/86 (65%), Gaps = 3/86 (3%)
 Frame = +3

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRF  563
            S   VA+ S N +KNRY DVLP+D  RV+L+  + Y  +   YINAS +  + H  + R+
Sbjct  8    SSTTVAVMSNNRAKNRYIDVLPYDITRVILDK-RHYDPTCSDYINASFVQDNAHEDLPRY  66

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGPL +T  DFW MV+Q RCP I
Sbjct  67   IATQGPLPSTVSDFWTMVLQQRCPVI  92



>ref|XP_006345139.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Solanum tuberosum]
Length=148

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 6/57 (11%)
 Frame = +3

Query  471  VVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
            VVL+P       ARGYINAS I +SE VS+FIATQGPL +TFEDFW M+IQ+RCP I
Sbjct  2    VVLDP------PARGYINASFIKISEDVSQFIATQGPLQHTFEDFWEMIIQHRCPVI  52



>gb|ABA91789.2| Protein-tyrosine phosphatase containing protein, expressed [Oryza 
sativa Japonica Group]
Length=387

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = +3

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHV---SRFIAT  572
             A +  N  KNRY+DV+PFD  RV L P      S+  YINASLI   +     ++FI+T
Sbjct  85   AAQNPANREKNRYSDVMPFDETRVRLKPSASDHPSSNEYINASLIETDDQGQSHTKFIST  144

Query  573  QGPLXNTFEDFWGMVIQNRCPAI  641
            QGPL  TF DFW MV +N+CP I
Sbjct  145  QGPLVKTFGDFWQMVYENQCPVI  167



>ref|XP_006662779.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Oryza brachyantha]
Length=289

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = +3

Query  405  ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV---SEHVSRFIATQ  575
            AL+  N  KNRY+DV+PFD+ RV L      R S   YINAS I +   ++  ++FI+TQ
Sbjct  36   ALNPANREKNRYSDVMPFDATRVRLKSSTGDRPSRNDYINASHIKIDSRNKSQTQFISTQ  95

Query  576  GPLXNTFEDFWGMVIQNRCPAI  641
            GPL  TFEDFW MV +N+C  I
Sbjct  96   GPLIKTFEDFWQMVYENQCSVI  117



>ref|XP_004978856.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Setaria italica]
 ref|XP_004978857.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Setaria italica]
Length=290

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 50/82 (61%), Gaps = 10/82 (12%)
 Frame = +3

Query  405  ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARG--YINASLI-TVSEHVSRFIATQ  575
            A +++N  +NRYTDVLP D  RV L       QS  G  YINAS I T     ++FI+TQ
Sbjct  46   AREAVNRGRNRYTDVLPIDKTRVRL-------QSPTGNDYINASFINTGGRDQTKFISTQ  98

Query  576  GPLXNTFEDFWGMVIQNRCPAI  641
            GPL  T EDFW MV +N CP I
Sbjct  99   GPLARTIEDFWQMVYENHCPVI  120



>ref|XP_004978858.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Setaria italica]
Length=289

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 50/82 (61%), Gaps = 10/82 (12%)
 Frame = +3

Query  405  ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARG--YINASLI-TVSEHVSRFIATQ  575
            A +++N  +NRYTDVLP D  RV L       QS  G  YINAS I T     ++FI+TQ
Sbjct  46   AREAVNRGRNRYTDVLPIDKTRVRL-------QSPTGNDYINASFINTGGRDQTKFISTQ  98

Query  576  GPLXNTFEDFWGMVIQNRCPAI  641
            GPL  T EDFW MV +N CP I
Sbjct  99   GPLARTIEDFWQMVYENHCPVI  120



>ref|XP_005755886.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
[Pundamilia nyererei]
Length=276

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  114  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEYT  167

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I    H   +IATQGPL +T EDFW MV + +C +I
Sbjct  168  DYVNASFIDGYRHKDYYIATQGPLQHTVEDFWRMVWEWKCHSI  210



>ref|XP_009013665.1| hypothetical protein HELRODRAFT_169572 [Helobdella robusta]
 gb|ESO07876.1| hypothetical protein HELRODRAFT_169572 [Helobdella robusta]
Length=628

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 58/102 (57%), Gaps = 9/102 (9%)
 Frame = +3

Query  336  RQEFGTLQAN--RMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP--CKDYRQ  503
            R+ F TL+     ++  + +  CL+A    N+SKNRY +  PFD NRVVL P  C     
Sbjct  360  RKNFKTLEEEFYSLQKPNPQPECLIASLPENLSKNRYKNYFPFDQNRVVLPPACC-----  414

Query  504  SARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNR  629
            S   YINAS I+   H ++FI  Q PL NT EDFW M+  N+
Sbjct  415  SQSDYINASFISTLYHFNKFITAQCPLPNTVEDFWTMIWVNK  456



>ref|XP_003964025.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
[Takifugu rubripes]
Length=678

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  367  YSFIYQALLEYFLYGDTELDVCSLEGHLHRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  426

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  427  RTGNLPA----NMKKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  480

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  481  ATQGPLSHTVEDFWRMVWEWRCHSI  505


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 4/74 (5%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+   D   S   YINAS I   +  ++FIA QGP   T  
Sbjct  144  NREKNRYPNILPYDHSRVVLS--HDGLHS--DYINASYIDGFKEKNKFIAAQGPKLETVA  199

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  200  DFWRMIWEQKTATI  213



>ref|XP_008197461.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 4 [Tribolium 
castaneum]
 gb|EFA07782.1| hypothetical protein TcasGA2_TC005339 [Tribolium castaneum]
Length=887

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 57/84 (68%), Gaps = 5/84 (6%)
 Frame = +3

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLN--PCKDYRQSARGYINASLITVSEHVSRFIA  569
            C V+L+S NI+KNRY D+ P+DS RV+L   P  DY  +   Y+N   I  ++ ++++IA
Sbjct  631  CDVSLESKNINKNRYRDISPYDSTRVILKNAPSGDYINA--NYVNMK-INGTDIINKYIA  687

Query  570  TQGPLXNTFEDFWGMVIQNRCPAI  641
            TQGPL +T EDFW M+++ +C  I
Sbjct  688  TQGPLQSTCEDFWQMILEEKCNLI  711



>ref|XP_008280566.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
[Stegastes partitus]
Length=680

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  369  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  428

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  429  RTGNLPA----NMKKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  482

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  483  ATQGPLSHTVEDFWRMVWEWRCHSI  507


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+    +  S   Y+NAS I   +  ++FIA QGP   T  
Sbjct  144  NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYVNASYIDGFKEKNKFIAAQGPKLETVA  201

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  202  DFWRMIWEQKTATI  215



>ref|XP_006783786.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Neolamprologus brichardi]
 ref|XP_006783787.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X2 [Neolamprologus brichardi]
 ref|XP_006783788.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X3 [Neolamprologus brichardi]
Length=680

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPE---KIRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  369  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  428

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  429  RTGNLPA----NMKKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  482

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  483  ATQGPLSHTVEDFWRMVWEWRCHSI  507


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  144  NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGYKEKNKFIAAQGPKPETVA  201

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  202  DFWRMIWEQKTATI  215



>ref|XP_005474301.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X4 [Oreochromis niloticus]
Length=680

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPE---KIRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  369  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  428

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  429  RTGNLPA----NMKKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  482

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  483  ATQGPLSHTVEDFWRMVWEWRCHSI  507


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  144  NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGYKEKNKFIAAQGPKPETVA  201

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  202  DFWRMIWEQKTATI  215



>ref|XP_004551587.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
[Maylandia zebra]
 ref|XP_005914223.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X2 [Haplochromis burtoni]
 ref|XP_005914224.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X3 [Haplochromis burtoni]
Length=680

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPE---KIRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  369  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  428

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  429  RTGNLPA----NMKKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  482

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  483  ATQGPLSHTVEDFWRMVWEWRCHSI  507


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  144  NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGYKEKNKFIAAQGPKPETVA  201

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  202  DFWRMIWEQKTTTI  215



>ref|XP_008320617.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
[Cynoglossus semilaevis]
Length=680

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  369  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  428

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  429  RTGNLPA----NMKKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  482

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  483  ATQGPLSHTVEDFWRMVWEWRCHSI  507


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  144  NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGYKEKNKFIAAQGPKLETVA  201

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  202  DFWRMIWEQKTATI  215



>ref|XP_005727504.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
[Pundamilia nyererei]
Length=680

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPE---KIRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  369  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  428

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  429  RTGNLPA----NMKKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  482

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  483  ATQGPLSHTVEDFWRMVWEWRCHSI  507


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  144  NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGYKEKNKFIAAQGPKPETVA  201

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  202  DFWWMIWEQKTTTI  215



>ref|XP_010742249.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X2 [Larimichthys crocea]
Length=636

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  325  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  384

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  385  RTGNLPA----NMKKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  438

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  439  ATQGPLSHTVEDFWRMVWEWRCHSI  463


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +   RFIA QGP   T  
Sbjct  100  NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGFKEKGRFIAAQGPKLETVA  157

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  158  DFWRMIWEQKTATI  171



>ref|XP_010742242.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Larimichthys crocea]
Length=680

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  369  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  428

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  429  RTGNLPA----NMKKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  482

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  483  ATQGPLSHTVEDFWRMVWEWRCHSI  507


