BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF050A20

Length=591
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             244   3e-74   Nicotiana tomentosiformis
emb|CAA65634.1|  PS60                                                   244   4e-74   Nicotiana tabacum [American tobacco]
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             244   6e-74   Nicotiana sylvestris
ref|XP_008452926.1|  PREDICTED: L-ascorbate oxidase homolog             243   1e-73   Cucumis melo [Oriental melon]
gb|KGN55480.1|  hypothetical protein Csa_4G653410                       240   1e-73   Cucumis sativus [cucumbers]
ref|XP_004145593.1|  PREDICTED: L-ascorbate oxidase homolog             243   2e-73   
ref|XP_004157080.1|  PREDICTED: L-ascorbate oxidase homolog             243   2e-73   
ref|XP_010101299.1|  L-ascorbate oxidase-like protein                   240   1e-72   Morus notabilis
ref|XP_006435292.1|  hypothetical protein CICLE_v10000783mg             238   2e-72   
ref|XP_004142986.1|  PREDICTED: L-ascorbate oxidase homolog             239   4e-72   Cucumis sativus [cucumbers]
ref|XP_008445302.1|  PREDICTED: L-ascorbate oxidase homolog             239   5e-72   Cucumis melo [Oriental melon]
ref|XP_007160607.1|  hypothetical protein PHAVU_001G001500g             238   5e-72   Phaseolus vulgaris [French bean]
ref|XP_007017957.1|  SKU5 similar 5 isoform 3                           236   7e-72   
ref|XP_009334388.1|  PREDICTED: L-ascorbate oxidase homolog             238   7e-72   Pyrus x bretschneideri [bai li]
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog             238   8e-72   Glycine max [soybeans]
ref|XP_006435293.1|  hypothetical protein CICLE_v10000783mg             238   8e-72   Citrus clementina [clementine]
ref|XP_002510630.1|  multicopper oxidase, putative                      238   9e-72   Ricinus communis
emb|CAB08077.1|  pectinesterase                                         237   1e-71   Solanum lycopersicum
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog             238   1e-71   Malus domestica [apple tree]
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog             238   1e-71   Glycine max [soybeans]
ref|XP_010667351.1|  PREDICTED: L-ascorbate oxidase homolog             238   1e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007221787.1|  hypothetical protein PRUPE_ppa003860mg             238   2e-71   Prunus persica
ref|XP_007017956.1|  SKU5 similar 5 isoform 2                           236   2e-71   
gb|KEH40258.1|  multi-copper oxidase-like protein                       237   2e-71   Medicago truncatula
ref|XP_006390228.1|  hypothetical protein EUTSA_v10018373mg             236   2e-71   
gb|KHN33820.1|  L-ascorbate oxidase like                                237   2e-71   Glycine soja [wild soybean]
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog             237   2e-71   Tarenaya hassleriana [spider flower]
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog             237   3e-71   Glycine max [soybeans]
ref|XP_004238406.1|  PREDICTED: L-ascorbate oxidase homolog             237   3e-71   
ref|XP_006342102.1|  PREDICTED: L-ascorbate oxidase homolog             237   3e-71   Solanum tuberosum [potatoes]
gb|KJB58003.1|  hypothetical protein B456_009G189900                    234   4e-71   Gossypium raimondii
gb|KJB58004.1|  hypothetical protein B456_009G189900                    234   6e-71   Gossypium raimondii
ref|XP_007017955.1|  SKU5 similar 5 isoform 1                           236   7e-71   
gb|KDP36848.1|  hypothetical protein JCGZ_08139                         236   7e-71   Jatropha curcas
ref|XP_008221175.1|  PREDICTED: L-ascorbate oxidase homolog             236   7e-71   Prunus mume [ume]
ref|XP_007136137.1|  hypothetical protein PHAVU_009G021000g             236   7e-71   Phaseolus vulgaris [French bean]
ref|XP_004500896.1|  PREDICTED: L-ascorbate oxidase homolog             236   8e-71   Cicer arietinum [garbanzo]
ref|XP_006390229.1|  hypothetical protein EUTSA_v10018373mg             236   8e-71   Eutrema salsugineum [saltwater cress]
gb|KFK34458.1|  hypothetical protein AALP_AA5G148000                    235   1e-70   Arabis alpina [alpine rockcress]
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog             235   1e-70   Camelina sativa [gold-of-pleasure]
gb|KJB15896.1|  hypothetical protein B456_002G202300                    232   2e-70   Gossypium raimondii
gb|KHF99853.1|  L-ascorbate oxidase                                     234   3e-70   Gossypium arboreum [tree cotton]
gb|KJB58002.1|  hypothetical protein B456_009G189900                    234   4e-70   Gossypium raimondii
ref|XP_008377105.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    233   5e-70   
ref|XP_007041705.1|  SKU5 similar 5                                     233   6e-70   
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog             233   6e-70   Camelina sativa [gold-of-pleasure]
ref|XP_011034917.1|  PREDICTED: L-ascorbate oxidase homolog             233   8e-70   Populus euphratica
ref|XP_003527461.1|  PREDICTED: L-ascorbate oxidase homolog             233   9e-70   Glycine max [soybeans]
ref|XP_004291312.1|  PREDICTED: L-ascorbate oxidase homolog             233   9e-70   Fragaria vesca subsp. vesca
ref|XP_004499321.1|  PREDICTED: L-ascorbate oxidase homolog             233   1e-69   Cicer arietinum [garbanzo]
ref|XP_002300669.1|  multi-copper oxidase type 1 family protein         233   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_002307765.1|  multi-copper oxidase type 1 family protein         233   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg             233   1e-69   Capsella rubella
ref|XP_011041276.1|  PREDICTED: L-ascorbate oxidase homolog             233   1e-69   Populus euphratica
ref|XP_010539810.1|  PREDICTED: L-ascorbate oxidase homolog             232   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494             232   2e-69   Arabidopsis lyrata subsp. lyrata
gb|KHG11003.1|  L-ascorbate oxidase                                     232   2e-69   Gossypium arboreum [tree cotton]
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog             232   2e-69   Sesamum indicum [beniseed]
ref|XP_009128157.1|  PREDICTED: L-ascorbate oxidase homolog             232   2e-69   Brassica rapa
gb|KJB15897.1|  hypothetical protein B456_002G202300                    232   2e-69   Gossypium raimondii
emb|CDY68834.1|  BnaCnng60730D                                          232   2e-69   Brassica napus [oilseed rape]
emb|CDY55201.1|  BnaCnng28410D                                          232   2e-69   Brassica napus [oilseed rape]
gb|KJB47732.1|  hypothetical protein B456_008G038600                    226   3e-69   Gossypium raimondii
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog             231   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog             231   4e-69   Tarenaya hassleriana [spider flower]
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             231   5e-69   Vitis vinifera
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             231   6e-69   Sesamum indicum [beniseed]
gb|AAL09733.1|  At1g76160/T23E18_10                                     230   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177743.1|  SKU5-like 5 protein                                   230   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog             230   1e-68   Nelumbo nucifera [Indian lotus]
gb|AAM97070.1|  pectinesterase, putative                                230   1e-68   Arabidopsis thaliana [mouse-ear cress]
gb|KEH36280.1|  multi-copper oxidase-like protein                       229   2e-68   Medicago truncatula
gb|AFK35121.1|  unknown                                                 229   2e-68   Medicago truncatula
gb|ACJ85585.1|  unknown                                                 229   2e-68   Medicago truncatula
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog             229   2e-68   Vitis vinifera
emb|CAN83942.1|  hypothetical protein VITISV_013559                     229   2e-68   Vitis vinifera
gb|KJB47729.1|  hypothetical protein B456_008G038600                    226   3e-68   Gossypium raimondii
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             229   4e-68   Eucalyptus grandis [rose gum]
ref|XP_008382461.1|  PREDICTED: L-ascorbate oxidase homolog             228   5e-68   
emb|CDX73238.1|  BnaC06g36860D                                          228   6e-68   
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog             228   7e-68   Populus euphratica
ref|XP_002306213.1|  hypothetical protein POPTR_0004s18730g             228   7e-68   
gb|AFK33407.1|  unknown                                                 224   8e-68   Lotus japonicus
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             228   8e-68   Fragaria vesca subsp. vesca
ref|XP_010667350.1|  PREDICTED: L-ascorbate oxidase homolog             228   8e-68   Beta vulgaris subsp. vulgaris [field beet]
gb|AGT57427.1|  ascorbate oxidase                                       227   1e-67   Prunus persica
ref|XP_009106271.1|  PREDICTED: L-ascorbate oxidase homolog             227   1e-67   Brassica rapa
emb|CDX87633.1|  BnaA07g32400D                                          227   1e-67   
ref|XP_007200295.1|  hypothetical protein PRUPE_ppa004000mg             227   1e-67   Prunus persica
ref|XP_008236098.1|  PREDICTED: L-ascorbate oxidase homolog             227   1e-67   Prunus mume [ume]
ref|XP_004505676.1|  PREDICTED: L-ascorbate oxidase homolog             227   1e-67   Cicer arietinum [garbanzo]
gb|KJB14335.1|  hypothetical protein B456_002G120000                    227   1e-67   Gossypium raimondii
gb|KHF99506.1|  L-ascorbate oxidase                                     227   2e-67   Gossypium arboreum [tree cotton]
ref|XP_008365718.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    222   2e-67   
gb|KCW70295.1|  hypothetical protein EUGRSUZ_F03538                     225   2e-67   Eucalyptus grandis [rose gum]
gb|KHG21048.1|  L-ascorbate oxidase                                     227   2e-67   Gossypium arboreum [tree cotton]
tpg|DAA62868.1|  TPA: hypothetical protein ZEAMMB73_701617              218   2e-67   
ref|XP_004253133.1|  PREDICTED: L-ascorbate oxidase homolog             226   2e-67   Solanum lycopersicum
gb|KJB47727.1|  hypothetical protein B456_008G038600                    226   3e-67   Gossypium raimondii
gb|KHG21949.1|  L-ascorbate oxidase                                     226   3e-67   Gossypium arboreum [tree cotton]
gb|KJB47731.1|  hypothetical protein B456_008G038600                    226   3e-67   Gossypium raimondii
gb|KEH30610.1|  multi-copper oxidase-like protein                       224   3e-67   Medicago truncatula
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                226   4e-67   Erythranthe guttata [common monkey flower]
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             226   4e-67   Nelumbo nucifera [Indian lotus]
gb|ACN50176.1|  pectinesterase                                          226   5e-67   Annona cherimola [cherimoya]
tpg|DAA62867.1|  TPA: hypothetical protein ZEAMMB73_701617              216   5e-67   
ref|XP_006342555.1|  PREDICTED: L-ascorbate oxidase homolog             226   6e-67   Solanum tuberosum [potatoes]
gb|KJB59710.1|  hypothetical protein B456_009G268100                    224   7e-67   Gossypium raimondii
emb|CDP07321.1|  unnamed protein product                                225   8e-67   Coffea canephora [robusta coffee]
ref|XP_010063104.1|  PREDICTED: L-ascorbate oxidase homolog             225   8e-67   Eucalyptus grandis [rose gum]
ref|XP_007131584.1|  hypothetical protein PHAVU_011G025400g             225   1e-66   Phaseolus vulgaris [French bean]
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog             225   1e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010103298.1|  L-ascorbate oxidase-like protein                   226   1e-66   
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                224   1e-66   Erythranthe guttata [common monkey flower]
gb|KJB59711.1|  hypothetical protein B456_009G268100                    224   2e-66   Gossypium raimondii
emb|CDY64276.1|  BnaCnng43630D                                          226   2e-66   Brassica napus [oilseed rape]
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             224   2e-66   Fragaria vesca subsp. vesca
gb|KHN05478.1|  L-ascorbate oxidase like                                224   2e-66   Glycine soja [wild soybean]
ref|XP_006592035.1|  PREDICTED: L-ascorbate oxidase homolog             224   2e-66   Glycine max [soybeans]
gb|KCW55614.1|  hypothetical protein EUGRSUZ_I01478                     221   2e-66   Eucalyptus grandis [rose gum]
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog             224   3e-66   Glycine max [soybeans]
gb|KEH30611.1|  multi-copper oxidase-like protein                       224   3e-66   Medicago truncatula
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog             224   3e-66   Solanum tuberosum [potatoes]
ref|XP_002528421.1|  multicopper oxidase, putative                      224   3e-66   
ref|XP_009107631.1|  PREDICTED: L-ascorbate oxidase homolog             223   3e-66   Brassica rapa
emb|CDY67479.1|  BnaCnng55180D                                          223   3e-66   Brassica napus [oilseed rape]
emb|CDY35790.1|  BnaA08g04510D                                          223   3e-66   Brassica napus [oilseed rape]
ref|XP_003563038.1|  PREDICTED: L-ascorbate oxidase homolog             223   3e-66   Brachypodium distachyon [annual false brome]
gb|AAF99833.1|AC008046_5  Putative pectinesterase                       223   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564479.1|  SKU5 similar 6                                        223   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009596487.1|  PREDICTED: L-ascorbate oxidase homolog             223   4e-66   
gb|AAL24296.1|  Unknown protein                                         223   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101945.1|  PREDICTED: L-ascorbate oxidase homolog             223   4e-66   Brassica rapa
ref|XP_007046384.1|  SKU5 similar 5 isoform 2                           221   4e-66   
gb|KDP47151.1|  hypothetical protein JCGZ_00042                         223   6e-66   Jatropha curcas
emb|CDY54804.1|  BnaA06g40970D                                          224   7e-66   Brassica napus [oilseed rape]
ref|XP_002888337.1|  hypothetical protein ARALYDRAFT_475543             223   8e-66   
ref|XP_006307199.1|  hypothetical protein CARUB_v10008790mg             222   1e-65   Capsella rubella
ref|XP_009758923.1|  PREDICTED: L-ascorbate oxidase homolog             222   1e-65   Nicotiana sylvestris
ref|XP_009630902.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    222   1e-65   Nicotiana tomentosiformis
ref|XP_010459724.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    222   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006657750.1|  PREDICTED: L-ascorbate oxidase homolog             222   2e-65   Oryza brachyantha
ref|XP_009794442.1|  PREDICTED: L-ascorbate oxidase homolog             222   2e-65   Nicotiana sylvestris
ref|XP_010459725.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    221   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog             221   2e-65   Solanum lycopersicum
ref|XP_009418785.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    221   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009630899.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    221   2e-65   
ref|XP_008789824.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    218   2e-65   
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    221   3e-65   Nicotiana tomentosiformis
ref|XP_010089487.1|  L-ascorbate oxidase-like protein                   214   3e-65   
ref|XP_006411628.1|  hypothetical protein EUTSA_v10024832mg             221   3e-65   Eutrema salsugineum [saltwater cress]
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             221   3e-65   Eucalyptus grandis [rose gum]