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +   RFIA QGP   T  
Sbjct  144  NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGFKEKGRFIAAQGPKLETVA  201

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  202  DFWRMIWEQKTATI  215



>ref|XP_005474298.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Oreochromis niloticus]
 ref|XP_005474299.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X2 [Oreochromis niloticus]
 ref|XP_005474300.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X3 [Oreochromis niloticus]
Length=745

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPE---KIRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  434  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  493

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  494  RTGNLPA----NMKKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  547

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  548  ATQGPLSHTVEDFWRMVWEWRCHSI  572


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  209  NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGYKEKNKFIAAQGPKPETVA  266

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  267  DFWRMIWEQKTATI  280



>dbj|BAC06424.1| protein tyrosine phosphatase e [Oryzias latipes]
Length=419

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPE---KIRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  103  YSFIYQALLEYYLYGDTELDVCSLEGHLHRLHNTRAPNDRLGLEEEFRKLTNVRIMKENM  162

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  163  RTGNLPA----NMRKNRVLQIIPYDFNRVILSVRRG--QEFTDYINASFIDGYRQKDYFI  216

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  217  ATQGPLSHTVEDFWRMVWEWRCHSI  241



>ref|XP_008427552.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X3 [Poecilia reticulata]
Length=576

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  265  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  324

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  325  RTGNLPA----NMRKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  378

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  379  ATQGPLSHTVEDFWRMVWEWRCHSI  403


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RV+L+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  40   NREKNRYPNILPYDHSRVILSQLDGHLCS--DYINASCIDGYKEKNKFIAAQGPKPETLA  97

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  98   DFWRMIWEQKTTTI  111



>ref|XP_004579797.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon 
isoform X2 [Ochotona princeps]
Length=642

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 57/103 (55%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   DMR+  L A    N+ K R   ++P+D NRV+L+  +   Q   
Sbjct  368  LEEEFRKLTNVRILKEDMRTGSLPA----NMKKARVIQIIPYDFNRVILSMKRG--QEHT  421

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I    H   FIATQGPL +T EDFW MV + +C  I
Sbjct  422  DYINASFIDGYRHKDYFIATQGPLAHTVEDFWRMVWECKCHTI  464


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 57/107 (53%), Gaps = 17/107 (16%)
 Frame = +3

Query  336  RQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLN-----PCKDYR  500
            R+EF +L +  ++A+       VA    N  KNRY ++LP D +RV+L+     PC DY 
Sbjct  78   REEFNSLPSGHVQAT-----FEVANKEENREKNRYPNILPNDDSRVILSQVDGLPCSDY-  131

Query  501  QSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
                  INAS I   +  ++FIA QGP   T EDFW M+ + +   I
Sbjct  132  ------INASYIDGYKEKNKFIAAQGPKQETVEDFWRMIWEQKSATI  172



>ref|XP_005914222.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Haplochromis burtoni]
Length=769

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPE---KIRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  458  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  517

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  518  RTGNLPA----NMKKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  571

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  572  ATQGPLSHTVEDFWRMVWEWRCHSI  596


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  233  NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGYKEKNKFIAAQGPKPETVA  290

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  291  DFWRMIWEQKTTTI  304



>ref|XP_007545405.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X3 [Poecilia formosa]
Length=636

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  325  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  384

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  385  RTGNLPA----NMRKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  438

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  439  ATQGPLSHTVEDFWRMVWEWRCHSI  463


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RV+L+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  100  NREKNRYPNILPYDHSRVILSQLDGHLCS--DYINASYIDGYKEKNKFIAAQGPKPETLA  157

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  158  DFWRMIWEQKTTTI  171



>ref|XP_005804936.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
[Xiphophorus maculatus]
Length=680

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  369  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  428

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  429  RTGNLPA----NMRKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  482

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  483  ATQGPLSHTVEDFWRMVWEWRCHSI  507


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RV+L+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  144  NREKNRYPNILPYDHSRVILSQLDGHLCS--DYINASYIDGYKEKNKFIAAQGPKPETLA  201

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  202  DFWRMIWEQKTTTI  215



>gb|ESA02363.1| hypothetical protein GLOINDRAFT_334164 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX78038.1| Ptp1p [Rhizophagus irregularis DAOM 197198w]
Length=319

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = +3

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGP  581
            VA DS+++  NRY+D+LPF+ NRV L   + Y+     YINAS I    +V R+IATQGP
Sbjct  56   VAFDSLSMDYNRYSDILPFNHNRVKLLQQRPYKTD---YINASYIEAPNNVRRYIATQGP  112

Query  582  LXNTFEDFWGMV  617
            L  T EDFW M+
Sbjct  113  LNKTIEDFWLMI  124



>ref|XP_007545404.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X2 [Poecilia formosa]
Length=679

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  368  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  427

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  428  RTGNLPA----NMRKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  481

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  482  ATQGPLSHTVEDFWRMVWEWRCHSI  506


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RV+L+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  144  NREKNRYPNILPYDHSRVILSQLDGHLCS--DYINASYIDGYKEKNKFIAAQGPKPETLA  201

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  202  DFWRMIWEQKTTTI  215



>ref|XP_007545400.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Poecilia formosa]
 ref|XP_007545401.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Poecilia formosa]
Length=680

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  369  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  428

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  429  RTGNLPA----NMRKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  482

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  483  ATQGPLSHTVEDFWRMVWEWRCHSI  507


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RV+L+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  144  NREKNRYPNILPYDHSRVILSQLDGHLCS--DYINASYIDGYKEKNKFIAAQGPKPETLA  201

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  202  DFWRMIWEQKTTTI  215



>ref|XP_008769322.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
isoform X2 [Rattus norvegicus]
Length=349

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 46/76 (61%), Gaps = 9/76 (12%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRF--IATQGPLXNT  593
            N  KNRY D+LP+DS RV L   KDY       INAS I +  H   +  IATQGPL +T
Sbjct  184  NRDKNRYRDILPYDSTRVPLGKNKDY-------INASYIRIVNHEEEYFYIATQGPLPDT  236

Query  594  FEDFWGMVIQNRCPAI  641
             EDFW MV++N C  I
Sbjct  237  IEDFWQMVLENNCNVI  252



>ref|XP_008427549.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Poecilia reticulata]
 ref|XP_008427550.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Poecilia reticulata]
Length=680

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  369  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  428

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  429  RTGNLPA----NMRKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  482

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  483  ATQGPLSHTVEDFWRMVWEWRCHSI  507


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RV+L+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  144  NREKNRYPNILPYDHSRVILSQLDGHLCS--DYINASCIDGYKEKNKFIAAQGPKPETLA  201

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  202  DFWRMIWEQKTTTI  215



>ref|XP_008427551.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X2 [Poecilia reticulata]
Length=679

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  368  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  427

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  428  RTGNLPA----NMRKNRVLQIIPYDFNRVILSVKRG--QEFTDYINASFIDGYRQKDYFI  481

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  482  ATQGPLSHTVEDFWRMVWEWRCHSI  506


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RV+L+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  144  NREKNRYPNILPYDHSRVILSQLDGHLCS--DYINASCIDGYKEKNKFIAAQGPKPETLA  201

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  202  DFWRMIWEQKTTTI  215



>ref|XP_005755424.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like, 
partial [Pundamilia nyererei]
Length=414

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  145  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEYT  198

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I    H   +IATQGPL +T EDFW MV + +C +I
Sbjct  199  DYVNASFIDGYRHKDYYIATQGPLQHTVEDFWRMVWEWKCHSI  241



>ref|XP_010782455.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon 
isoform X2 [Notothenia coriiceps]
Length=636

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  325  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  384

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  385  RTGNLPA----NMKKNRVLQIIPYDFNRVMLSVKRG--QEFTDYINASFIDGYRQKDYFI  438

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  439  ATQGPLSHTVEDFWRMVWEWRCHSI  463


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RV+L+    +  S   YINAS I   +  +RFIA QGP   T  
Sbjct  100  NREKNRYPNILPYDHSRVLLSHLDGHLCS--DYINASYIDGFKEKNRFIAAQGPKLETLA  157

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  158  DFWRMIWEQKTATI  171



>ref|XP_004579796.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon 
isoform X1 [Ochotona princeps]
Length=701

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 57/103 (55%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   DMR+  L A    N+ K R   ++P+D NRV+L+  +   Q   
Sbjct  427  LEEEFRKLTNVRILKEDMRTGSLPA----NMKKARVIQIIPYDFNRVILSMKRG--QEHT  480

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I    H   FIATQGPL +T EDFW MV + +C  I
Sbjct  481  DYINASFIDGYRHKDYFIATQGPLAHTVEDFWRMVWECKCHTI  523


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 57/107 (53%), Gaps = 17/107 (16%)
 Frame = +3

Query  336  RQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLN-----PCKDYR  500
            R+EF +L +  ++A+       VA    N  KNRY ++LP D +RV+L+     PC DY 
Sbjct  137  REEFNSLPSGHVQAT-----FEVANKEENREKNRYPNILPNDDSRVILSQVDGLPCSDY-  190

Query  501  QSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
                  INAS I   +  ++FIA QGP   T EDFW M+ + +   I
Sbjct  191  ------INASYIDGYKEKNKFIAAQGPKQETVEDFWRMIWEQKSATI  231