ref|XP_009418784.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    221   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGJ03718.1|  multicopper oxidase                                     221   3e-65   Citrus maxima [buntan]
ref|XP_009758924.1|  PREDICTED: L-ascorbate oxidase homolog             221   3e-65   Nicotiana sylvestris
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog             221   3e-65   Glycine max [soybeans]
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           221   4e-65   
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             220   5e-65   Citrus clementina [clementine]
gb|KFK44289.1|  hypothetical protein AALP_AA1G238900                    209   5e-65   Arabis alpina [alpine rockcress]
ref|XP_002269614.1|  PREDICTED: L-ascorbate oxidase homolog             220   5e-65   Vitis vinifera
ref|XP_003596958.1|  L-ascorbate oxidase-like protein                   220   6e-65   Medicago truncatula
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             220   6e-65   Eucalyptus grandis [rose gum]
ref|XP_003539859.1|  PREDICTED: L-ascorbate oxidase homolog             220   7e-65   Glycine max [soybeans]
ref|XP_007213899.1|  hypothetical protein PRUPE_ppa003872mg             218   8e-65   
gb|KFK44156.1|  hypothetical protein AALP_AA1G222300                    220   8e-65   Arabis alpina [alpine rockcress]
gb|KHN21220.1|  L-ascorbate oxidase like                                219   8e-65   Glycine soja [wild soybean]
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog             220   9e-65   Solanum lycopersicum
ref|XP_010500092.1|  PREDICTED: L-ascorbate oxidase homolog             219   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_007132533.1|  hypothetical protein PHAVU_011G102500g             219   1e-64   Phaseolus vulgaris [French bean]
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             219   1e-64   
gb|EMT15848.1|  L-ascorbate oxidase-like protein                        219   1e-64   
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             219   1e-64   Nelumbo nucifera [Indian lotus]
gb|KFK34651.1|  hypothetical protein AALP_AA5G173600                    219   1e-64   Arabis alpina [alpine rockcress]
ref|XP_010923874.1|  PREDICTED: L-ascorbate oxidase homolog             219   1e-64   Elaeis guineensis
ref|XP_009612547.1|  PREDICTED: L-ascorbate oxidase homolog             219   2e-64   Nicotiana tomentosiformis
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog             219   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002460757.1|  hypothetical protein SORBIDRAFT_02g034420          219   2e-64   
ref|XP_008455444.1|  PREDICTED: L-ascorbate oxidase homolog             219   2e-64   Cucumis melo [Oriental melon]
ref|XP_010461374.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    219   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010480557.1|  PREDICTED: L-ascorbate oxidase homolog             219   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             219   2e-64   Citrus clementina [clementine]
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             219   2e-64   Citrus sinensis [apfelsine]
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             219   2e-64   Prunus mume [ume]
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                   219   2e-64   Morus notabilis
gb|ACL53812.1|  unknown                                                 219   3e-64   Zea mays [maize]
dbj|BAK04971.1|  predicted protein                                      219   3e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP19581.1|  unnamed protein product                                218   3e-64   Coffea canephora [robusta coffee]
ref|NP_001152000.1|  L-ascorbate oxidase precursor                      218   3e-64   
ref|XP_008806480.1|  PREDICTED: L-ascorbate oxidase homolog             218   3e-64   Phoenix dactylifera
ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog             218   3e-64   Solanum tuberosum [potatoes]
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog             218   4e-64   Glycine max [soybeans]
ref|XP_008789823.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    218   4e-64   Phoenix dactylifera
gb|KGN43295.1|  hypothetical protein Csa_7G018770                       216   4e-64   Cucumis sativus [cucumbers]
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             218   4e-64   Prunus persica
ref|XP_004957823.1|  PREDICTED: L-ascorbate oxidase homolog             218   4e-64   Setaria italica
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         218   4e-64   Jatropha curcas
gb|EMS52588.1|  L-ascorbate oxidase-like protein                        223   5e-64   Triticum urartu
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg             218   5e-64   Prunus persica
ref|XP_010929557.1|  PREDICTED: L-ascorbate oxidase homolog             218   5e-64   Elaeis guineensis
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             218   5e-64   
gb|EEE67250.1|  hypothetical protein OsJ_24405                          218   5e-64   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82126.1|  hypothetical protein OsI_26158                          218   5e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_009803721.1|  PREDICTED: L-ascorbate oxidase homolog             218   6e-64   Nicotiana sylvestris
gb|KHG04142.1|  L-ascorbate oxidase                                     218   6e-64   Gossypium arboreum [tree cotton]
ref|XP_004231076.1|  PREDICTED: L-ascorbate oxidase homolog             218   6e-64   Solanum lycopersicum
ref|XP_002301616.1|  hypothetical protein POPTR_0002s21400g             218   6e-64   Populus trichocarpa [western balsam poplar]
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         218   6e-64   Jatropha curcas
gb|ABR18324.1|  unknown                                                 218   6e-64   Picea sitchensis
ref|XP_002272880.1|  PREDICTED: L-ascorbate oxidase homolog             218   7e-64   Vitis vinifera
ref|XP_010498473.1|  PREDICTED: L-ascorbate oxidase homolog             217   7e-64   Camelina sativa [gold-of-pleasure]
ref|XP_006855939.1|  hypothetical protein AMTR_s00037p00216460          217   8e-64   Amborella trichopoda
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             217   8e-64   
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   217   8e-64   Medicago truncatula
dbj|BAC83966.1|  putative PS60                                          218   9e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010278638.1|  PREDICTED: L-ascorbate oxidase homolog             217   1e-63   Nelumbo nucifera [Indian lotus]
ref|XP_004144874.1|  PREDICTED: L-ascorbate oxidase homolog             217   1e-63   Cucumis sativus [cucumbers]
ref|XP_008224692.1|  PREDICTED: L-ascorbate oxidase homolog             216   1e-63   Prunus mume [ume]
gb|EMS67789.1|  L-ascorbate oxidase-like protein                        218   2e-63   Triticum urartu
ref|XP_002866796.1|  hypothetical protein ARALYDRAFT_490604             216   2e-63   
ref|XP_009402574.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    216   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008447902.1|  PREDICTED: L-ascorbate oxidase homolog             216   2e-63   Cucumis melo [Oriental melon]
ref|NP_195555.2|  protein SKU5 similar 9                                216   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009597920.1|  PREDICTED: L-ascorbate oxidase homolog             216   3e-63   Nicotiana tomentosiformis
emb|CAB37498.1|  putative pectinesterase                                216   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002518462.1|  multicopper oxidase, putative                      216   3e-63   Ricinus communis
gb|KGN43515.1|  hypothetical protein Csa_7G043570                       213   3e-63   Cucumis sativus [cucumbers]
ref|XP_009794440.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    215   4e-63   Nicotiana sylvestris
ref|XP_002524823.1|  multicopper oxidase, putative                      215   4e-63   Ricinus communis
ref|XP_006366591.1|  PREDICTED: L-ascorbate oxidase homolog             216   4e-63   
dbj|BAK00459.1|  predicted protein                                      215   5e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007026110.1|  SKU5 similar 4 isoform 3                           215   6e-63   
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             215   6e-63   
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog             215   6e-63   Cucumis sativus [cucumbers]
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                           215   7e-63   
dbj|BAJ91397.1|  predicted protein                                      215   7e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         215   7e-63   
ref|XP_006656379.1|  PREDICTED: L-ascorbate oxidase homolog             215   8e-63   Oryza brachyantha
ref|XP_006283464.1|  hypothetical protein CARUB_v10004509mg             214   1e-62   Capsella rubella
ref|XP_010555198.1|  PREDICTED: L-ascorbate oxidase homolog             214   1e-62   Tarenaya hassleriana [spider flower]
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog             214   1e-62   Pyrus x bretschneideri [bai li]
ref|NP_173603.1|  SKU5 similar 8 protein                                214   1e-62   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ38022.1|  hypothetical protein OsJ_22366                          214   1e-62   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02087.1|  hypothetical protein OsI_24168                          214   1e-62   Oryza sativa Indica Group [Indian rice]
ref|NP_001058365.1|  Os06g0678800                                       214   1e-62   
gb|KJB67220.1|  hypothetical protein B456_010G181000                    213   1e-62   Gossypium raimondii
ref|XP_009400332.1|  PREDICTED: L-ascorbate oxidase homolog             214   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006413696.1|  hypothetical protein EUTSA_v10024862mg             214   2e-62   Eutrema salsugineum [saltwater cress]
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    214   2e-62   Populus euphratica
ref|XP_010323833.1|  PREDICTED: L-ascorbate oxidase homolog             214   2e-62   Solanum lycopersicum
ref|XP_010918208.1|  PREDICTED: L-ascorbate oxidase homolog             214   2e-62   Elaeis guineensis
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog             214   2e-62   
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             213   2e-62   
ref|XP_010431777.1|  PREDICTED: L-ascorbate oxidase homolog             214   2e-62   Camelina sativa [gold-of-pleasure]
emb|CDX82897.1|  BnaC01g13470D                                          213   2e-62   
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog             213   2e-62   Cicer arietinum [garbanzo]
ref|XP_009135529.1|  PREDICTED: L-ascorbate oxidase homolog             213   2e-62   Brassica rapa
ref|NP_173604.1|  SKU5 similar 7 protein                                213   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010690287.1|  PREDICTED: L-ascorbate oxidase homolog             213   3e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB50840.1|  hypothetical protein B456_008G189200                    213   3e-62   Gossypium raimondii
emb|CDX79120.1|  BnaA01g11870D                                          213   3e-62   
ref|XP_006342554.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    216   3e-62   
emb|CDP10787.1|  unnamed protein product                                213   3e-62   Coffea canephora [robusta coffee]
ref|XP_010436936.1|  PREDICTED: L-ascorbate oxidase homolog             213   3e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010439384.1|  PREDICTED: L-ascorbate oxidase homolog             213   3e-62   
ref|XP_010434093.1|  PREDICTED: L-ascorbate oxidase homolog             213   3e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010448953.1|  PREDICTED: L-ascorbate oxidase homolog             213   3e-62   Camelina sativa [gold-of-pleasure]
ref|NP_193932.1|  protein SKU5 similar 4                                213   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791980.1|  PREDICTED: L-ascorbate oxidase homolog             213   4e-62   Phoenix dactylifera
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog             213   4e-62   
gb|KJB67219.1|  hypothetical protein B456_010G181000                    212   4e-62   Gossypium raimondii
ref|XP_003563398.1|  PREDICTED: L-ascorbate oxidase homolog             213   5e-62   Brachypodium distachyon [annual false brome]
ref|XP_002869849.1|  hypothetical protein ARALYDRAFT_914433             213   5e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_009408654.1|  PREDICTED: L-ascorbate oxidase homolog             212   6e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004487420.1|  PREDICTED: L-ascorbate oxidase homolog             212   6e-62   Cicer arietinum [garbanzo]
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g             212   6e-62   
ref|XP_006416260.1|  hypothetical protein EUTSA_v10007292mg             212   6e-62   Eutrema salsugineum [saltwater cress]
gb|KHG02352.1|  L-ascorbate oxidase                                     212   6e-62   Gossypium arboreum [tree cotton]
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog             212   6e-62   
gb|KJB67218.1|  hypothetical protein B456_010G181000                    212   6e-62   Gossypium raimondii
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             212   9e-62   
ref|XP_008798222.1|  PREDICTED: L-ascorbate oxidase homolog             212   9e-62   
ref|XP_002893186.1|  hypothetical protein ARALYDRAFT_313077             211   1e-61   
ref|XP_003549771.1|  PREDICTED: L-ascorbate oxidase homolog             211   1e-61   
ref|XP_006282576.1|  hypothetical protein CARUB_v10004445mg             212   2e-61   
ref|XP_006416404.1|  hypothetical protein EUTSA_v10007361mg             211   2e-61   
gb|EPS74059.1|  hypothetical protein M569_00695                         211   2e-61   
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog             211   2e-61   
ref|XP_004253203.1|  PREDICTED: L-ascorbate oxidase homolog             211   3e-61   
ref|XP_002438855.1|  hypothetical protein SORBIDRAFT_10g027270          211   3e-61   
ref|XP_010539014.1|  PREDICTED: L-ascorbate oxidase homolog             211   3e-61   
ref|XP_004507683.1|  PREDICTED: L-ascorbate oxidase homolog             211   3e-61   
emb|CDY31468.1|  BnaC05g15770D                                          211   3e-61   
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog             210   3e-61   
gb|KGN64509.1|  hypothetical protein Csa_1G062350                       207   4e-61   
ref|XP_009782819.1|  PREDICTED: L-ascorbate oxidase homolog             210   5e-61   
ref|NP_001147597.1|  LOC100281206 precursor                             210   5e-61   
emb|CAH67167.1|  H0211B05.4                                             210   7e-61   
ref|NP_001053555.1|  Os04g0561900                                       210   7e-61   
gb|KHN03487.1|  L-ascorbate oxidase like                                209   1e-60   
ref|XP_009629876.1|  PREDICTED: L-ascorbate oxidase homolog             208   2e-60   
gb|EYU17541.1|  hypothetical protein MIMGU_mgv1a004531mg                208   2e-60   
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog             208   2e-60   
gb|ABK95805.1|  unknown                                                 208   2e-60   
ref|XP_004145114.1|  PREDICTED: L-ascorbate oxidase homolog             208   2e-60   
ref|XP_004966212.1|  PREDICTED: L-ascorbate oxidase homolog             208   2e-60   
gb|KEH29685.1|  multi-copper oxidase-like protein                       207   3e-60   
ref|XP_009149524.1|  PREDICTED: L-ascorbate oxidase homolog             208   3e-60   
ref|XP_008440923.1|  PREDICTED: L-ascorbate oxidase homolog             207   3e-60   
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog             207   4e-60   
gb|KFK28784.1|  hypothetical protein AALP_AA7G047600                    206   1e-59   
ref|XP_003529638.1|  PREDICTED: L-ascorbate oxidase homolog             206   1e-59   
gb|KFK30447.1|  hypothetical protein AALP_AA7G262200                    206   1e-59   
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             206   2e-59   
gb|EYU27771.1|  hypothetical protein MIMGU_mgv1a003982mg                205   3e-59   
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             205   3e-59   
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             205   4e-59   
gb|ABK25324.1|  unknown                                                 203   1e-58   
ref|XP_003610452.1|  L-ascorbate oxidase-like protein                   204   1e-58   
ref|XP_007153964.1|  hypothetical protein PHAVU_003G080100g             203   2e-58   
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             203   2e-58   
emb|CDP04415.1|  unnamed protein product                                202   3e-58   
ref|XP_010052867.1|  PREDICTED: L-ascorbate oxidase homolog             202   5e-58   
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog             202   6e-58   
gb|ABK25092.1|  unknown                                                 201   1e-57   
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             201   1e-57   
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             201   1e-57   
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog             201   1e-57   
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog             201   1e-57   
gb|KJB57755.1|  hypothetical protein B456_009G179300                    200   2e-57   
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             200   2e-57   
gb|KHG03845.1|  L-ascorbate oxidase                                     199   4e-57   
ref|XP_009347241.1|  PREDICTED: L-ascorbate oxidase homolog             199   5e-57   
gb|KGN63948.1|  hypothetical protein Csa_1G031720                       197   6e-57   
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             199   7e-57   
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          198   1e-56   
ref|XP_002459273.1|  hypothetical protein SORBIDRAFT_02g001610          192   1e-56   
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             198   1e-56   
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    198   1e-56   
ref|XP_009366415.1|  PREDICTED: L-ascorbate oxidase homolog             197   2e-56   
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             197   3e-56   
ref|NP_001058771.1|  Os07g0119400                                       197   4e-56   
emb|CDX81353.1|  BnaC09g07640D                                          197   4e-56   
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             197   5e-56   
emb|CDY18626.1|  BnaA09g07690D                                          197   5e-56   
ref|XP_008663511.1|  PREDICTED: L-ascorbate oxidase homolog             197   5e-56   
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             197   5e-56   
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             196   6e-56   
emb|CDY01453.1|  BnaA07g12260D                                          196   6e-56   
emb|CDY12788.1|  BnaC07g16450D                                          196   6e-56   
emb|CBI18560.3|  unnamed protein product                                196   7e-56   
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             196   7e-56   
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             196   7e-56   
ref|XP_008338225.1|  PREDICTED: L-ascorbate oxidase homolog             196   8e-56   
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             196   1e-55   
emb|CDY43557.1|  BnaC02g16540D                                          195   2e-55   
ref|XP_009115829.1|  PREDICTED: L-ascorbate oxidase homolog             195   2e-55   
gb|KHN44494.1|  L-ascorbate oxidase like                                195   3e-55   
ref|NP_569041.1|  protein SKU5 similar 17                               195   3e-55   
gb|AAM61328.1|  pectinesterase-like protein                             195   3e-55   
dbj|BAB08634.1|  pectinesterase like protein                            194   3e-55   
ref|XP_010686816.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    194   3e-55   
ref|XP_002866726.1|  predicted protein                                  194   3e-55   
ref|XP_010255119.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    194   4e-55   
gb|EMT24760.1|  L-ascorbate oxidase-like protein                        194   4e-55   
ref|XP_010255117.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    194   4e-55   
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             194   6e-55   
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             194   7e-55   
ref|XP_004955371.1|  PREDICTED: L-ascorbate oxidase homolog             193   8e-55   
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             194   8e-55   
gb|KGN48499.1|  hypothetical protein Csa_6G490140                       192   8e-55   
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    193   9e-55   
ref|XP_006280268.1|  hypothetical protein CARUB_v10026189mg             193   1e-54   
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             192   1e-54   
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             192   2e-54   
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             192   2e-54   
ref|XP_003557661.2|  PREDICTED: L-ascorbate oxidase homolog             192   2e-54   
gb|KDO79340.1|  hypothetical protein CISIN_1g0092422mg                  191   2e-54   
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          192   3e-54   
gb|EPS65321.1|  hypothetical protein M569_09457                         183   3e-54   
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         192   4e-54   
ref|XP_010227225.1|  PREDICTED: L-ascorbate oxidase homolog             192   4e-54   
gb|EMS54595.1|  L-ascorbate oxidase-like protein                        192   4e-54   
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             191   4e-54   
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             191   4e-54   
ref|XP_010088984.1|  L-ascorbate oxidase-like protein                   191   6e-54   
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               191   6e-54   
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             191   6e-54   
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             191   9e-54   
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     191   1e-53   
ref|XP_010484570.1|  PREDICTED: L-ascorbate oxidase homolog             191   1e-53   
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             190   1e-53   
ref|XP_002522337.1|  multicopper oxidase, putative                      190   1e-53   
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         190   2e-53   
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             190   2e-53   
gb|KCW68031.1|  hypothetical protein EUGRSUZ_F01712                     189   2e-53   
ref|XP_002522339.1|  multicopper oxidase, putative                      189   3e-53   
ref|XP_002448327.1|  hypothetical protein SORBIDRAFT_06g025300          190   3e-53   
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             189   4e-53   
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             189   4e-53   
ref|XP_006657409.1|  PREDICTED: L-ascorbate oxidase homolog             188   7e-53   
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             188   7e-53   
gb|AGE09595.1|  SKU5-like protein                                       187   8e-53   
ref|XP_010686815.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    188   1e-52   
ref|XP_010464737.1|  PREDICTED: L-ascorbate oxidase homolog             187   1e-52   
ref|XP_006848556.1|  hypothetical protein AMTR_s00169p00049950          187   2e-52   
ref|XP_008792598.1|  PREDICTED: L-ascorbate oxidase homolog             186   3e-52   
ref|XP_009348089.1|  PREDICTED: L-ascorbate oxidase homolog             186   3e-52   
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog             186   3e-52   
ref|XP_006304367.1|  hypothetical protein CARUB_v10010844mg             186   4e-52   
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             186   4e-52   
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             186   4e-52   
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             186   5e-52   
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             186   5e-52   
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             186   7e-52   
gb|KDP31875.1|  hypothetical protein JCGZ_12336                         185   8e-52   
ref|XP_003550084.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    185   8e-52   
ref|XP_004301852.1|  PREDICTED: L-ascorbate oxidase homolog             185   1e-51   
gb|KDO79346.1|  hypothetical protein CISIN_1g009171mg                   184   2e-51   
ref|XP_006402152.1|  hypothetical protein EUTSA_v10013200mg             184   2e-51   
emb|CAN72539.1|  hypothetical protein VITISV_028750                     184   2e-51   
ref|XP_006466655.1|  PREDICTED: L-ascorbate oxidase homolog             184   2e-51   
ref|XP_009347247.1|  PREDICTED: L-ascorbate oxidase homolog             184   2e-51   
ref|XP_004300548.1|  PREDICTED: L-ascorbate oxidase homolog             184   2e-51   
ref|XP_009368021.1|  PREDICTED: L-ascorbate oxidase homolog             184   2e-51   
ref|XP_009773470.1|  PREDICTED: L-ascorbate oxidase homolog             184   2e-51   
ref|XP_006425822.1|  hypothetical protein CICLE_v10027285mg             184   2e-51   
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog             184   3e-51   
ref|XP_004511977.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    184   3e-51   
ref|XP_002268020.2|  PREDICTED: L-ascorbate oxidase homolog             184   3e-51   
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             183   4e-51   
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             183   5e-51   
ref|XP_004511976.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    183   6e-51   
gb|KEH20499.1|  multi-copper oxidase-like protein                       183   6e-51   
ref|XP_010908384.1|  PREDICTED: L-ascorbate oxidase homolog             183   7e-51   
emb|CBI18561.3|  unnamed protein product                                184   7e-51   
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             183   7e-51   
ref|XP_009387378.1|  PREDICTED: L-ascorbate oxidase homolog             182   8e-51   
ref|XP_002310164.1|  multi-copper oxidase type 1 family protein         182   9e-51   
ref|XP_011013815.1|  PREDICTED: L-ascorbate oxidase homolog             182   9e-51   
gb|KEH20500.1|  multi-copper oxidase-like protein                       182   1e-50   
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                   182   1e-50   
ref|XP_004229062.1|  PREDICTED: L-ascorbate oxidase homolog             182   1e-50   
ref|XP_010680456.1|  PREDICTED: L-ascorbate oxidase homolog             182   1e-50   
ref|XP_003524640.1|  PREDICTED: L-ascorbate oxidase homolog             181   2e-50   
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog             182   2e-50   
gb|KHN44868.1|  L-ascorbate oxidase like                                181   2e-50   
emb|CDX89588.1|  BnaC04g36070D                                          175   2e-50   
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             181   2e-50   
gb|EEE61490.1|  hypothetical protein OsJ_15776                          182   3e-50   
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             181   3e-50   
gb|EEC77800.1|  hypothetical protein OsI_16980                          181   4e-50   
ref|XP_009383852.1|  PREDICTED: L-ascorbate oxidase homolog             181   5e-50   
ref|XP_006341879.1|  PREDICTED: L-ascorbate oxidase homolog             181   6e-50   
ref|XP_010247849.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    180   7e-50   
ref|XP_010247847.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    180   8e-50   
ref|XP_010247848.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    180   8e-50   
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             180   9e-50   
gb|KHN36198.1|  L-ascorbate oxidase like                                180   9e-50   
emb|CAN72538.1|  hypothetical protein VITISV_028749                     180   1e-49   
ref|XP_011039229.1|  PREDICTED: L-ascorbate oxidase homolog             179   1e-49   
ref|XP_009794441.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    178   2e-49   
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             179   2e-49   
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog             179   2e-49   
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             179   3e-49   
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    178   3e-49   
emb|CDP02461.1|  unnamed protein product                                178   3e-49   
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             178   3e-49   
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             178   4e-49   
sp|P29162.1|ASOL_TOBAC  RecName: Full=L-ascorbate oxidase homolog...    178   4e-49   
ref|XP_002867467.1|  hypothetical protein ARALYDRAFT_328883             178   6e-49   
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             177   6e-49   
ref|XP_009588330.1|  PREDICTED: L-ascorbate oxidase homolog             178   6e-49   
ref|XP_010433262.1|  PREDICTED: L-ascorbate oxidase homolog             177   8e-49   
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             177   8e-49   
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             177   8e-49   
ref|XP_010109886.1|  L-ascorbate oxidase-like protein                   177   8e-49   
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein         177   9e-49   
ref|XP_010271079.1|  PREDICTED: L-ascorbate oxidase homolog             177   9e-49   
ref|XP_007155970.1|  hypothetical protein PHAVU_003G247800g             177   1e-48   
gb|KGN62015.1|  hypothetical protein Csa_2G286480                       176   1e-48   
ref|XP_010438504.1|  PREDICTED: L-ascorbate oxidase homolog             177   1e-48   
ref|XP_009594575.1|  PREDICTED: L-ascorbate oxidase homolog             176   1e-48   
ref|NP_194538.1|  SKU5 similar 10 protein                               177   1e-48   
emb|CDP02462.1|  unnamed protein product                                176   2e-48   
ref|XP_007014661.1|  SKU5 similar 12                                    176   2e-48   
ref|XP_008457817.1|  PREDICTED: L-ascorbate oxidase homolog             176   3e-48   
ref|XP_004148037.1|  PREDICTED: L-ascorbate oxidase homolog             176   3e-48   
ref|XP_009140476.1|  PREDICTED: L-ascorbate oxidase homolog             176   3e-48   
gb|KHN42054.1|  L-ascorbate oxidase like                                175   4e-48   
ref|XP_007163845.1|  hypothetical protein PHAVU_001G269200g             176   4e-48   
ref|XP_010034522.1|  PREDICTED: L-ascorbate oxidase homolog             175   5e-48   
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg                175   5e-48   
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             175   5e-48   
ref|XP_004509178.1|  PREDICTED: L-ascorbate oxidase homolog             175   6e-48   
ref|XP_009600428.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    175   6e-48   
ref|XP_009600426.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    175   7e-48   
ref|XP_009591795.1|  PREDICTED: L-ascorbate oxidase homolog             175   7e-48   
gb|AAQ90182.1|  ntp101                                                  175   7e-48   
gb|AFK33666.1|  unknown                                                 173   8e-48   
ref|XP_009766183.1|  PREDICTED: L-ascorbate oxidase homolog             174   9e-48   