>ref|XP_010782454.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon 
isoform X1 [Notothenia coriiceps]
Length=680

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  369  YSFIYQALLEYYLYGDTELDVCSLEGHLQRLHNTRAPHDRLGLEEEFRKLTNVRIMKENM  428

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  429  RTGNLPA----NMKKNRVLQIIPYDFNRVMLSVKRG--QEFTDYINASFIDGYRQKDYFI  482

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  483  ATQGPLSHTVEDFWRMVWEWRCHSI  507


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RV+L+    +  S   YINAS I   +  +RFIA QGP   T  
Sbjct  144  NREKNRYPNILPYDHSRVLLSHLDGHLCS--DYINASYIDGFKEKNRFIAAQGPKLETLA  201

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  202  DFWRMIWEQKTATI  215



>ref|XP_003441817.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoformX2 [Oreochromis niloticus]
Length=636

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  367  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEYT  420

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I    H   +IATQGPL +T EDFW MV + +C +I
Sbjct  421  DYVNASFIDGYRHKDYYIATQGPLQHTVEDFWRMVWEWKCHSI  463


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 12/74 (16%)
 Frame = +3

Query  435  RYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            RY ++LP+D +RVVL     NPC DY       +NAS I      ++FI  QGP  +T  
Sbjct  105  RYPNILPYDHSRVVLTELEGNPCSDY-------VNASYIDGYTEKNKFIGAQGPKEDTVA  157

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  158  DFWRMIWEQKVSTI  171



>ref|XP_004561226.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X4 [Maylandia zebra]
 ref|XP_005919552.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X2 [Haplochromis burtoni]
Length=636

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  367  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEYT  420

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I    H   +IATQGPL +T EDFW MV + +C +I
Sbjct  421  DYVNASFIDGYRHKDYYIATQGPLQHTVEDFWRMVWEWKCHSI  463


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 12/74 (16%)
 Frame = +3

Query  435  RYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            RY ++LP+D +RVVL     NPC DY       +NAS I      ++FI  QGP  +T  
Sbjct  105  RYPNILPYDHSRVVLTELEGNPCSDY-------VNASYIDGFTEKNKFIGAQGPKEDTVA  157

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   +
Sbjct  158  DFWRMIWEQKVSTV  171



>ref|XP_002326005.2| hypothetical protein POPTR_0019s11590g, partial [Populus trichocarpa]
 gb|EEF00387.2| hypothetical protein POPTR_0019s11590g, partial [Populus trichocarpa]
Length=216

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 19/94 (20%)
 Frame = +3

Query  360  ANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLIT  539
            A+ +  S M   C VA+DS+N++KNRY DV+P          C      +    N     
Sbjct  1    ASEITPSQMARSCKVAVDSVNVNKNRYLDVVP----------CLQELLLSSSSEN-----  45

Query  540  VSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
                +SRFIATQGPL +T+EDFW M+I + CP I
Sbjct  46   ----ISRFIATQGPLPHTYEDFWEMIILHHCPVI  75



>ref|XP_005471474.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X6 [Oreochromis niloticus]
Length=651

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  382  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEYT  435

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I    H   +IATQGPL +T EDFW MV + +C +I
Sbjct  436  DYVNASFIDGYRHKDYYIATQGPLQHTVEDFWRMVWEWKCHSI  478


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 12/74 (16%)
 Frame = +3

Query  435  RYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            RY ++LP+D +RVVL     NPC DY       +NAS I      ++FI  QGP  +T  
Sbjct  120  RYPNILPYDHSRVVLTELEGNPCSDY-------VNASYIDGYTEKNKFIGAQGPKEDTVA  172

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  173  DFWRMIWEQKVSTI  186



>ref|XP_011482437.1| PREDICTED: protein tyrosine phosphatase e isoform X1 [Oryzias 
latipes]
Length=679

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  368  YSFIYQALLEYYLYGDTELDVCSLEGHLHRLHNTRAPNDRLGLEEEFRKLTNVRIMKENM  427

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  428  RTGNLPA----NMRKNRVLQIIPYDFNRVILSVRRG--QEFTDYINASFIDGYRQKDYFI  481

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  482  ATQGPLSHTVEDFWRMVWEWRCHSI  506


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  143  NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGFKEKNKFIAAQGPKPETLA  200

Query  600  DFWGMVIQNRCPAI  641
            DFW MV + +   I
Sbjct  201  DFWRMVWEQKTTTI  214



>ref|NP_001098558.1| protein tyrosine phosphatase e [Oryzias latipes]
 dbj|BAD02401.1| protein tyrosine phosphatase e [Oryzias latipes]
Length=680

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  368  YSFIYQALLEYYLYGDTELDVCSLEGHLHRLHNTRAPNDRLGLEEEFRKLTNVRIMKENM  427

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  428  RTGNLPA----NMRKNRVLQIIPYDFNRVILSVRRG--QEFTDYINASFIDGYRQKDYFI  481

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  482  ATQGPLSHTVEDFWRMVWEWRCHSI  506


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  143  NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGFKEKNKFIAAQGPKPETLA  200

Query  600  DFWGMVIQNRCPAI  641
            DFW MV + +   I
Sbjct  201  DFWRMVWEQKTTTI  214



>ref|XP_004561225.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X3 [Maylandia zebra]
 ref|XP_005919551.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Haplochromis burtoni]
Length=651

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  382  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEYT  435

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I    H   +IATQGPL +T EDFW MV + +C +I
Sbjct  436  DYVNASFIDGYRHKDYYIATQGPLQHTVEDFWRMVWEWKCHSI  478


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 12/74 (16%)
 Frame = +3

Query  435  RYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            RY ++LP+D +RVVL     NPC DY       +NAS I      ++FI  QGP  +T  
Sbjct  120  RYPNILPYDHSRVVLTELEGNPCSDY-------VNASYIDGFTEKNKFIGAQGPKEDTVA  172

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   +
Sbjct  173  DFWRMIWEQKVSTV  186



>ref|XP_005471473.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X5 [Oreochromis niloticus]
Length=677

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  408  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEYT  461

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I    H   +IATQGPL +T EDFW MV + +C +I
Sbjct  462  DYVNASFIDGYRHKDYYIATQGPLQHTVEDFWRMVWEWKCHSI  504


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 12/74 (16%)
 Frame = +3

Query  435  RYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            RY ++LP+D +RVVL     NPC DY       +NAS I      ++FI  QGP  +T  
Sbjct  146  RYPNILPYDHSRVVLTELEGNPCSDY-------VNASYIDGYTEKNKFIGAQGPKEDTVA  198

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  199  DFWRMIWEQKVSTI  212



>dbj|BAD02404.1| protein tyrosine phosphatase e [Oryzias latipes]
Length=680

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  368  YSFIYQALLEYYLYGDTELDVCSLEGHLHRLHNTRAPNDRLGLEEEFRKLTNVRIMKENM  427

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  428  RTGNLPA----NMRKNRVLQIIPYDFNRVILSVRRG--QEFTDYINASFIDGYRQKDYFI  481

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  482  ATQGPLSHTVEDFWRMVWEWRCHSI  506


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  143  NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGFKEKNKFIAAQGPKPETLA  200

Query  600  DFWGMVIQNRCPAI  641
            DFW MV + +   I
Sbjct  201  DFWRMVWEQKTATI  214



>ref|XP_004561224.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X2 [Maylandia zebra]
Length=680

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  411  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEYT  464

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I    H   +IATQGPL +T EDFW MV + +C +I
Sbjct  465  DYVNASFIDGYRHKDYYIATQGPLQHTVEDFWRMVWEWKCHSI  507


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 12/74 (16%)
 Frame = +3

Query  435  RYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            RY ++LP+D +RVVL     NPC DY       +NAS I      ++FI  QGP  +T  
Sbjct  149  RYPNILPYDHSRVVLTELEGNPCSDY-------VNASYIDGFTEKNKFIGAQGPKEDTVA  201

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   +
Sbjct  202  DFWRMIWEQKVSTV  215



>ref|XP_005471471.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X3 [Oreochromis niloticus]
 ref|XP_005471472.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X4 [Oreochromis niloticus]
Length=692

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  423  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEYT  476

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I    H   +IATQGPL +T EDFW MV + +C +I
Sbjct  477  DYVNASFIDGYRHKDYYIATQGPLQHTVEDFWRMVWEWKCHSI  519


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 12/74 (16%)
 Frame = +3

Query  435  RYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            RY ++LP+D +RVVL     NPC DY       +NAS I      ++FI  QGP  +T  
Sbjct  161  RYPNILPYDHSRVVLTELEGNPCSDY-------VNASYIDGYTEKNKFIGAQGPKEDTVA  213

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   I
Sbjct  214  DFWRMIWEQKVSTI  227



>ref|XP_004561223.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Maylandia zebra]
Length=695

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  426  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEYT  479

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I    H   +IATQGPL +T EDFW MV + +C +I
Sbjct  480  DYVNASFIDGYRHKDYYIATQGPLQHTVEDFWRMVWEWKCHSI  522


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 12/74 (16%)
 Frame = +3

Query  435  RYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            RY ++LP+D +RVVL     NPC DY       +NAS I      ++FI  QGP  +T  
Sbjct  164  RYPNILPYDHSRVVLTELEGNPCSDY-------VNASYIDGFTEKNKFIGAQGPKEDTVA  216