>ref|XP_009623446.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=540

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   EDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQ+KDQIGS+YYFPSLAFHKAAGGFGGI+
Sbjct  83   WNGIQNRRNSFEDGVYGTTCPIPPGRNFTYILQMKDQIGSYYYFPSLAFHKAAGGFGGIK  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>emb|CAA65634.1| PS60 [Nicotiana tabacum]
Length=540

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   EDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQ+KDQIGS+YYFPSLAFHKAAGGFGGI+
Sbjct  83   WNGIQNRRNSFEDGVYGTTCPIPPGRNFTYILQMKDQIGSYYYFPSLAFHKAAGGFGGIK  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>ref|XP_009785141.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=540

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   EDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQ+KDQIGS+YYFPSLAFHKAAGGFGGI+
Sbjct  83   WNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQMKDQIGSYYYFPSLAFHKAAGGFGGIK  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>ref|XP_008452926.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
 gb|ADN34135.1| multicopper oxidase [Cucumis melo subsp. melo]
Length=541

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+FTWNV+YA IYPLGV QQGILINGQFPGP+I CVTNDNL INVFNSLD+PFL+S
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDIHCVTNDNLIINVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>gb|KGN55480.1| hypothetical protein Csa_4G653410 [Cucumis sativus]
Length=447

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+FTWNV+YA IYPLGV QQGILINGQFPGP++ CVTNDNL INVFNSLD+PFL+S
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>ref|XP_004145593.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+FTWNV+YA IYPLGV QQGILINGQFPGP++ CVTNDNL INVFNSLD+PFL+S
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>ref|XP_004157080.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+FTWNV+YA IYPLGV QQGILINGQFPGP++ CVTNDNL INVFNSLD+PFL+S
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>ref|XP_010101299.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB88234.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=541

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  22   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  82   WNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  141

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  142  ILSRPRIPVP  151



>ref|XP_006435292.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 gb|ESR48532.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
Length=446

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILIN QFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  25   EDPYRFFNWNVTYGDIYPLGVRQRGILINWQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  145  ILSRPRIPVP  154



>ref|XP_004142986.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 gb|KGN62282.1| Multicopper oxidase [Cucumis sativus]
Length=539

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY TIYPLG+PQQGILINGQFPGP+I  VTNDN+ INVFNSLD+PFLLS
Sbjct  20   EDPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPFLLS  79

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQ+KDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  80   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIR  139

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  140  ILSRPRIPVP  149



>ref|XP_008445302.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=538

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY TIYPLG+PQQGILINGQFPGP+I  VTNDN+ INVFNSLD+PFLLS
Sbjct  19   EDPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPFLLS  78

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQ+KDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  79   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIR  138

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  139  ILSRPRIPVP  148



>ref|XP_007160607.1| hypothetical protein PHAVU_001G001500g [Phaseolus vulgaris]
 gb|ESW32601.1| hypothetical protein PHAVU_001G001500g [Phaseolus vulgaris]
Length=539

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLDQPFLLS
Sbjct  21   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLS  80

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGG+R
Sbjct  81   WNGVQQRRNSFEDGVWGTTCPIPPGGNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGLR  140

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  141  ILSRPRIPVP  150



>ref|XP_007017957.1| SKU5 similar 5 isoform 3 [Theobroma cacao]
 gb|EOY15182.1| SKU5 similar 5 isoform 3 [Theobroma cacao]
Length=445

 Score =   236 bits (602),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   DDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  83   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>ref|XP_009334388.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=544

 Score =   238 bits (608),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  146  ILSRPRIPVP  155



>ref|XP_006596528.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   238 bits (608),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLDQPFLLS
Sbjct  29   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNSFEDGV GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  89   WNGVQQRRNSFEDGVLGTTCPIPPGGNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>ref|XP_006435293.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 ref|XP_006473746.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR48533.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 gb|KDO85016.1| hypothetical protein CISIN_1g009149mg [Citrus sinensis]
Length=542

 Score =   238 bits (608),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILIN QFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  25   EDPYRFFNWNVTYGDIYPLGVRQRGILINWQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  145  ILSRPRIPVP  154



>ref|XP_002510630.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF52817.1| multicopper oxidase, putative [Ricinus communis]
Length=546

 Score =   238 bits (608),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLG+ QQGILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  28   EDPYRFFNWNVTYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  87

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  88   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  147

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  148  ILSRPRIPVP  157



>emb|CAB08077.1| pectinesterase [Solanum lycopersicum]
Length=504

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL IN+ NSLD+PFLLS
Sbjct  1    EDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVINIHNSLDEPFLLS  60

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQNRRNSF DGVYGTTCPI PG N T+ LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  61   WNGIQNRRNSFVDGVYGTTCPIPPGRNNTFNLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  120

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  121  ILSRPRIPVP  130



>ref|XP_008387887.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=544

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  146  ILSRPRIPVP  155



>ref|XP_003550444.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN48525.1| L-ascorbate oxidase like [Glycine soja]
Length=541

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLDQPFLLS
Sbjct  23   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNSFEDGV GTTCPI  G NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  83   WNGVQQRRNSFEDGVLGTTCPIPAGGNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>ref|XP_010667351.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=539

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F+WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFN+LD PFLLS
Sbjct  21   EDPYRFFSWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNNLDVPFLLS  80

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNSFEDGVYGTTCPI PG NFTYMLQVKDQIGSFYY+PSLAFHKAAG FGGIR
Sbjct  81   WNGVQNRRNSFEDGVYGTTCPIPPGRNFTYMLQVKDQIGSFYYYPSLAFHKAAGAFGGIR  140

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  141  ILSRPRIPVP  150



>ref|XP_007221787.1| hypothetical protein PRUPE_ppa003860mg [Prunus persica]
 gb|EMJ22986.1| hypothetical protein PRUPE_ppa003860mg [Prunus persica]
Length=544

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  146  ILSRPRIPVP  155



>ref|XP_007017956.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
 gb|EOY15181.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
Length=475

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   DDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  83   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>gb|KEH40258.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  25   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  145  ILSRPRIPVP  154



>ref|XP_006390228.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
 gb|ESQ27514.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
Length=515

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>gb|KHN33820.1| L-ascorbate oxidase like [Glycine soja]
Length=540

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  22   EDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  82   WNGIQQRRNSFEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  141

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  142  ILSRPRIPVP  151



>ref|XP_010536445.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  24   EDPYRFFDWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSF+DGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFQDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>ref|XP_003523207.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  29   EDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  89   WNGIQQRRNSFEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>ref|XP_004238406.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=540

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL IN+ NSLD+PFLLS
Sbjct  23   EDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVINIHNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNSF DGVYGTTCPI PG N T+ LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  83   WNGVQNRRNSFVDGVYGTTCPIPPGRNNTFNLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>ref|XP_006342102.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=540

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL IN+ NSLD+PFLLS
Sbjct  23   EDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVINIHNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNSF DGVYGTTCPI PG N T+ LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  83   WNGVQNRRNSFVDGVYGTTCPIPPGRNNTFNLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>gb|KJB58003.1| hypothetical protein B456_009G189900 [Gossypium raimondii]
Length=445

 Score =   234 bits (597),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  I+PLGV Q GILINGQFPGP+I  VTNDNL INVFNSL++PFLLS
Sbjct  23   EDPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  83   WNGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>gb|KJB58004.1| hypothetical protein B456_009G189900 [Gossypium raimondii]
Length=474

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  I+PLGV Q GILINGQFPGP+I  VTNDNL INVFNSL++PFLLS
Sbjct  23   EDPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  83   WNGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>ref|XP_007017955.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
 gb|EOY15180.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
Length=541

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   DDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  83   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>gb|KDP36848.1| hypothetical protein JCGZ_08139 [Jatropha curcas]
Length=542

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  25   EDPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS+EDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  145  ILSRPRIPVP  154



>ref|XP_008221175.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=544

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY++F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  26   EDPYKFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  146  ILSRPRIPVP  155



>ref|XP_007136137.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
 gb|ESW08131.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
Length=548

 Score =   236 bits (602),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  I+PLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  30   EDPYRFFNWNVTYGDIFPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKA GGFGGIR
Sbjct  90   WNGIQQRRNSFEDGVFGTTCPIAPGKNFTYILQVKDQIGSFYYFPSLAFHKAGGGFGGIR  149

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  150  ILSRPRIPVP  159



>ref|XP_004500896.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=548

 Score =   236 bits (601),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  30   EDPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSL+FHKAAGGFGGIR
Sbjct  90   WNGIQQRRNSFEDGVFGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLSFHKAAGGFGGIR  149

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  150  ILSRPRIPVP  159



>ref|XP_006390229.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
 gb|ESQ27515.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
Length=541

 Score =   236 bits (601),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>gb|KFK34458.1| hypothetical protein AALP_AA5G148000 [Arabis alpina]
Length=541

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>ref|XP_010428667.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INVFNSLD+PFLLS
Sbjct  25   EDPYRFYEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNSF DGVYGTTCPI PG N+TYMLQ+KDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQQRRNSFVDGVYGTTCPIPPGQNYTYMLQMKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  145  ILSRPRIPVP  154



>gb|KJB15896.1| hypothetical protein B456_002G202300 [Gossypium raimondii]
Length=449

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP++  VTNDNL INV+N+LD+PFLLS
Sbjct  27   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDLYSVTNDNLIINVYNNLDEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQ KDQIG+FYYFPSLAFHKAAGGFGGIR
Sbjct  87   WNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIGTFYYFPSLAFHKAAGGFGGIR  146

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  147  ILSRPRIPVP  156



>gb|KHF99853.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  I+PLGV Q GILINGQFPGP+I  VTNDNL INVFNSL++PFLLS
Sbjct  23   EDPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  83   WNGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>gb|KJB58002.1| hypothetical protein B456_009G189900 [Gossypium raimondii]
Length=541

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  I+PLGV Q GILINGQFPGP+I  VTNDNL INVFNSL++PFLLS
Sbjct  23   EDPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  83   WNGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>ref|XP_008377105.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=544

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSF DGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  86   WNGIQQRRNSFVDGVYGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLDFHKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  146  ILSRPRIPVP  155



>ref|XP_007041705.1| SKU5 similar 5 [Theobroma cacao]
 gb|EOX97536.1| SKU5 similar 5 [Theobroma cacao]
Length=547

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGPE+  VTNDNL INV+N+LD+PFLLS
Sbjct  29   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPELYSVTNDNLIINVYNNLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGI+
Sbjct  89   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIK  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>ref|XP_010471765.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   233 bits (595),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INV+NSLD+PFLLS
Sbjct  25   EDPYRFYEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNSF DGVYGTTCPI PG N+TYMLQ+KDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQQRRNSFVDGVYGTTCPIPPGQNYTYMLQMKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  145  ILSRPRIPVP  154



>ref|XP_011034917.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=547

 Score =   233 bits (594),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  29   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  89   WNGIQQRRNSFEDGVIGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>ref|XP_003527461.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   233 bits (594),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  29   EDPYRFFNWNITYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGV+GTTCPI  G NFTY+LQVKDQIG+FYYFPSLAFHKAAGGFGGIR
Sbjct  89   WNGIQQRRNSFEDGVFGTTCPIPAGKNFTYILQVKDQIGTFYYFPSLAFHKAAGGFGGIR  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>ref|XP_004291312.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=545

 Score =   233 bits (594),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  27   EDPYRFFQWNVTYGDIYPLGVRQRGILINGQFPGPDINSVTNDNLIINVFNSLDEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ R NSF+DGVYGTTCPI PG N TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  87   WNGIQQRHNSFQDGVYGTTCPIPPGRNLTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  146

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  147  ILSRPRIPVP  156



>ref|XP_004499321.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=544

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLG+ QQGILINGQFPGP+I  VTNDNL INVFNSLD PFL+S
Sbjct  26   EDPYRFFDWNITYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDVPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGV GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  86   WNGVQQRRNSYEDGVSGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  146  ILSRPRIPVP  155



>ref|XP_002300669.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE79942.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=547

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  29   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  89   WNGIQQRRNSFEDGVIGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>ref|XP_002307765.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE94761.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=548

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  29   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS+EDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  89   WNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>ref|XP_006302110.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
 gb|EOA35008.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
Length=541

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNSF DGVYGTTCPI PG N+TYMLQ+KDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  84   WNGVQQRRNSFVDGVYGTTCPIPPGKNYTYMLQMKDQIGSFYYFPSLGFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>ref|XP_011041276.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=548

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  29   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS+EDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  89   WNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIR  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>ref|XP_010539810.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=542

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP++  VTNDNL INVFNSLD+PFL+S
Sbjct  24   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDVRSVTNDNLIINVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQ RRNSF DGVYGTTCPI PG N+TY LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  84   WSGIQQRRNSFVDGVYGTTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRP+I  P
Sbjct  144  ILSRPKIPVP  153



>ref|XP_002889063.1| hypothetical protein ARALYDRAFT_895494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65322.1| hypothetical protein ARALYDRAFT_895494 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQ+KDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>gb|KHG11003.1| L-ascorbate oxidase [Gossypium arboreum]
Length=545

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP++  VTNDNL INV+N+LD+PFLLS
Sbjct  27   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDLYSVTNDNLIINVYNNLDEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQ KDQIG+FYYFPSLAFHKAAGGFGGIR
Sbjct  87   WNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIGTFYYFPSLAFHKAAGGFGGIR  146

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  147  ILSRPRIPVP  156



>ref|XP_011088669.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWN+TYA IYPLGV QQGILINGQFPGP+I  VTNDN+ +NV+N+L +PFLLS
Sbjct  22   EDPYRFFTWNITYADIYPLGVRQQGILINGQFPGPDIYAVTNDNIIVNVYNNLPEPFLLS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++Q+KDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  82   WNGVQQRKNSFEDGVYGTTCPIPPGKNFTYVMQMKDQIGSFYYFPSLAFHKAAGGFGGIR  141

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  142  ILSRPRIPVP  151



>ref|XP_009128157.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=542

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILI+G+FPGP+I  VTNDNL IN+FN+LD+PFLLS
Sbjct  24   EDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+ DGVYGTTCPI PG N+TYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>gb|KJB15897.1| hypothetical protein B456_002G202300 [Gossypium raimondii]
Length=545

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP++  VTNDNL INV+N+LD+PFLLS
Sbjct  27   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDLYSVTNDNLIINVYNNLDEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQ KDQIG+FYYFPSLAFHKAAGGFGGIR
Sbjct  87   WNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIGTFYYFPSLAFHKAAGGFGGIR  146

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  147  ILSRPRIPVP  156



>emb|CDY68834.1| BnaCnng60730D, partial [Brassica napus]
Length=549

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILI+G+FPGP+I  VTNDNL IN+FN+LD+PFLLS
Sbjct  32   EDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEPFLLS  91

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+ DGVYGTTCPI PG N+TYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  92   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  151

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  152  ILSRPRIPVP  161



>emb|CDY55201.1| BnaCnng28410D, partial [Brassica napus]
Length=549

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILI+G+FPGP+I  VTNDNL IN+FN+LD+PFLLS
Sbjct  32   EDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEPFLLS  91

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+ DGVYGTTCPI PG N+TYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  92   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  151

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  152  ILSRPRIPVP  161



>gb|KJB47732.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=325

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            +LSRPRI  P
Sbjct  145  VLSRPRIPVP  154



>ref|XP_010416527.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INV+NSLD+PFLLS
Sbjct  24   EDPYRFYEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNSF DGVYGTTCPI PG N+TY+LQ+KDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVQQRRNSFVDGVYGTTCPIPPGQNYTYVLQMKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>ref|XP_010530339.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=540

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  23   ESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNS+ DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  83   WNGVQNRRNSYVDGVYGTTCPIPPGRNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  143  ILSRPLIPVP  152



>ref|XP_002282214.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI37764.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  24   EDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>ref|XP_011099705.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++TWNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDN+ +NVFNSLD+PFL+ 
Sbjct  20   ESPYRFYTWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNIIVNVFNSLDEPFLIH  79

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+QNRRNS+EDGVYGTTCPI PG NFTY+LQ+KDQIGSF+YFPSLAFHKAAGGFGGI+
Sbjct  80   WSGVQNRRNSYEDGVYGTTCPIPPGQNFTYILQMKDQIGSFFYFPSLAFHKAAGGFGGIK  139

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  140  ILSRPLIPVP  149



>gb|AAL09733.1| At1g76160/T23E18_10 [Arabidopsis thaliana]
Length=541

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILING FPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQ+KDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>ref|NP_177743.1| SKU5-like 5 protein [Arabidopsis thaliana]
 gb|AAF17645.1|AC009978_21 T23E18.10 [Arabidopsis thaliana]
 dbj|BAH19558.1| AT1G76160 [Arabidopsis thaliana]
 gb|AEE35804.1| SKU5-like 5 protein [Arabidopsis thaliana]
Length=541

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILING FPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQ+KDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>ref|XP_010266098.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=547

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSL +PFLLS
Sbjct  29   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLPEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  89   WNGIQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLAFHKAAGGFGGIR  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>gb|AAM97070.1| pectinesterase, putative [Arabidopsis thaliana]
 gb|AAN15546.1| pectinesterase, putative [Arabidopsis thaliana]
Length=541

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILING FPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQ+KDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>gb|KEH36280.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=544

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY++F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSL++PFL+S
Sbjct  26   EDPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAF KAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFQKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  146  ILSRPRIPVP  155



>gb|AFK35121.1| unknown [Medicago truncatula]
Length=544

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY++F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSL++PFL+S
Sbjct  26   EDPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAF KAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFQKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  146  ILSRPRIPVP  155



>gb|ACJ85585.1| unknown [Medicago truncatula]
Length=544

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY++F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSL++PFL+S
Sbjct  26   EDPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIGSFYYFPSLAF KAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFQKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  146  ILSRPRIPVP  155



>ref|XP_002285913.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18890.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVT+  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSL +PFLLS
Sbjct  23   EDPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLTEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  83   WSGVQQRRNSYEDGVYGTTCPIPPGRNFTYILQVKDQIGSFFYFPSLDFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>emb|CAN83942.1| hypothetical protein VITISV_013559 [Vitis vinifera]
Length=541

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVT+  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSL +PFLLS
Sbjct  23   EDPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLTEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  83   WSGVQQRRNSYEDGVYGTTCPIPPGRNFTYILQVKDQIGSFFYFPSLDFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>gb|KJB47729.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
 gb|KJB47730.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=447

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            +LSRPRI  P
Sbjct  145  VLSRPRIPVP  154



>ref|XP_010061137.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW68030.1| hypothetical protein EUGRSUZ_F01712 [Eucalyptus grandis]
Length=543

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL++PFLLS
Sbjct  26   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVINSLNEPFLLS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  145

Query  534  ILSR  545
            ILSR
Sbjct  146  ILSR  149



>ref|XP_008382461.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=535

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF WNVTY  IYPLG  QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRYFDWNVTYGDIYPLGARQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  78

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSFYYFPSLAFHKAAGGFG I+
Sbjct  79   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIK  138

Query  534  ILSRPRILSP  563
            I SRPRI  P
Sbjct  139  IJSRPRIPVP  148



>emb|CDX73238.1| BnaC06g36860D [Brassica napus]
Length=541

 Score =   228 bits (581),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   ESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+ DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGG+R
Sbjct  84   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGLR  143

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  144  ILSRPGIPVP  153



>ref|XP_011046313.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=544

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTN+NL INV+NSL +PFL+S
Sbjct  26   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVYNSLPEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYY+PSLAFHKAAGGFGGIR
Sbjct  86   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYYPSLAFHKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  146  ILSRPLIPVP  155



>ref|XP_002306213.1| hypothetical protein POPTR_0004s18730g [Populus trichocarpa]
 gb|EEE86724.1| hypothetical protein POPTR_0004s18730g [Populus trichocarpa]
Length=543

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTN+NL INV+NSL +PFL+S
Sbjct  26   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVYNSLPEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSFYY+PSLAFHKAAGGFGGIR
Sbjct  86   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYYPSLAFHKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  146  ILSRPLIPVP  155



>gb|AFK33407.1| unknown [Lotus japonicus]
Length=385

 Score =   224 bits (570),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N L +PFLLS
Sbjct  31   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLVINVHNHLPEPFLLS  90

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  91   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYNLQVKDQIGSFFYFPSLAFHKAAGGFGAIK  150

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  151  ILSRPRIPVP  160



>ref|XP_004287955.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=542

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLGV QQGILINGQFPGP+I+CVTNDNL I+VFNSLD+PFL+S
Sbjct  24   EDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQIGS+YYFPSLAFHKAAGG+GGI+
Sbjct  84   WNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYYYFPSLAFHKAAGGYGGIK  143

Query  534  ILSRPRILSP  563
            I SRPRI  P
Sbjct  144  ISSRPRIPVP  153



>ref|XP_010667350.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=539

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INVFN+L+ PFLLS
Sbjct  21   EDPYRYFNWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVFNNLNVPFLLS  80

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+QNRRNS++DGVYGTTCPI PG NFTY LQ KDQIGSFYYFPSLAFHKAAG FGGIR
Sbjct  81   WSGVQNRRNSYQDGVYGTTCPIPPGRNFTYKLQFKDQIGSFYYFPSLAFHKAAGAFGGIR  140

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  141  ILSRPRIPVP  150



>gb|AGT57427.1| ascorbate oxidase [Prunus persica]
Length=536

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  78

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q+RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSFYYFPSLAFHKAAGGFG I+
Sbjct  79   WNGVQHRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIK  138

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  139  ILSRPRIPVP  148



>ref|XP_009106271.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   ESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+ DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGG+R
Sbjct  84   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGLR  143

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  144  ILSRPGIPVP  153



>emb|CDX87633.1| BnaA07g32400D [Brassica napus]
Length=541

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   ESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+ DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGG+R
Sbjct  84   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGLR  143

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  144  ILSRPGIPVP  153



>ref|XP_007200295.1| hypothetical protein PRUPE_ppa004000mg [Prunus persica]
 gb|EMJ01494.1| hypothetical protein PRUPE_ppa004000mg [Prunus persica]
Length=536

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  78

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q+RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSFYYFPSLAFHKAAGGFG I+
Sbjct  79   WNGVQHRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIK  138

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  139  ILSRPRIPVP  148



>ref|XP_008236098.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=536

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  78

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSFYYFPSLAFHKAAGGFG I+
Sbjct  79   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIK  138

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  139  ILSRPRIPVP  148



>ref|XP_004505676.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=533

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  21   EDPYRFFDWNITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  80

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  81   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGSIK  140

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  141  ILSRPRIPVP  150



>gb|KJB14335.1| hypothetical protein B456_002G120000 [Gossypium raimondii]
Length=541