Query  600  DFWGMVIQNRCPAI  641
            DFW M+ + +   +
Sbjct  217  DFWRMIWEQKVSTV  230



>gb|ERE91225.1| tyrosine-protein phosphatase non-receptor type 20-like protein 
[Cricetulus griseus]
Length=425

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 74/146 (51%), Gaps = 28/146 (19%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +P  F+Y SQ              ++ LK+L+ K       I +EF  L+   +   D+R
Sbjct  137  RPLIFNYSSQSA-----------MNDCLKMLQGKN---EYDIIREFLELEQMPL-LDDLR  181

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRF--  563
            S      + +N  KNRY D+LP+DS+RV L   KDY       INAS I +  H   +  
Sbjct  182  S----GNELLNKDKNRYRDILPYDSSRVPLGKNKDY-------INASYIRIVNHEQEYFY  230

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGPL  T EDFW MV++N C  I
Sbjct  231  IATQGPLPETIEDFWQMVMENNCNVI  256



>ref|XP_009888039.1| PREDICTED: receptor-type tyrosine-protein phosphatase kappa-like 
[Charadrius vociferus]
Length=1030

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 61/124 (49%), Gaps = 9/124 (7%)
 Frame = +3

Query  285  EALKVLKEKRFQAPEKI-----RQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDV  449
            EALK  K +  +A +       RQ+ G L+  +  +S +   C    +  N SKNRY  +
Sbjct  444  EALKTFKREEIEAEQNDDESVDRQDAGRLREYQQLSSTLLHPCDAGKELCNQSKNRYKSI  503

Query  450  LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNR  629
            +P+D  RVVL P      +  GYINAS +        FIA QGPL  T  DFW MV Q +
Sbjct  504  IPYDHCRVVLQP----SDTGNGYINASYVDSYRSPRFFIAAQGPLPGTVVDFWQMVWQEK  559

Query  630  CPAI  641
               I
Sbjct  560  TSVI  563



>gb|EDL88897.1| protein tyrosine phosphatase, non-receptor type 20 (predicted) 
[Rattus norvegicus]
Length=242

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 46/76 (61%), Gaps = 9/76 (12%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRF--IATQGPLXNT  593
            N  KNRY D+LP+DS RV L   KDY       INAS I +  H   +  IATQGPL +T
Sbjct  15   NRDKNRYRDILPYDSTRVPLGKNKDY-------INASYIRIVNHEEEYFYIATQGPLPDT  67

Query  594  FEDFWGMVIQNRCPAI  641
             EDFW MV++N C  I
Sbjct  68   IEDFWQMVLENNCNVI  83



>ref|XP_009645647.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
[Egretta garzetta]
Length=851

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 59/124 (48%), Gaps = 9/124 (7%)
 Frame = +3

Query  285  EALKVLKEKRFQAPEKIRQEFGTLQANRMR-----ASDMRSRCLVALDSINISKNRYTDV  449
            E LK  K    +A +   +   T  A R+R     +S +   C V  +  N SKNRY  +
Sbjct  265  ETLKRFKRAEIEAEQTEDESVDTHGAGRLREYQQLSSTLLHPCDVGKELCNQSKNRYKGI  324

Query  450  LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNR  629
            +P+D  RVVL P      +  GYINAS +        FIA QGPL  T  DFW MV Q +
Sbjct  325  IPYDHCRVVLQP----SDTGNGYINASYVNSYRSPHFFIAAQGPLPGTVVDFWQMVWQEK  380

Query  630  CPAI  641
               I
Sbjct  381  TSVI  384



>ref|NP_001073618.1| tyrosine-protein phosphatase non-receptor type 20 [Rattus norvegicus]
 ref|XP_006252827.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
isoform X1 [Rattus norvegicus]
 ref|XP_006252829.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
isoform X1 [Rattus norvegicus]
 ref|XP_008769321.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
isoform X1 [Rattus norvegicus]
 sp|A1L1L3.1|PTN20_RAT RecName: Full=Tyrosine-protein phosphatase non-receptor type 
20 [Rattus norvegicus]
 gb|AAI29118.1| Protein tyrosine phosphatase, non-receptor type 20 [Rattus norvegicus]
Length=421

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 46/76 (61%), Gaps = 9/76 (12%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRF--IATQGPLXNT  593
            N  KNRY D+LP+DS RV L   KDY       INAS I +  H   +  IATQGPL +T
Sbjct  184  NRDKNRYRDILPYDSTRVPLGKNKDY-------INASYIRIVNHEEEYFYIATQGPLPDT  236

Query  594  FEDFWGMVIQNRCPAI  641
             EDFW MV++N C  I
Sbjct  237  IEDFWQMVLENNCNVI  252



>pir||JC8052 protein tyrosine phosphatase epsilon - Japanese medaka
Length=680

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 72/145 (50%), Gaps = 9/145 (6%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
            + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  368  YSFIYQALLEYYLYGDTELDVCSLEGHLHRLHNTRAPNDRLGLEEEFRKLTNVRIMKENM  427

Query  387  RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
            R+  L A    N+ KNR   ++P+D NRV+++  +   Q    YINAS I        FI
Sbjct  428  RTGNLPA----NMRKNRVLQIIPYDFNRVIISVRRG--QEFTDYINASFIDGYRQKDYFI  481

Query  567  ATQGPLXNTFEDFWGMVIQNRCPAI  641
            ATQGPL +T EDFW MV + RC +I
Sbjct  482  ATQGPLSHTVEDFWRMVWEWRCHSI  506


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +  ++FIA QGP   T  
Sbjct  143  NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGFKEKNKFIAAQGPKPETLA  200

Query  600  DFWGMVIQNRCPAI  641
            DFW MV + +   I
Sbjct  201  DFWRMVWEQKTTTI  214



>ref|XP_005312032.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 18 
[Chrysemys picta bellii]
Length=517

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 61/105 (58%), Gaps = 9/105 (9%)
 Frame = +3

Query  321  APEKIRQEFGTLQANRMRASDMRSRCLVALDSI----NISKNRYTDVLPFDSNRVVLNPC  488
             P ++ QEF  ++A   +AS  R +   + ++     NI KNRY D+LP+D  RVVLN C
Sbjct  17   GPARLGQEFQDIKA---QASAFRQQQGFSAEAGGRKENIKKNRYKDILPYDQTRVVLNLC  73

Query  489  KDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQ  623
             D  Q+   YINAS I    +   +IATQGPL +T  DFW M+ +
Sbjct  74   TDEGQTD--YINASFIQGVNNKRCYIATQGPLPHTVLDFWRMIWE  116



>ref|XP_006976805.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
[Peromyscus maniculatus bairdii]
Length=539

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 46/77 (60%), Gaps = 9/77 (12%)
 Frame = +3

Query  417  INISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRF--IATQGPLXN  590
            +N  KNRY D+LP+DS RV L   KDY       INAS I +  H   +  IATQGPL  
Sbjct  301  LNRDKNRYRDILPYDSTRVPLGKHKDY-------INASYIRIVNHDEEYFYIATQGPLPE  353

Query  591  TFEDFWGMVIQNRCPAI  641
            T EDFW MV++N C  I
Sbjct  354  TIEDFWQMVMENNCNVI  370



>ref|XP_008641244.1| PREDICTED: receptor-type tyrosine-protein phosphatase mu-like, 
partial [Corvus brachyrhynchos]
Length=670

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 69/147 (47%), Gaps = 12/147 (8%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKI-----RQEFGTLQANRMRAS  380
            + FS D + P   +  ++L    EALK+ K +  +A +       R   G L+  +  +S
Sbjct  65   YSFSVDVRKPNTQILVEELL---EALKMFKREEIEAEQTDDESVDRHGAGLLREYQQLSS  121

Query  381  DMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR  560
             +   C    +  N  KNRY  ++P+D  RVVL P      +  GYINAS +        
Sbjct  122  TLLHPCNAGKELCNQYKNRYKSIIPYDHCRVVLQP----SDTGNGYINASYVDSYRSPRF  177

Query  561  FIATQGPLXNTFEDFWGMVIQNRCPAI  641
            FIA QGPL  T  DFW MV Q +   I
Sbjct  178  FIAAQGPLAGTVVDFWQMVWQEKTSVI  204



>emb|CDQ58273.1| unnamed protein product [Oncorhynchus mykiss]
Length=626

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  357  LEEEFRKLTNVRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMKRG--QEFT  410

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + RC +I
Sbjct  411  DYINASFIDGYRQKDYFIATQGPLSHTVEDFWRMVWEYRCHSI  453


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 56/104 (54%), Gaps = 9/104 (9%)
 Frame = +3

Query  333  IRQEFGTLQANRMRAS-DMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSA  509
             R+EF +L      +S +  SR       IN  KNRY ++LP+D +RV+L     Y  S 
Sbjct  66   FREEFNSLPCGYQHSSFEEASRV------INRDKNRYPNILPYDHSRVLLTQIDGY--SC  117

Query  510  RGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
              YINAS I   +  ++FIA QGP+ +T  DFW MV + +   I
Sbjct  118  TDYINASYIDGYKEKNKFIAAQGPMHDTVADFWRMVWEQKTATI  161



>ref|XP_006518793.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
isoform X4 [Mus musculus]
Length=252