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVT+  IYPLGV Q GILINGQFPGP+I  VTNDNL INV NSL++PFL+S
Sbjct  23   EDPYRFFDWNVTFGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVHNSLNEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  83   WSGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>gb|KHF99506.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVT+  IYPLGV Q GILINGQFPGP+I  VTNDNL INV NSL++PFL+S
Sbjct  23   EDPYRFFDWNVTFGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVHNSLNEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  83   WSGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>ref|XP_008365718.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=373

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPEIFSVTNDNLIINVHNSLPEPFLIS  78

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGTTC I PG NFTY LQVKDQIGSFYYFPSLAFHKAAGGFG I+
Sbjct  79   WNGVQQRRNSYQDGVYGTTCAIPPGQNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIK  138

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  139  ILSRPLIPVP  148



>gb|KCW70295.1| hypothetical protein EUGRSUZ_F03538 [Eucalyptus grandis]
Length=487

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLD PFL+S
Sbjct  22   ENPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDVPFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQ RRNS+EDGVYGTTCPI PG NFTY+ QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  82   WSGIQQRRNSYEDGVYGTTCPIPPGRNFTYIFQVKDQIGSFFYFPSLKFHKAAGGFGGIR  141

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  142  ILSRPLIPVP  151



>gb|KHG21048.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+++WNVTY  IYPLGV Q G+LINGQFPGP+I  VTNDNL INV+N+L++ FLLS
Sbjct  23   EDPYRFYSWNVTYGDIYPLGVRQTGLLINGQFPGPDIHSVTNDNLIINVYNNLNESFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGVYGTTCPI PG NFTYMLQVKDQIGSFYY+PSL FHKAAGGFGGIR
Sbjct  83   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYMLQVKDQIGSFYYYPSLGFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>tpg|DAA62868.1| TPA: hypothetical protein ZEAMMB73_701617, partial [Zea mays]
Length=237

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFN L++PFLLS
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+Q RRNSFEDGV GTTCPI PG NFTY++Q KDQIG++YYFPSLAFHKAAGGFGGIR
Sbjct  90   WSGLQQRRNSFEDGVAGTTCPIPPGSNFTYIMQAKDQIGTYYYFPSLAFHKAAGGFGGIR  149

Query  534  ILSR  545
            +LSR
Sbjct  150  VLSR  153



>ref|XP_004253133.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=544

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY TI+PLG+PQ+GILINGQFPGP+I  VTNDN+ INVFN+LD+ FL+S
Sbjct  22   ESPYRFFEWNVTYGTIWPLGLPQKGILINGQFPGPDIHSVTNDNVIINVFNNLDEEFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQNRRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPS AFHKA+GGFGG R
Sbjct  82   WNGIQNRRNSFEDGVWGTTCPIPPGKNFTYILQVKDQIGSFYYFPSTAFHKASGGFGGFR  141

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  142  ILSRPGIPVP  151



>gb|KJB47727.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=543

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            +LSRPRI  P
Sbjct  145  VLSRPRIPVP  154



>gb|KHG21949.1| L-ascorbate oxidase [Gossypium arboreum]
Length=543

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            +LSRPRI  P
Sbjct  145  VLSRPRIPVP  154



>gb|KJB47731.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=522

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            +LSRPRI  P
Sbjct  145  VLSRPRIPVP  154



>gb|KEH30610.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=447

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  26   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLPEPFLLS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  86   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGSIK  145

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  146  ILSRPRIPVP  155



>gb|EYU38005.1| hypothetical protein MIMGU_mgv1a004001mg [Erythranthe guttata]
Length=550

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWN+TY  I PLGVPQQGILINGQFPGP+I  VTNDN+ INVFN+L +PFLLS
Sbjct  23   EDPYRFFTWNITYGDISPLGVPQQGILINGQFPGPDIYSVTNDNIIINVFNNLPEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ R+NSFEDGV+GTTCPI PG NFTY +Q+KDQIGSFYYFPSLAFHKAAGGFGG R
Sbjct  83   WNGIQQRKNSFEDGVFGTTCPIPPGKNFTYKMQMKDQIGSFYYFPSLAFHKAAGGFGGFR  142

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  143  ILSRPGIPVP  152



>ref|XP_010266952.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=546

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSL +PFL+S
Sbjct  28   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLPEPFLIS  87

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+  RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  88   WNGVLQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLAFHKAAGGFGGIR  147

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  148  ILSRPRIPVP  157



>gb|ACN50176.1| pectinesterase [Annona cherimola]
Length=540

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  22   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIFSVTNDNLIINVHNSLPEPFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGI+
Sbjct  82   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIK  141

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  142  ILSRPRIPVP  151



>tpg|DAA62867.1| TPA: hypothetical protein ZEAMMB73_701617 [Zea mays]
Length=217

 Score =   216 bits (550),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFN L++PFLLS
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+Q RRNSFEDGV GTTCPI PG NFTY++Q KDQIG++YYFPSLAFHKAAGGFGGIR
Sbjct  90   WSGLQQRRNSFEDGVAGTTCPIPPGSNFTYIMQAKDQIGTYYYFPSLAFHKAAGGFGGIR  149

Query  534  ILSR  545
            +LSR
Sbjct  150  VLSR  153



>ref|XP_006342555.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=544

 Score =   226 bits (575),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY TI+PLG+PQ+GILINGQFPGP+I  VTNDN+ INVFN+LD+ FL+S
Sbjct  22   ESPYRFFEWNVTYGTIWPLGLPQKGILINGQFPGPDIHSVTNDNVIINVFNNLDEDFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQNRRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPS AFHKA+GGFGG R
Sbjct  82   WNGIQNRRNSFEDGVWGTTCPIPPGKNFTYILQVKDQIGSFYYFPSTAFHKASGGFGGFR  141

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  142  ILSRPGIPVP  151



>gb|KJB59710.1| hypothetical protein B456_009G268100 [Gossypium raimondii]
Length=491

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+++WNVTY  IYPLGV Q G+LINGQFPGP+I  VTNDNL INV+N+L++ FLLS
Sbjct  23   EDPYRFYSWNVTYGDIYPLGVRQTGLLINGQFPGPDIHSVTNDNLIINVYNNLNESFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGV+GTTCPI PG NFTYMLQVKDQIG+FYY+PSL FHKAAGGFGGIR
Sbjct  83   WNGVQQRRNSYEDGVFGTTCPIPPGKNFTYMLQVKDQIGTFYYYPSLGFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>emb|CDP07321.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   225 bits (574),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY +F WNVTY TIYPLGVPQQGILINGQFPGP+I  VTN+NL INVFNSL +PFLLS
Sbjct  25   EDPYLFFNWNVTYGTIYPLGVPQQGILINGQFPGPDIHSVTNNNLVINVFNSLTEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQNRRNS+ DGVYGTTCPI PG N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGG R
Sbjct  85   WSGIQNRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGFR  144

Query  534  ILSRPRILSP  563
            ILSR  I  P
Sbjct  145  ILSRSVIPVP  154



>ref|XP_010063104.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW70294.1| hypothetical protein EUGRSUZ_F03538 [Eucalyptus grandis]
Length=540

 Score =   225 bits (574),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLD PFL+S
Sbjct  22   ENPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDVPFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQ RRNS+EDGVYGTTCPI PG NFTY+ QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  82   WSGIQQRRNSYEDGVYGTTCPIPPGRNFTYIFQVKDQIGSFFYFPSLKFHKAAGGFGGIR  141

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  142  ILSRPLIPVP  151



>ref|XP_007131584.1| hypothetical protein PHAVU_011G025400g [Phaseolus vulgaris]
 gb|ESW03578.1| hypothetical protein PHAVU_011G025400g [Phaseolus vulgaris]
Length=545

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W VTY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  30   EDPYRFFDWTVTYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVRNNLTEPFLLS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  90   WNGVQQRRNSYQDGVYGTTCPIPPGQNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGAIK  149

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  150  ILSRPRIPVP  159



>ref|XP_010676489.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=549

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++TWNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL ++VFNSLD+PFLLS
Sbjct  25   ESPYRFYTWNVTYGDIYPLGVKQQGILINGQFPGPPIEAVTNDNLIVSVFNSLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYYYFPSLAFHKAAGGYGGIR  144

Query  534  ILSRPRILSP  563
            I SRP I  P
Sbjct  145  IDSRPLIPVP  154



>ref|XP_010103298.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB95365.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=632

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV Q+GILINGQFPGPEI  VTNDNL INVFNSL +PFL+S
Sbjct  205  EDPYRFFNWNITYGDIYPLGVRQRGILINGQFPGPEIYSVTNDNLIINVFNSLPEPFLIS  264

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNR+NS++DGVYGTTCPI PG NFTY LQ+KDQIGSF+Y+PSLAFHKAAGGFGGIR
Sbjct  265  WNGVQNRKNSYQDGVYGTTCPIPPGKNFTYKLQMKDQIGSFFYYPSLAFHKAAGGFGGIR  324

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  325  ILSRPRIPVP  334


 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 107/130 (82%), Gaps = 5/130 (4%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+  WNVTY  IYPLGV Q+GILINGQFPGP I  VTNDNL +NV N+L +PFL+S
Sbjct  28   EDPYRFMEWNVTYGNIYPLGVRQRGILINGQFPGPGIYAVTNDNLIVNVHNNLPEPFLIS  87

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+QNR+NSFEDGVYGTTCPI PG NFTY LQ KDQIGSFYYFPSL FHKAAGGF    
Sbjct  88   WSGLQNRKNSFEDGVYGTTCPIPPGKNFTYRLQAKDQIGSFYYFPSLGFHKAAGGF----  143

Query  534  ILSRPRILSP  563
             LSRP+I  P
Sbjct  144  -LSRPQIPVP  152



>gb|EYU36818.1| hypothetical protein MIMGU_mgv1a004264mg [Erythranthe guttata]
Length=536

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY TIYPLG+ QQGILINGQFPGPEI  VTNDN+ +NVFNSLDQPFL+ 
Sbjct  18   EDPYRFFNWNITYGTIYPLGIAQQGILINGQFPGPEIYSVTNDNIIVNVFNSLDQPFLIH  77

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQNRRNS+EDGVYGTTCPI  G NFTY+LQ+KDQIGSF+YFPSL FHKAAG FG I+
Sbjct  78   WNGIQNRRNSYEDGVYGTTCPIPAGGNFTYILQMKDQIGSFFYFPSLGFHKAAGAFGAIK  137

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  138  ILSRPLIPVP  147



>gb|KJB59711.1| hypothetical protein B456_009G268100 [Gossypium raimondii]
Length=541

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+++WNVTY  IYPLGV Q G+LINGQFPGP+I  VTNDNL INV+N+L++ FLLS
Sbjct  23   EDPYRFYSWNVTYGDIYPLGVRQTGLLINGQFPGPDIHSVTNDNLIINVYNNLNESFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGV+GTTCPI PG NFTYMLQVKDQIG+FYY+PSL FHKAAGGFGGIR
Sbjct  83   WNGVQQRRNSYEDGVFGTTCPIPPGKNFTYMLQVKDQIGTFYYYPSLGFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>emb|CDY64276.1| BnaCnng43630D [Brassica napus]
Length=614

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W VTY+ IYPLG+PQ+GILINGQFPGPEI  VTNDNL INV N LD+PFLLS
Sbjct  87   EDPYRFFDWRVTYSNIYPLGIPQRGILINGQFPGPEIYSVTNDNLIINVHNDLDEPFLLS  146

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLAFHKAAG FGG+R
Sbjct  147  WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAFHKAAGAFGGLR  206

Query  534  ILSRPRILSP  563
            +LSRPRI  P
Sbjct  207  VLSRPRIPVP  216



>ref|XP_004290036.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLG+ Q+GILINGQFPGPEI  VTNDNL INV NSL +PFL++
Sbjct  23   EDPYRFFEWNVTYGDIYPLGIKQRGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIT  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSFYYFPSLAFHKAAGGFG I+
Sbjct  83   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIK  142

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  143  ILSRPRIPVP  152



>gb|KHN05478.1| L-ascorbate oxidase like [Glycine soja]
Length=544

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  29   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLTEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  89   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGAIK  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>ref|XP_006592035.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=544

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  29   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLTEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  89   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGAIK  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>gb|KCW55614.1| hypothetical protein EUGRSUZ_I01478 [Eucalyptus grandis]
Length=449

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFLL+
Sbjct  27   EDPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLLT  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGV GTTCPI PG NFTY+LQVKDQIGSF+Y PSLAFHKAAGGFGGIR
Sbjct  87   WNGVQQRRNSYEDGVQGTTCPIPPGKNFTYILQVKDQIGSFFYSPSLAFHKAAGGFGGIR  146

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  147  ILSRPLIPVP  156



>ref|XP_003527501.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN41233.1| L-ascorbate oxidase like [Glycine soja]
Length=537