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 45/76 (59%), Gaps = 9/76 (12%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRF--IATQGPLXNT  593
            N  KNRY D+LP+DS RV L   KDY       INAS I +  H   +  IATQGPL  T
Sbjct  15   NRDKNRYRDILPYDSTRVPLGKNKDY-------INASYIRIVNHEEEYFYIATQGPLPET  67

Query  594  FEDFWGMVIQNRCPAI  641
             EDFW MV++N C  I
Sbjct  68   IEDFWQMVLENNCNVI  83



>ref|XP_007638291.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
[Cricetulus griseus]
 ref|XP_007614021.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
[Cricetulus griseus]
Length=457

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 47/77 (61%), Gaps = 9/77 (12%)
 Frame = +3

Query  417  INISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRF--IATQGPLXN  590
            +N  KNRY D+LP+DS+RV L   KDY       INAS I +  H   +  IATQGPL  
Sbjct  219  LNKDKNRYRDILPYDSSRVPLGKNKDY-------INASYIRIVNHEQEYFYIATQGPLPE  271

Query  591  TFEDFWGMVIQNRCPAI  641
            T EDFW MV++N C  I
Sbjct  272  TIEDFWQMVMENNCNVI  288



>ref|XP_007260074.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
[Astyanax mexicanus]
Length=537

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  267  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  320

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  321  DYINASFIDGYRQKDYFIATQGPLSHTVEDFWRMVWEWKCHSI  363



>gb|KHJ75838.1| Protein-tyrosine phosphatase [Oesophagostomum dentatum]
Length=301

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = +3

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGP  581
            VA + +N+ +NRY DVLPFD  RVVL P  +   S   YINAS +++ +    +I  QGP
Sbjct  18   VAKNLLNMDRNRYIDVLPFDQARVVLGPNAEDDDS---YINASPVSIEKAHRNYILAQGP  74

Query  582  LXNTFEDFWGMVIQNRCPAI  641
            L NT  DFW M+ +   PA+
Sbjct  75   LENTCNDFWQMIWEQNVPAV  94



>ref|XP_005602789.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
isoform X4 [Equus caballus]
Length=342

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 69/138 (50%), Gaps = 26/138 (19%)
 Frame = +3

Query  249  LVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRM-----RASDMRSRCLVALD  413
            LV S D+     E  K+L+EKR  A  +I QEF  L+   +       S+ R+R      
Sbjct  135  LVSSFDEQSTIKETFKMLEEKR--ADNEITQEFMALEFKNLPGEFNSGSEPRNR------  186

Query  414  SINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIATQGPLX  587
                 KNRY DVLP+DS RV L    DY       INAS I +  S     +I TQGPL 
Sbjct  187  ----DKNRYRDVLPYDSTRVPLGKNMDY-------INASYIRIINSGEEYFYIGTQGPLP  235

Query  588  NTFEDFWGMVIQNRCPAI  641
            +T +DFW MV++N    I
Sbjct  236  DTTDDFWQMVLENNSNVI  253



>gb|EYC21500.1| hypothetical protein Y032_0019g3860 [Ancylostoma ceylanicum]
Length=380

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 47/80 (59%), Gaps = 3/80 (4%)
 Frame = +3

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGP  581
            VA   +N+ +NRY DVLPFD  R+VL P  D   S   YINAS +++      +I  QGP
Sbjct  44   VAKSLLNMDRNRYIDVLPFDQYRIVLGPNADDDDS---YINASPVSIKRAHRNYILAQGP  100

Query  582  LXNTFEDFWGMVIQNRCPAI  641
            L NT  DFW MV +   PA+
Sbjct  101  LENTCNDFWQMVWEQNVPAV  120



>ref|NP_033004.1| tyrosine-protein phosphatase non-receptor type 20 [Mus musculus]
 sp|O55082.1|PTN20_MOUSE RecName: Full=Tyrosine-protein phosphatase non-receptor type 
20; AltName: Full=Testis-specific tyrosine phosphatase [Mus 
musculus]
 dbj|BAA23761.1| protein-tyrosine-phosphatase [Mus musculus]
 dbj|BAC26476.1| unnamed protein product [Mus musculus]
 gb|AAI60274.1| Protein tyrosine phosphatase, non-receptor type 20 [synthetic 
construct]
Length=426

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 45/76 (59%), Gaps = 9/76 (12%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRF--IATQGPLXNT  593
            N  KNRY D+LP+DS RV L   KDY       INAS I +  H   +  IATQGPL  T
Sbjct  189  NRDKNRYRDILPYDSTRVPLGKNKDY-------INASYIRIVNHEEEYFYIATQGPLPET  241

Query  594  FEDFWGMVIQNRCPAI  641
             EDFW MV++N C  I
Sbjct  242  IEDFWQMVLENNCNVI  257



>gb|EDL24859.1| protein tyrosine phosphatase, non-receptor type 20 [Mus musculus]
Length=412

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 45/76 (59%), Gaps = 9/76 (12%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRF--IATQGPLXNT  593
            N  KNRY D+LP+DS RV L   KDY       INAS I +  H   +  IATQGPL  T
Sbjct  189  NRDKNRYRDILPYDSTRVPLGKNKDY-------INASYIRIVNHEEEYFYIATQGPLPET  241

Query  594  FEDFWGMVIQNRCPAI  641
             EDFW MV++N C  I
Sbjct  242  IEDFWQMVLENNCNVI  257



>gb|EFX79072.1| hypothetical protein DAPPUDRAFT_197788 [Daphnia pulex]
Length=282

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 45/72 (63%), Gaps = 9/72 (13%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV----SEHVSRFIATQGPLX  587
            NI KNRY D+ P+D NRVVL+ C+D       YINAS + +         R+IATQGPL 
Sbjct  43   NIQKNRYGDIFPYDCNRVVLSSCQD-----EDYINASYVNIPLPGENKTLRYIATQGPLP  97

Query  588  NTFEDFWGMVIQ  623
            +T EDFW +V Q
Sbjct  98   HTVEDFWLLVWQ  109



>ref|XP_006518792.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
isoform X2 [Mus musculus]
Length=449

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 45/76 (59%), Gaps = 9/76 (12%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRF--IATQGPLXNT  593
            N  KNRY D+LP+DS RV L   KDY       INAS I +  H   +  IATQGPL  T
Sbjct  226  NRDKNRYRDILPYDSTRVPLGKNKDY-------INASYIRIVNHEEEYFYIATQGPLPET  278

Query  594  FEDFWGMVIQNRCPAI  641
             EDFW MV++N C  I
Sbjct  279  IEDFWQMVLENNCNVI  294



>ref|XP_011486570.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X3 [Oryzias latipes]
Length=635

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  366  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  419

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  420  DYINASFIDGYRQKDYFIATQGPLSHTVEDFWRMVWEWKCHSI  462


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D++RVVL     NPC DY       +NAS +      ++FIA QGP 
Sbjct  99   NKEKNRYPNILPYDNSRVVLSQLDGNPCSDY-------VNASFVDGYTEKNKFIAAQGPK  151

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW MV + +   +
Sbjct  152  EDTVADFWRMVWEQKVATV  170



>emb|CBN81571.1| Receptor-type tyrosine-protein phosphatase epsilon [Dicentrarchus 
labrax]
Length=682

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  413  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  466

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  467  DYINASFIDGYRQKDYFIATQGPLSHTVEDFWRMVWEWKCHSI  509


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       +NAS I      ++FI  QGP 
Sbjct  146  NKEKNRYPNILPYDHSRVVLSQLDGNPCSDY-------VNASYIDGFTEKNKFIGAQGPK  198

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW M+ + +   +
Sbjct  199  EDTAADFWRMIWEQKVATV  217



>dbj|GAM18917.1| hypothetical protein SAMD00019534_020920 [Acytostelium subglobosum 
LB1]
Length=425

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N SKNRYT+++P+D+ RV L        S   YINA+ I   EH  ++I TQGPL NTF 
Sbjct  170  NTSKNRYTNIVPWDTTRVKLEKIDGLEGS--DYINANFIAGGEHYKQYICTQGPLQNTFV  227

Query  600  DFWGMVIQN  626
            DFW MV +N
Sbjct  228  DFWRMVWEN  236



>ref|XP_006518791.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
isoform X1 [Mus musculus]
Length=463

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 45/76 (59%), Gaps = 9/76 (12%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRF--IATQGPLXNT  593
            N  KNRY D+LP+DS RV L   KDY       INAS I +  H   +  IATQGPL  T
Sbjct  226  NRDKNRYRDILPYDSTRVPLGKNKDY-------INASYIRIVNHEEEYFYIATQGPLPET  278

Query  594  FEDFWGMVIQNRCPAI  641
             EDFW MV++N C  I
Sbjct  279  IEDFWQMVLENNCNVI  294



>gb|EYC21499.1| hypothetical protein Y032_0019g3860 [Ancylostoma ceylanicum]
Length=377

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 47/80 (59%), Gaps = 3/80 (4%)
 Frame = +3

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGP  581
            VA   +N+ +NRY DVLPFD  R+VL P  D   S   YINAS +++      +I  QGP
Sbjct  44   VAKSLLNMDRNRYIDVLPFDQYRIVLGPNADDDDS---YINASPVSIKRAHRNYILAQGP  100

Query  582  LXNTFEDFWGMVIQNRCPAI  641
            L NT  DFW MV +   PA+
Sbjct  101  LENTCNDFWQMVWEQNVPAV  120



>ref|XP_005412656.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X1 [Chinchilla lanigera]
 ref|XP_005412657.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X2 [Chinchilla lanigera]
 ref|XP_005412658.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X3 [Chinchilla lanigera]
 ref|XP_005412659.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X4 [Chinchilla lanigera]
 ref|XP_005412660.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X5 [Chinchilla lanigera]
 ref|XP_005412661.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X6 [Chinchilla lanigera]
Length=379

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 69/135 (51%), Gaps = 17/135 (13%)
 Frame = +3

Query  243  PRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSIN  422
            PR   S D+     + LK+L+ K       I QEFG L+  + R S+    C    +  N
Sbjct  91   PR-TFSFDKQSAFKDYLKILERK---GVFDITQEFGDLERKKSRCSE----CTYGNEPWN  142

Query  423  ISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIATQGPLXNTF  596
              KNRY D++P++S RV L   +D       YINAS I +   E    +IATQGPL +T 
Sbjct  143  RQKNRYRDIIPYESTRVPLGKSQD-------YINASYIRIINQEEEYFYIATQGPLPDTI  195

Query  597  EDFWGMVIQNRCPAI  641
            +DFW MV ++    I
Sbjct  196  DDFWQMVFEHNSNVI  210



>ref|XP_010736225.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X2 [Larimichthys crocea]
Length=636

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  367  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  420

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  421  DYINASFIDGYRQKDYFIATQGPLTHTVEDFWRMVWEWKCHSI  463


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       +NAS I      ++FIA QGP 
Sbjct  100  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------VNASYIDGFTEKNKFIAAQGPK  152

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW M+ + +   +
Sbjct  153  EDTTADFWRMIWELKVATV  171



>ref|XP_008283738.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X3 [Stegastes partitus]
Length=636

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  367  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  420

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  421  DYINASFIDGYRQKDYFIATQGPLQHTVEDFWRMVWEWKCHSI  463


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       +NAS I      ++FIA QGP 
Sbjct  100  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------VNASYIDGYTEKNKFIAAQGPK  152

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW M+ + +   +
Sbjct  153  EDTVADFWRMIWEQKVATV  171



>ref|XP_010736150.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Larimichthys crocea]
Length=682

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  413  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  466

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  467  DYINASFIDGYRQKDYFIATQGPLTHTVEDFWRMVWEWKCHSI  509


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       +NAS I      ++FIA QGP 
Sbjct  146  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------VNASYIDGFTEKNKFIAAQGPK  198

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW M+ + +   +
Sbjct  199  EDTTADFWRMIWELKVATV  217



>gb|ESA01264.1| hypothetical protein GLOINDRAFT_338068 [Rhizophagus irregularis 
DAOM 181602]
Length=327

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = +3

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGP  581
             A+  I++  NRY+D++PFD NR+ L+  +    +   YINAS I   + + R+I TQGP
Sbjct  53   TAISKISMKFNRYSDIIPFDRNRIKLHSKRSSNNT--DYINASYIEAPQKLRRYIGTQGP  110

Query  582  LXNTFEDFWGMVIQNRCPAI  641
            L NT EDFW MV + R   +
Sbjct  111  LENTIEDFWCMVWEQRSHVV  130



>ref|XP_004080496.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Oryzias latipes]
 ref|XP_011486568.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Oryzias latipes]
Length=682

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  413  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  466

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  467  DYINASFIDGYRQKDYFIATQGPLSHTVEDFWRMVWEWKCHSI  509


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D++RVVL     NPC DY       +NAS +      ++FIA QGP 
Sbjct  146  NKEKNRYPNILPYDNSRVVLSQLDGNPCSDY-------VNASFVDGYTEKNKFIAAQGPK  198

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW MV + +   +
Sbjct  199  EDTVADFWRMVWEQKVATV  217



>ref|XP_011486569.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X2 [Oryzias latipes]
Length=681

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  412  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  465

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  466  DYINASFIDGYRQKDYFIATQGPLSHTVEDFWRMVWEWKCHSI  508


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D++RVVL     NPC DY       +NAS +      ++FIA QGP 
Sbjct  145  NKEKNRYPNILPYDNSRVVLSQLDGNPCSDY-------VNASFVDGYTEKNKFIAAQGPK  197

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW MV + +   +
Sbjct  198  EDTVADFWRMVWEQKVATV  216



>ref|XP_008283734.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Stegastes partitus]
 ref|XP_008283735.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Stegastes partitus]
 ref|XP_008283736.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Stegastes partitus]
Length=682

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  413  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  466

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  467  DYINASFIDGYRQKDYFIATQGPLQHTVEDFWRMVWEWKCHSI  509


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       +NAS I      ++FIA QGP 
Sbjct  146  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------VNASYIDGYTEKNKFIAAQGPK  198

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW M+ + +   +
Sbjct  199  EDTVADFWRMIWEQKVATV  217



>ref|XP_008283737.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X2 [Stegastes partitus]
Length=681

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  412  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  465

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  466  DYINASFIDGYRQKDYFIATQGPLQHTVEDFWRMVWEWKCHSI  508


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       +NAS I      ++FIA QGP 
Sbjct  146  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------VNASYIDGYTEKNKFIAAQGPK  198

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW M+ + +   +
Sbjct  199  EDTVADFWRMIWEQKVATV  217



>ref|XP_005412666.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X11 [Chinchilla lanigera]
Length=355

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 69/135 (51%), Gaps = 17/135 (13%)
 Frame = +3

Query  243  PRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSIN  422
            PR   S D+     + LK+L+ K       I QEFG L+  + R S+    C    +  N
Sbjct  67   PR-TFSFDKQSAFKDYLKILERK---GVFDITQEFGDLERKKSRCSE----CTYGNEPWN  118

Query  423  ISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIATQGPLXNTF  596
              KNRY D++P++S RV L   +D       YINAS I +   E    +IATQGPL +T 
Sbjct  119  RQKNRYRDIIPYESTRVPLGKSQD-------YINASYIRIINQEEEYFYIATQGPLPDTI  171

Query  597  EDFWGMVIQNRCPAI  641
            +DFW MV ++    I
Sbjct  172  DDFWQMVFEHNSNVI  186



>ref|XP_005412662.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X7 [Chinchilla lanigera]
 ref|XP_005412663.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X8 [Chinchilla lanigera]
 ref|XP_005412664.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X9 [Chinchilla lanigera]
 ref|XP_005412665.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X10 [Chinchilla lanigera]
Length=357

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 69/135 (51%), Gaps = 17/135 (13%)
 Frame = +3

Query  243  PRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSIN  422
            PR   S D+     + LK+L+ K       I QEFG L+  + R S+    C    +  N
Sbjct  69   PR-TFSFDKQSAFKDYLKILERK---GVFDITQEFGDLERKKSRCSE----CTYGNEPWN  120

Query  423  ISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIATQGPLXNTF  596
              KNRY D++P++S RV L   +D       YINAS I +   E    +IATQGPL +T 
Sbjct  121  RQKNRYRDIIPYESTRVPLGKSQD-------YINASYIRIINQEEEYFYIATQGPLPDTI  173

Query  597  EDFWGMVIQNRCPAI  641
            +DFW MV ++    I
Sbjct  174  DDFWQMVFEHNSNVI  188



>ref|XP_005491808.1| PREDICTED: uncharacterized protein LOC102063787, partial [Zonotrichia 
albicollis]
Length=568

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 60/124 (48%), Gaps = 9/124 (7%)
 Frame = +3

Query  285  EALKVLKEKRFQAPEKI-----RQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDV  449
            EALK+ K +  +A +       R   G L+  +  +S +   C    +  N +KNRY  +
Sbjct  332  EALKMFKREEIEAEQTDDESVNRHGAGLLREYQQLSSTLLHPCNAGKELCNQNKNRYKSI  391

Query  450  LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNR  629
            +P+D  RVVL P      +  GYINAS +        FIA QGPL  T  DFW MV Q +
Sbjct  392  IPYDHCRVVLQP----SDTGNGYINASYVDTYRSPRFFIAAQGPLAGTVVDFWHMVWQEK  447

Query  630  CPAI  641
               I
Sbjct  448  TSVI  451



>ref|XP_010764793.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X6 [Notothenia coriiceps]
Length=636

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  367  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  420

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  421  DYVNASFIDGYRQKDYFIATQGPLTHTVEDFWRMVWEWKCHSI  463


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       +NAS I       +FIA QGP 
Sbjct  100  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------VNASYIDGYTEKKKFIAAQGPK  152

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW M+ + +   +
Sbjct  153  EDTVADFWRMIWEQKVATV  171



>ref|XP_007451241.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon 
isoform X2 [Lipotes vexillifer]
Length=642

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 57/103 (55%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+    MR+  L A    N+ K R   ++P+D NRV+L+  +   Q   
Sbjct  368  LEEEFRKLTNVRIMKESMRTGNLPA----NMRKARVIQIIPYDFNRVILSMKRG--QEYT  421

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I      S FIATQGPL +T EDFW MV + +C AI
Sbjct  422  DYINASFIDGYRQKSHFIATQGPLAHTVEDFWRMVWEWKCHAI  464


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 55/107 (51%), Gaps = 17/107 (16%)
 Frame = +3