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INV+NSLD+PFLLS
Sbjct  23   EDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVTNDNLIINVYNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+  RRNS++DGVYGT CPILPGHNFTY+LQVKDQIGS++Y+PSLAFHKAAGG+GG +
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPILPGHNFTYVLQVKDQIGSYFYYPSLAFHKAAGGYGGFK  142

Query  534  ILSRPRILSP  563
            I SRP I  P
Sbjct  143  IASRPGIPVP  152



>gb|KEH30611.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  26   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLPEPFLLS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  86   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGSIK  145

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  146  ILSRPRIPVP  155



>ref|XP_006364519.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=541

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W +TY  IYPLG+ QQGILINGQFPGP+I  VTNDNL INV N L  PFLL+
Sbjct  29   EDPYRYFDWRITYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVHNDLHDPFLLT  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  89   WNGLQQRKNSFEDGVYGTTCPIPPGQNFTYIMQVKDQIGSFFYFPSLQFHKAAGGFGGIR  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>ref|XP_002528421.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF33963.1| multicopper oxidase, putative [Ricinus communis]
Length=544

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTN+NL INV NSL +PFL+S
Sbjct  26   EDPYRFFDWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVHNSLPEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  86   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  146  ILSRPLIPVP  155



>ref|XP_009107631.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=542

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  145  ILSRPGIPVP  154



>emb|CDY67479.1| BnaCnng55180D [Brassica napus]
Length=541

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  24   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  144  ILSRPGIPVP  153



>emb|CDY35790.1| BnaA08g04510D [Brassica napus]
Length=542

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  145  ILSRPGIPVP  154



>ref|XP_003563038.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=543

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  I+PLGV QQGILINGQFPGP+I+ VTNDNL +NV+N+L++PFLLS
Sbjct  25   EDPYRFFTWNVTYGDIFPLGVKQQGILINGQFPGPQIDAVTNDNLVVNVYNNLNEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNSFEDGV GTTCPI PG NFTY+LQVKDQIG+++YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQQRRNSFEDGVAGTTCPIPPGRNFTYILQVKDQIGTYFYFPSLAFHKAAGGFGGIR  144

Query  534  ILSR  545
            +LSR
Sbjct  145  VLSR  148



>gb|AAF99833.1|AC008046_5 Putative pectinesterase [Arabidopsis thaliana]
Length=541

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  24   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  144  ILSRPGIPVP  153



>ref|NP_564479.1| SKU5 similar 6 [Arabidopsis thaliana]
 gb|AEE31910.1| SKU5 similar 6 [Arabidopsis thaliana]
Length=542

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  145  ILSRPGIPVP  154



>ref|XP_009596487.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=544

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLG+ QQGILINGQFPGP IECVTNDNL INVFN+LD+PFL+S
Sbjct  27   EDPYRFYTWNVTYGDIYPLGLKQQGILINGQFPGPPIECVTNDNLIINVFNNLDEPFLIS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG++ RRNS++DGVYGT CPI PG+NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFG I 
Sbjct  87   WNGVEQRRNSWQDGVYGTNCPIPPGNNFTYVLQVKDQIGSFYYFPSLAFHKAAGGFGSIN  146

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  147  IASRSVIPVP  156



>gb|AAL24296.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91125.1| unknown protein [Arabidopsis thaliana]
Length=542

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  145  ILSRPGIPVP  154



>ref|XP_009101945.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=549

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W VTY  IYPLG+PQ+GILINGQFPGPEI  VTNDNL INV N LD+PFLLS
Sbjct  24   EDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNDNLIINVHNDLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLAFHKAAG FGG+R
Sbjct  84   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAFHKAAGAFGGLR  143

Query  534  ILSRPRILSP  563
            +LSRPRI  P
Sbjct  144  VLSRPRIPVP  153



>ref|XP_007046384.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
 gb|EOY02216.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
Length=447

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            ED YR+FTWNVTY  IYPLGV QQGILINGQFPGP+IE VTN+NL INVFNSLDQPFL+S
Sbjct  25   EDAYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLIINVFNSLDQPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY LQVKDQIGS++YFPSLA HKAAGG+GG R
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGSYFYFPSLALHKAAGGYGGFR  144

Query  534  ILSRPRILSP  563
            ILSR  I  P
Sbjct  145  ILSRSVIPVP  154



>gb|KDP47151.1| hypothetical protein JCGZ_00042 [Jatropha curcas]
Length=540

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTN+NL INV NSL +PFL+S
Sbjct  22   EDPYRFFDWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVHNSLPEPFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  82   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGGIR  141

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  142  ILSRPLIPVP  151



>emb|CDY54804.1| BnaA06g40970D [Brassica napus]
Length=639

 Score =   224 bits (572),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W VTY  IYPLG+PQ+GILINGQFPGPEI  VTNDNL INV N LD+PFLLS
Sbjct  114  EDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNDNLIINVHNDLDEPFLLS  173

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLAFHKAAG FGG+R
Sbjct  174  WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAFHKAAGAFGGLR  233

Query  534  ILSRPRILSP  563
            +LSRPRI  P
Sbjct  234  VLSRPRIPVP  243



>ref|XP_002888337.1| hypothetical protein ARALYDRAFT_475543 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64596.1| hypothetical protein ARALYDRAFT_475543 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   223 bits (567),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILING+FPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  26   ESPYRFFDWNVTYGDIYPLGVRQQGILINGKFPGPDIHSVTNDNLIINVHNSLDEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  86   WNGIQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  146  ILSRPGIPVP  155



>ref|XP_006307199.1| hypothetical protein CARUB_v10008790mg [Capsella rubella]
 gb|EOA40097.1| hypothetical protein CARUB_v10008790mg [Capsella rubella]
Length=541

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  24   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLVINVHNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNSF DG+ GTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVQNRRNSFVDGMSGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  144  ILSRPGIPVP  153



>ref|XP_009758923.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=549

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL INV N L +PFLL+
Sbjct  32   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIISVTNDNLIINVHNDLPEPFLLT  91

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  92   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFGGIR  151

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  152  ILSRPRIPVP  161



>ref|XP_009630902.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Nicotiana 
tomentosiformis]
Length=543

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL INV N L  PFLL+
Sbjct  25   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPFLLT  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  85   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  145  ILSRPRIPVP  154



>ref|XP_010459724.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
Length=548

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W++TY  IYP+GV QQGILIN  FPGPEI CVTNDNL INVFN LD+PFL+S
Sbjct  35   EDPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIINVFNHLDEPFLIS  94

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W GIQNR+NSF+DGVYGTTCPI PG NFTY LQVKDQIGSFYYFPSL FHKAAGGFG IR
Sbjct  95   WAGIQNRKNSFQDGVYGTTCPIPPGKNFTYALQVKDQIGSFYYFPSLGFHKAAGGFGAIR  154

Query  534  ILSR  545
            I SR
Sbjct  155  ISSR  158



>ref|XP_006657750.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=551

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/124 (82%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  I PLGV QQGILINGQFPGP+IE VTNDNL INVFN+L +PFLLS
Sbjct  31   DDPYRFFTWTVTYGDIAPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNNLTEPFLLS  90

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIG+++YFPSLAFHKAAGGFGGIR
Sbjct  91   WNGIQQRRNSFEDGVAGTTCPIPPGGNFTYILQVKDQIGTYFYFPSLAFHKAAGGFGGIR  150

Query  534  ILSR  545
            +LSR
Sbjct  151  VLSR  154



>ref|XP_009794442.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=541

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWN+TY  +YPLGV QQGILINGQFPGP IECVTNDNL INVFN+LD+PFL+S
Sbjct  24   EDPYRFYTWNITYGDVYPLGVKQQGILINGQFPGPTIECVTNDNLIINVFNNLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG++ RRNS++DGVYGT CPI PG+NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFG I 
Sbjct  84   WNGVEQRRNSWQDGVYGTNCPIPPGNNFTYVLQVKDQIGSFYYFPSLAFHKAAGGFGSIN  143

Query  534  ILSRPRILSP  563
            I S   I  P
Sbjct  144  IASSSVIPVP  153



>ref|XP_010459725.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=537

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W++TY  IYP+GV QQGILIN  FPGPEI CVTNDNL INVFN LD+PFL+S
Sbjct  24   EDPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIINVFNHLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W GIQNR+NSF+DGVYGTTCPI PG NFTY LQVKDQIGSFYYFPSL FHKAAGGFG IR
Sbjct  84   WAGIQNRKNSFQDGVYGTTCPIPPGKNFTYALQVKDQIGSFYYFPSLGFHKAAGGFGAIR  143

Query  534  ILSR  545
            I SR
Sbjct  144  ISSR  147



>ref|XP_004243477.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=537

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLGV QQGILINGQFPGP I+CVTNDNL INVFN+LD+PFL+S
Sbjct  27   EDPYRFYAWNVTYGDIYPLGVKQQGILINGQFPGPPIQCVTNDNLIINVFNNLDEPFLIS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG++ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSFYYFPSLAFHKAAGGFG I 
Sbjct  87   WNGVEQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFYYFPSLAFHKAAGGFGSIN  146

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  147  IASRSVIPVP  156



>ref|XP_009418785.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTWNVTY  I+P+GV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  25   DDPYRFFTWNVTYGDIWPMGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY++QVKDQIGS++YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGGNFTYVMQVKDQIGSYFYFPSLAFHKAAGGFGGIR  144

Query  534  ILSR  545
            +LSR
Sbjct  145  VLSR  148



>ref|XP_009630899.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=547

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL INV N L  PFLL+
Sbjct  29   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPFLLT  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  89   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFGGIR  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>ref|XP_008789824.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Phoenix dactylifera]
Length=427

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  31   DDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  90

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPI P  NFTY+LQVKDQIGS++YFPSLAFHKAAGGFGG R
Sbjct  91   WNGIQQRRNSWQDGVYGTNCPIPPRRNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFGGFR  150

Query  534  ILSR  545
            ILSR
Sbjct  151  ILSR  154



>ref|XP_009630901.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=546

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL IN+ N L +PFLL+
Sbjct  29   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIISVTNDNLIINIHNDLPEPFLLT  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  89   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFGGIR  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>ref|XP_010089487.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB37880.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=300

 Score =   214 bits (546),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++ WNVTY  IYPLGV Q+GILINGQFPGP+IE VTNDNL I+VFNSLD+PFL+S
Sbjct  23   ESPYRFYDWNVTYGDIYPLGVKQRGILINGQFPGPQIESVTNDNLIISVFNSLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++Y PSLAFHKAAGGFGGI+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYSPSLAFHKAAGGFGGIK  142

Query  534  ILSR  545
            ILSR
Sbjct  143  ILSR  146



>ref|XP_006411628.1| hypothetical protein EUTSA_v10024832mg [Eutrema salsugineum]
 gb|ESQ53081.1| hypothetical protein EUTSA_v10024832mg [Eutrema salsugineum]
Length=551

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W VTY  IYPLG+PQ+GILINGQFPGPEI  VTN+NL INV N LD+PFLLS
Sbjct  24   EDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNNNLIINVHNDLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLA HKAAGGFGG R
Sbjct  84   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLALHKAAGGFGGHR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>ref|XP_010028797.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW55613.1| hypothetical protein EUGRSUZ_I01478 [Eucalyptus grandis]
Length=545

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFLL+
Sbjct  27   EDPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLLT  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGV GTTCPI PG NFTY+LQVKDQIGSF+Y PSLAFHKAAGGFGGIR
Sbjct  87   WNGVQQRRNSYEDGVQGTTCPIPPGKNFTYILQVKDQIGSFFYSPSLAFHKAAGGFGGIR  146

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  147  ILSRPLIPVP  156



>ref|XP_009418784.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=566

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTWNVTY  I+P+GV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  25   DDPYRFFTWNVTYGDIWPMGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY++QVKDQIGS++YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGGNFTYVMQVKDQIGSYFYFPSLAFHKAAGGFGGIR  144

Query  534  ILSR  545
            +LSR
Sbjct  145  VLSR  148



>gb|AGJ03718.1| multicopper oxidase [Citrus maxima]
Length=538

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL I+VFN+LD+PFL+S
Sbjct  23   ESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPGPSIEAVTNDNLIISVFNALDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGG+GGI+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPISPGKNFTYVLQVKDQIGSYFYFPSLAFHKAAGGYGGIK  142

Query  534  ILSRPRILSP  563
            I SRP I  P
Sbjct  143  IASRPLIPVP  152



>ref|XP_009758924.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=548

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL INV N L  PFLL+
Sbjct  30   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPFLLT  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  90   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFGGIR  149

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  150  ILSRPRIPVP  159



>ref|XP_003537754.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W +TY  IYPLGV QQ ILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  32   EDPYRFFDWTITYGDIYPLGVKQQVILINGQFPGPEIYSVTNDNLIINVHNNLTEPFLLS  91

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQIGSF+YFPSLAFHKAAGGFG I+
Sbjct  92   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGAIK  151

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  152  ILSRPRIPVP  161



>ref|XP_007046383.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
 gb|EOY02215.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
Length=540