Query  336  RQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLN-----PCKDYR  500
            R+EF +L +  ++ +       +A    N  KNRY ++LP D +RV+L+     PC DY 
Sbjct  78   REEFNSLPSGHIQGT-----FELANKEENKEKNRYPNILPNDHSRVILSQVDGTPCSDY-  131

Query  501  QSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
                  INAS I   +  ++FIA QGP   T  DFW M+ + +   I
Sbjct  132  ------INASYIDGYKEKNKFIAAQGPKQGTVNDFWRMIWEQKSATI  172



>ref|XP_010764792.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X5 [Notothenia coriiceps]
Length=651

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  382  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  435

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  436  DYVNASFIDGYRQKDYFIATQGPLTHTVEDFWRMVWEWKCHSI  478


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       +NAS I       +FIA QGP 
Sbjct  115  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------VNASYIDGYTEKKKFIAAQGPK  167

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW M+ + +   +
Sbjct  168  EDTVADFWRMIWEQKVATV  186



>ref|XP_010764788.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Notothenia coriiceps]
Length=697

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  428  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  481

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  482  DYVNASFIDGYRQKDYFIATQGPLTHTVEDFWRMVWEWKCHSI  524


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       +NAS I       +FIA QGP 
Sbjct  161  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------VNASYIDGYTEKKKFIAAQGPK  213

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW M+ + +   +
Sbjct  214  EDTVADFWRMIWEQKVATV  232



>ref|XP_010168415.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like, 
partial [Caprimulgus carolinensis]
Length=239

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ K R   ++P+D NRV+L+  +   Q   
Sbjct  90   LEEEFKKLTNVRIMKENMRTGNLPA----NMKKARVIQIIPYDFNRVILSMKRG--QEYT  143

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + +C  I
Sbjct  144  DYINASFIDGYRQKDYFIATQGPLPHTVEDFWRMVWEWKCHTI  186



>ref|XP_003379118.1| tyrosine-protein phosphatase non-receptor type 12 [Trichinella 
spiralis]
 gb|EFV61251.1| tyrosine-protein phosphatase non-receptor type 12 [Trichinella 
spiralis]
Length=418

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFE  599
            N  KNRY D+LP+D NRV L        S+  YINAS +        +IATQGPL NT +
Sbjct  58   NTFKNRYRDILPYDYNRVKLLS----GGSSSDYINASYLNGCNGKVAYIATQGPLENTCD  113

Query  600  DFWGMVIQNRCPAI  641
            DFW MV+Q+RC  I
Sbjct  114  DFWAMVVQSRCRTI  127



>ref|XP_008945457.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like, 
partial [Merops nubicus]
Length=251

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ K R   ++P+D NRV+L+  +   Q   
Sbjct  144  LEEEFKKLTNVRIMKENMRTGNLPA----NMKKARVIQIIPYDFNRVILSMKRG--QEYT  197

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + +C  I
Sbjct  198  DYINASFIDGYRQKDYFIATQGPLPHTVEDFWRMVWEWKCHTI  240



>ref|XP_010764791.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X4 [Notothenia coriiceps]
Length=681

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  412  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  465

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  466  DYVNASFIDGYRQKDYFIATQGPLTHTVEDFWRMVWEWKCHSI  508


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       +NAS I       +FIA QGP 
Sbjct  145  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------VNASYIDGYTEKKKFIAAQGPK  197

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW M+ + +   +
Sbjct  198  EDTVADFWRMIWEQKVATV  216



>ref|XP_005077756.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
[Mesocricetus auratus]
Length=479

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 72/146 (49%), Gaps = 28/146 (19%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
            +P  F+Y SQ               + LK L++K+      I +EF  L+   +   D+ 
Sbjct  191  RPLIFNYSSQSAM-----------KDCLKTLQKKK---EHDIIREFLELEQMPL-LDDLH  235

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRF--  563
            S      + +N  KNRY D+LP+DS RV L   K+Y       INAS I +  H   +  
Sbjct  236  S----GNELLNKDKNRYRDILPYDSTRVPLGKNKNY-------INASYIKIVNHEEEYFY  284

Query  564  IATQGPLXNTFEDFWGMVIQNRCPAI  641
            IATQGP+  T EDFW MV++N C  I
Sbjct  285  IATQGPMPETIEDFWQMVMENNCNVI  310



>ref|XP_010764790.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X3 [Notothenia coriiceps]
Length=682

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  413  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  466

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  467  DYVNASFIDGYRQKDYFIATQGPLTHTVEDFWRMVWEWKCHSI  509


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       +NAS I       +FIA QGP 
Sbjct  146  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------VNASYIDGYTEKKKFIAAQGPK  198

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW M+ + +   +
Sbjct  199  EDTVADFWRMIWEQKVATV  217



>ref|XP_007451240.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon 
isoform X1 [Lipotes vexillifer]
Length=705

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 57/103 (55%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+    MR+  L A    N+ K R   ++P+D NRV+L+  +   Q   
Sbjct  431  LEEEFRKLTNVRIMKESMRTGNLPA----NMRKARVIQIIPYDFNRVILSMKRG--QEYT  484

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I      S FIATQGPL +T EDFW MV + +C AI
Sbjct  485  DYINASFIDGYRQKSHFIATQGPLAHTVEDFWRMVWEWKCHAI  527


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 55/107 (51%), Gaps = 17/107 (16%)
 Frame = +3

Query  336  RQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLN-----PCKDYR  500
            R+EF +L +  ++ +       +A    N  KNRY ++LP D +RV+L+     PC DY 
Sbjct  141  REEFNSLPSGHIQGT-----FELANKEENKEKNRYPNILPNDHSRVILSQVDGTPCSDY-  194

Query  501  QSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
                  INAS I   +  ++FIA QGP   T  DFW M+ + +   I
Sbjct  195  ------INASYIDGYKEKNKFIAAQGPKQGTVNDFWRMIWEQKSATI  235



>ref|XP_007902010.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 21 
isoform X2 [Callorhinchus milii]
Length=1110

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 64/115 (56%), Gaps = 7/115 (6%)
 Frame = +3

Query  285  EALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDS  464
            EAL +L+ K  +  +++ Q+    +  R+      + C +A    N  +NR+ DV+P+D 
Sbjct  814  EALPLLRCKILE--QRVEQKMVFTEYERVPKRSAHAECTIAQLPENAERNRFPDVIPYDD  871

Query  465  NRVVLNPCKDYRQSARGYINAS--LITVSEHVSRFIATQGPLXNTFEDFWGMVIQ  623
             RV L P K+   +  GYINAS   ITV +    +IATQGPL NT  DFW MV +
Sbjct  872  TRVELVPTKE---NNTGYINASNIKITVGDKEWNYIATQGPLQNTCHDFWQMVWE  923



>ref|XP_010764789.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X2 [Notothenia coriiceps]
Length=696

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  427  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  480

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  481  DYVNASFIDGYRQKDYFIATQGPLTHTVEDFWRMVWEWKCHSI  523


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       +NAS I       +FIA QGP 
Sbjct  160  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------VNASYIDGYTEKKKFIAAQGPK  212

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW M+ + +   +
Sbjct  213  EDTVADFWRMIWEQKVATV  231



>gb|KHJ88348.1| Protein-tyrosine phosphatase [Oesophagostomum dentatum]
Length=125

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 56/109 (51%), Gaps = 14/109 (13%)
 Frame = +3

Query  327  EKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLN----PCKD  494
            E +R++F   Q    RA D + R   A ++ N  KNRY DV+  D  RV L     PC D
Sbjct  17   EGLRKQFRE-QLAAYRAPDDKYR-FTAFEA-NPDKNRYLDVVCLDETRVKLTLDVPPCTD  73

Query  495  YRQSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
            Y       I+A+ +    H   FIATQ PL NT EDFW MV Q  CP +
Sbjct  74   Y-------IHANWVKFEGHDKVFIATQAPLDNTIEDFWRMVFQEGCPNV  115



>emb|CAG01030.1| unnamed protein product [Tetraodon nigroviridis]
Length=1031

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  363  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  416

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  417  DYINASFIDGYRQKDYFIATQGPLPHTVEDFWRMVWEWKCHSI  459


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  790  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  843

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             YINAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  844  DYINASFIDGYRQKDYFIATQGPLPHTVEDFWRMVWEWKCHSI  886


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 44/79 (56%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       +NAS I      ++FIA QGP 
Sbjct  100  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------VNASYIDGFTEKNKFIAAQGPK  152

Query  585  XNTFEDFWGMVIQNRCPAI  641
             +T  DFW M+ + +   I
Sbjct  153  EDTVADFWRMIWEQKVATI  171



>ref|XP_004177199.1| PREDICTED: receptor-type tyrosine-protein phosphatase T-like 
[Taeniopygia guttata]
Length=1149

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 60/124 (48%), Gaps = 9/124 (7%)
 Frame = +3

Query  285  EALKVLKEKRFQAPEKI-----RQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDV  449
            EALK+ K +  +A +       R   G L+  +  +S +   C    +  N +KNRY  +
Sbjct  514  EALKMFKREEIKAEQTDDESVNRHGAGLLREYQQLSSALLHPCNAGKELCNQNKNRYKSI  573

Query  450  LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNR  629
            +P+D  RVVL P      +  GYINAS +        FIA QGPL  T  DFW MV Q +
Sbjct  574  IPYDHCRVVLQP----SDTGNGYINASYVDTYRSPHFFIAAQGPLTGTVVDFWHMVWQEK  629

Query  630  CPAI  641
               I
Sbjct  630  TSVI  633



>ref|XP_008435334.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X6 [Poecilia reticulata]
Length=636

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  367  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  420

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  421  DYVNASFIDGYRQKDYFIATQGPLPHTVEDFWRMVWEWKCHSI  463


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       INAS +      ++FIA QGP 
Sbjct  100  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------INASYVDGYTEKNKFIAAQGPK  152

Query  585  XNTFEDFWGMVIQNRCPAI  641
              T  DFW M+ + +   +
Sbjct  153  EETVADFWRMIWEQKVATV  171



>ref|XP_007562463.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X6 [Poecilia formosa]
Length=636

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  367  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  420

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  421  DYVNASFIDGYRQKDYFIATQGPLPHTVEDFWRMVWEWKCHSI  463


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       INAS +      ++FIA QGP 
Sbjct  100  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------INASYVDGYTEKNKFIAAQGPK  152

Query  585  XNTFEDFWGMVIQNRCPAI  641
              T  DFW M+ + +   +
Sbjct  153  EETVADFWRMIWEQKVATV  171



>ref|XP_004681103.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
[Condylura cristata]
Length=352

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 68/133 (51%), Gaps = 16/133 (12%)
 Frame = +3

Query  249  LVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINIS  428
             + +S +     E LK  + K  ++  +I QEF +L++  +             +  N  
Sbjct  65   FIFTSHEQSAIKEYLKTFERKVVES--EINQEFLSLESTNLPGEFNSGN-----EPNNRD  117

Query  429  KNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIATQGPLXNTFED  602
            KNRY D+LP+DS RV L   KDY       INAS I +  SE    +IATQGPL +T ED
Sbjct  118  KNRYRDILPYDSTRVPLGENKDY-------INASYIRIVNSEEEYFYIATQGPLPDTIED  170

Query  603  FWGMVIQNRCPAI  641
            FW MV++N    I
Sbjct  171  FWQMVLENNSNII  183



>emb|CAQ14261.1| protein tyrosine phosphatase 1b, partial [Danio rerio]
Length=136

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 54/96 (56%), Gaps = 10/96 (10%)
 Frame = +3

Query  357  QANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLN-PCKDYRQSARGYINASL  533
            Q  R ++SD+   C +A    N S+NRY DV PFD +R+ L   C DY       INASL
Sbjct  19   QEIRQQSSDLP--CKIAKLPENRSRNRYRDVSPFDHSRICLQIGCNDY-------INASL  69

Query  534  ITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
            I+V E   ++I TQGPL NT   FW MV + R   +
Sbjct  70   ISVEEAQRKYILTQGPLPNTCGHFWEMVWEQRSRGV  105



>ref|XP_008435333.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X5 [Poecilia reticulata]
Length=651

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  382  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  435

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  436  DYVNASFIDGYRQKDYFIATQGPLPHTVEDFWRMVWEWKCHSI  478


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       INAS +      ++FIA QGP 
Sbjct  115  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------INASYVDGYTEKNKFIAAQGPK  167

Query  585  XNTFEDFWGMVIQNRCPAI  641
              T  DFW M+ + +   +
Sbjct  168  EETVADFWRMIWEQKVATV  186



>ref|XP_007562462.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X5 [Poecilia formosa]
Length=651

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  382  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  435

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  436  DYVNASFIDGYRQKDYFIATQGPLPHTVEDFWRMVWEWKCHSI  478


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       INAS +      ++FIA QGP 
Sbjct  115  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------INASYVDGYTEKNKFIAAQGPK  167

Query  585  XNTFEDFWGMVIQNRCPAI  641
              T  DFW M+ + +   +
Sbjct  168  EETVADFWRMIWEQKVATV  186



>ref|XP_005602786.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
isoform X1 [Equus caballus]
 ref|XP_005602787.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
isoform X2 [Equus caballus]
 ref|XP_005602788.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
isoform X3 [Equus caballus]
Length=422

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 69/138 (50%), Gaps = 26/138 (19%)
 Frame = +3

Query  249  LVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRM-----RASDMRSRCLVALD  413
            LV S D+     E  K+L+EKR  A  +I QEF  L+   +       S+ R+R      
Sbjct  135  LVSSFDEQSTIKETFKMLEEKR--ADNEITQEFMALEFKNLPGEFNSGSEPRNR------  186

Query  414  SINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIATQGPLX  587
                 KNRY DVLP+DS RV L    DY       INAS I +  S     +I TQGPL 
Sbjct  187  ----DKNRYRDVLPYDSTRVPLGKNMDY-------INASYIRIINSGEEYFYIGTQGPLP  235

Query  588  NTFEDFWGMVIQNRCPAI  641
            +T +DFW MV++N    I
Sbjct  236  DTTDDFWQMVLENNSNVI  253



>ref|XP_009894702.1| PREDICTED: receptor-type tyrosine-protein phosphatase T-like, 
partial [Picoides pubescens]
Length=649

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 59/124 (48%), Gaps = 9/124 (7%)
 Frame = +3

Query  285  EALKVLKEKRFQAPEKIRQEFGTLQANRMR-----ASDMRSRCLVALDSINISKNRYTDV  449
            EALK  K    +A +   +   T  A R+R     +S +   C    +  N SKNRY  +
Sbjct  64   EALKRFKRAEIEAEQTEDELVDTYGAGRLREYQQLSSTLLHPCDTGNELCNQSKNRYKSI  123

Query  450  LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNR  629
            +P+D  RVVL P      +  GYINAS +        FIA QGPL  T  DFW MV Q +
Sbjct  124  VPYDHCRVVLQP----SDTGNGYINASYVDSYRSPRFFIAAQGPLPGTVVDFWQMVWQEK  179

Query  630  CPAI  641
               I
Sbjct  180  TSVI  183



>ref|XP_010019842.1| PREDICTED: receptor-type tyrosine-protein phosphatase mu-like, 
partial [Nestor notabilis]
Length=659

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 59/124 (48%), Gaps = 9/124 (7%)
 Frame = +3

Query  285  EALKVLKEKRFQAPEKI-----RQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDV  449
            EALK LK    +A +       R   G L   +  +S +   C    +  N SKNRY  +
Sbjct  73   EALKRLKRAEIEAEQTEDESVDRHGAGRLGEYQQLSSSLLHPCDAGKELCNQSKNRYKSI  132

Query  450  LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNR  629
            +P+D  RVVL P      +  GYINAS +   +    FIA QGPL  T  DFW MV Q +
Sbjct  133  IPYDHCRVVLQP----SDTGNGYINASYVDSYQSPRFFIAAQGPLPGTVMDFWQMVWQEK  188

Query  630  CPAI  641
               I
Sbjct  189  TSVI  192



>ref|XP_007562456.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Poecilia formosa]
 ref|XP_007562457.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X1 [Poecilia formosa]
Length=700

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  431  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  484

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  485  DYVNASFIDGYRQKDYFIATQGPLPHTVEDFWRMVWEWKCHSI  527


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       INAS +      ++FIA QGP 
Sbjct  164  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------INASYVDGYTEKNKFIAAQGPK  216

Query  585  XNTFEDFWGMVIQNRCPAI  641
              T  DFW M+ + +   +
Sbjct  217  EETVADFWRMIWEQKVATV  235



>ref|XP_005671255.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20 
isoform X6 [Sus scrofa]
Length=340

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 69/133 (52%), Gaps = 16/133 (12%)
 Frame = +3

Query  249  LVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINIS  428
            +V+S+ +     +  K+L++K   +  +I QEF  L+   + A       L      N  
Sbjct  139  IVVSNHEQSTFQDYFKMLEKKL--SENEIIQEFMALEFKNLHAVFHSGNELQ-----NRE  191

Query  429  KNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIATQGPLXNTFED  602
            KNRY D+LP+DS RV L   KDY       INAS I +  SE    +IATQGPL  T +D
Sbjct  192  KNRYRDILPYDSTRVPLGENKDY-------INASYIKIVNSEQEYYYIATQGPLPGTTDD  244

Query  603  FWGMVIQNRCPAI  641
            FW MV++N    I
Sbjct  245  FWQMVLENNSNVI  257



>ref|XP_007562458.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
isoform X2 [Poecilia formosa]
Length=699

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  333  IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
            + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  430  LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  483

Query  513  GYINASLITVSEHVSRFIATQGPLXNTFEDFWGMVIQNRCPAI  641
             Y+NAS I        FIATQGPL +T EDFW MV + +C +I
Sbjct  484  DYVNASFIDGYRQKDYFIATQGPLPHTVEDFWRMVWEWKCHSI  526


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 12/79 (15%)
 Frame = +3

Query  420  NISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            N  KNRY ++LP+D +RVVL     NPC DY       INAS +      ++FIA QGP 
Sbjct  163  NKEKNRYPNILPYDHSRVVLTQLDGNPCSDY-------INASYVDGYTEKNKFIAAQGPK  215

Query  585  XNTFEDFWGMVIQNRCPAI  641
              T  DFW M+ + +   +
Sbjct  216  EETVADFWRMIWEQKVATV  234



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750