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            ED YR+FTWNVTY  IYPLGV QQGILINGQFPGP+IE VTN+NL INVFNSLDQPFL+S
Sbjct  25   EDAYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLIINVFNSLDQPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY LQVKDQIGS++YFPSLA HKAAGG+GG R
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGSYFYFPSLALHKAAGGYGGFR  144

Query  534  ILSRPRILSP  563
            ILSR  I  P
Sbjct  145  ILSRSVIPVP  154



>ref|XP_006447580.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 ref|XP_006469673.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Citrus sinensis]
 gb|ESR60820.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 gb|KDO54689.1| hypothetical protein CISIN_1g009283mg [Citrus sinensis]
Length=538

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL I+VFN+LD+PFL+S
Sbjct  23   ESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPGPSIEAVTNDNLIISVFNALDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGG+GGI+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLAFHKAAGGYGGIK  142

Query  534  ILSRPRILSP  563
            I SRP I  P
Sbjct  143  IASRPLIPVP  152



>gb|KFK44289.1| hypothetical protein AALP_AA1G238900 [Arabis alpina]
Length=176

 Score =   209 bits (533),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY++F W+VTY  I PLGV QQGILING+FPGP+I  VTNDNL INVFN LD+PFL+S
Sbjct  23   EDPYKFFEWHVTYGNISPLGVQQQGILINGKFPGPDIYSVTNDNLIINVFNHLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQN RNS++DGVYGTTCPI PG N+TY LQVKDQIGSFYYFPSL FHKAAGGFGGIR
Sbjct  83   WSGIQNWRNSYQDGVYGTTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGFGGIR  142

Query  534  ILSRPRILSP  563
            I +R  I  P
Sbjct  143  ISNRALIPVP  152



>ref|XP_002269614.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI28811.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL ++V+NSLD+PFLLS
Sbjct  23   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPPIESVTNDNLIVSVYNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGG+GGI+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLAFHKAAGGYGGIK  142

Query  534  ILSR  545
            I SR
Sbjct  143  ISSR  146



>ref|XP_003596958.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|ABN08527.1| Multicopper oxidase, type 1 [Medicago truncatula]
 gb|AES67209.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=539

 Score =   220 bits (561),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQGILINGQFPGP+IE VTNDNL ++VFNSLDQPFL+S
Sbjct  26   EDPYRFYTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIVSVFNSLDQPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLA HKAAGG+GGI+
Sbjct  86   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLALHKAAGGYGGIK  145

Query  534  ILSR  545
            I SR
Sbjct  146  INSR  149



>ref|XP_010046372.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW88773.1| hypothetical protein EUGRSUZ_A01118 [Eucalyptus grandis]
Length=542

 Score =   220 bits (561),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY ++ WNVTY  IYPLGV QQGILINGQFPGP+IE VTNDNL INVFN+LD+PFLLS
Sbjct  27   EDPYSFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNALDEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q +RNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGGFGG +
Sbjct  87   WNGVQQKRNSWQDGVYGTNCPIPPGQNFTYILQVKDQIGSYFYFPSLAFHKAAGGFGGFK  146

Query  534  ILSRPRILSP  563
            ILSR  I  P
Sbjct  147  ILSRSVIPVP  156



>ref|XP_003539859.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=537

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INV+NSLD+PFLLS
Sbjct  23   EDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVTNDNLIINVYNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+  RRNS++DGVYGT CPILPGHNFTY+LQVKDQIGS++Y+PSLAFHKAAGG+GG +
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPILPGHNFTYVLQVKDQIGSYFYYPSLAFHKAAGGYGGFK  142

Query  534  ILSR  545
            I SR
Sbjct  143  IESR  146



>ref|XP_007213899.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
 gb|EMJ15098.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
Length=447

 Score =   218 bits (554),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTW +TY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+VFN L +PFL+S
Sbjct  24   EDPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLREPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQ RRNS++DGVYGT CPILPG NFTY +QVKDQIGSF+YFPS  FHKAAGGFGGIR
Sbjct  84   WDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGSFFYFPSFLFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            I SRP+I  P
Sbjct  144  IWSRPKIPVP  153



>gb|KFK44156.1| hypothetical protein AALP_AA1G222300 [Arabis alpina]
Length=538

 Score =   220 bits (560),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR F W+VTY  IYP+GV QQGILIN QFPGPEI  VTNDNL INVFN LD+PFL+S
Sbjct  24   EDPYRNFEWHVTYGDIYPMGVKQQGILINNQFPGPEIRSVTNDNLIINVFNELDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W GIQNR+NSF+DGVYGTTCPI PG N+TY LQVKDQIGSFYYFPSL FHKAAGGFG IR
Sbjct  84   WAGIQNRKNSFQDGVYGTTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGFGAIR  143

Query  534  ILSR  545
            ILSR
Sbjct  144  ILSR  147



>gb|KHN21220.1| L-ascorbate oxidase like [Glycine soja]
Length=537

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INV+NSLD+PFLLS
Sbjct  23   EDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVTNDNLIINVYNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+  RRNS++DGVYGT CPILPGHNFTY+LQVKDQIGS++Y+PSLAFHKAAGG+GG +
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPILPGHNFTYVLQVKDQIGSYFYYPSLAFHKAAGGYGGFK  142

Query  534  ILSR  545
            I SR
Sbjct  143  IESR  146



>ref|XP_004232701.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=548

 Score =   220 bits (560),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            ++PYRY+TW +TY  IYPLGV QQGILINGQFPGP+I+CVTNDNL I+V+N L +PFL+S
Sbjct  30   DNPYRYYTWKITYGDIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVYNYLSEPFLIS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGTTCPILPG NFTY LQ KDQIGS++YFPSLA HKAAGG+G IR
Sbjct  90   WNGIQQRRNSWQDGVYGTTCPILPGKNFTYTLQAKDQIGSYFYFPSLAMHKAAGGYGAIR  149

Query  534  ILSRPRILSP  563
            + SRPRI  P
Sbjct  150  VYSRPRIPVP  159



>ref|XP_010500092.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++ WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFYDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNS+ DG+ GTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQNRRNSYVDGMSGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  145  ILSRPGIPVP  154



>ref|XP_007132533.1| hypothetical protein PHAVU_011G102500g [Phaseolus vulgaris]
 gb|ESW04527.1| hypothetical protein PHAVU_011G102500g [Phaseolus vulgaris]
Length=538

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFNSLD+PFLLS
Sbjct  24   EDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVTNDNLIINVFNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+  RRNS++DGVYGT CPI PGHNFTY+LQVKDQIGS++Y+PSLAFHKAAGG+GG +
Sbjct  84   WNGVLQRRNSWQDGVYGTNCPISPGHNFTYVLQVKDQIGSYFYYPSLAFHKAAGGYGGFK  143

Query  534  ILSR  545
            I SR
Sbjct  144  IASR  147



>ref|XP_009413373.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
 ref|XP_009413374.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=543

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            + PYR+FTWNVTY  IYPLGV QQGILINGQFPGP+IE VTNDNL +NVFNSL +PFL S
Sbjct  24   DSPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIEAVTNDNLIVNVFNSLPEPFLFS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RR+S++DGVYGT CPI PG NFTY +QVKDQIGS++YFPSLAFHKAAGG+GGIR
Sbjct  84   WNGIQQRRSSWQDGVYGTNCPIPPGGNFTYTMQVKDQIGSYFYFPSLAFHKAAGGYGGIR  143

Query  534  ILSRPRILSP  563
            +LSRP I  P
Sbjct  144  VLSRPLIPVP  153



>gb|EMT15848.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=545

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNV+Y  IYPLG  QQGILINGQFPGP+IE VTNDNL +NVFN L++PFLLS
Sbjct  27   EDPYRFFTWNVSYGDIYPLGGKQQGILINGQFPGPQIEAVTNDNLVVNVFNKLNEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+Q RRNSFEDGV GTTCPI PG NFTY+LQ KDQIG+++YFPSLAFHKAAGGFGGIR
Sbjct  87   WSGLQQRRNSFEDGVAGTTCPIPPGANFTYILQAKDQIGTYFYFPSLAFHKAAGGFGGIR  146

Query  534  ILSR  545
            +LSR
Sbjct  147  VLSR  150



>ref|XP_010244491.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=543

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP I+ V+NDNL I+V+NSLD+PFL+S
Sbjct  25   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPLIDSVSNDNLIISVYNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSFFYFPSLAFHKAAGGFGGIR  144

Query  534  ILSR  545
            I SR
Sbjct  145  INSR  148



>gb|KFK34651.1| hypothetical protein AALP_AA5G173600 [Arabis alpina]
Length=543

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++ WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INV NSLD+PFL+S
Sbjct  26   ESPYRFYDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNVIINVHNSLDEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQ+KDQIGSFYYFP+LAFHKAAGGFGGIR
Sbjct  86   WNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQMKDQIGSFYYFPTLAFHKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  146  ILSRPGIPVP  155



>ref|XP_010923874.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=542

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTNDNL INV+NSL +PFLLS
Sbjct  24   EDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIESVTNDNLIINVYNSLPEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+  RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVLQRRNSWQDGVYGTNCPIPPGGNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFGGIR  143

Query  534  ILSR  545
            ILSR
Sbjct  144  ILSR  147



>ref|XP_009612547.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=539

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++ +NVTY TI PLGV Q+GILINGQFPGP+I  VTNDN+ INVFN LD+PFL+S
Sbjct  22   ESPYRFYEFNVTYGTISPLGVKQKGILINGQFPGPDIYSVTNDNVIINVFNYLDEPFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQNRRNSFEDGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPS AFHKAAGGFGG R
Sbjct  82   WNGIQNRRNSFEDGVWGTTCPIPPGKNFTYILQVKDQIGSFYYFPSTAFHKAAGGFGGFR  141

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  142  ILSRPGIPVP  151



>ref|XP_009397777.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=541

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTWN+TY  I+P+GV QQGILINGQFPGP+IE VTNDN+ INVFNSL +PFL+S
Sbjct  23   DDPYRFFTWNITYGDIWPMGVKQQGILINGQFPGPQIEAVTNDNVIINVFNSLPEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPI PG NFTY++Q KDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  83   WNGIQQRRNSWQDGVYGTNCPIPPGRNFTYVMQFKDQIGSFFYFPSLAFHKAAGGFGGIR  142

Query  534  ILSR  545
            +LSR
Sbjct  143  VLSR  146



>ref|XP_002460757.1| hypothetical protein SORBIDRAFT_02g034420 [Sorghum bicolor]
 gb|EER97278.1| hypothetical protein SORBIDRAFT_02g034420 [Sorghum bicolor]
Length=548

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFN L++PFLLS
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+Q RRNSFEDGV GTTCPI PG NFTY++Q KDQIG++YYFPSLAFHKAAGGFGGIR
Sbjct  90   WSGLQQRRNSFEDGVAGTTCPIPPGANFTYIMQAKDQIGTYYYFPSLAFHKAAGGFGGIR  149

Query  534  ILSR  545
            +LSR
Sbjct  150  VLSR  153



>ref|XP_008455444.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=543

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTN+NL INVFNSLD+PFL+S
Sbjct  25   EDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLA HKAAGGFGG +
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLALHKAAGGFGGFK  144

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  145  IQSRSIIPIP  154



>ref|XP_010461374.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
 ref|XP_010461375.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=542

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++ WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFYDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+QNRRNS+ DG+ GTTCPI P  N+TY+LQVKDQIGSFYYFPSLAFHKAAGGFGGIR
Sbjct  85   WNGVQNRRNSYVDGMSGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIR  144

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  145  ILSRPGIPVP  154



>ref|XP_010480557.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=537

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYRYF W++TY  IYP+GV QQGILIN  FPGPEI CVTNDNL INVFN LD+PFL+S
Sbjct  24   ENPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIINVFNHLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W GIQNR+NSF+DGVYGTTCPI PG N+TY LQVKDQIGSFYYFPSL FHKAAGGFG IR
Sbjct  84   WAGIQNRKNSFQDGVYGTTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGFGAIR  143

Query  534  ILSR  545
            I SR
Sbjct  144  ISSR  147



>ref|XP_006422489.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
 gb|ESR35729.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
Length=545

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  27   ESPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLIS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGS++YFPS+ F KAAGGFGGIR
Sbjct  87   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSYFYFPSVGFQKAAGGFGGIR  146

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  147  ILSRPLIPVP  156



>ref|XP_006486657.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|KDO68240.1| hypothetical protein CISIN_1g009054mg [Citrus sinensis]
Length=545

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  27   ESPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLIS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQIGS++YFPS+ F KAAGGFGGIR
Sbjct  87   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSYFYFPSVGFQKAAGGFGGIR  146

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  147  ILSRPLIPVP  156



>ref|XP_008229964.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=542

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLG+ Q+GILINGQFPGP+IE VTNDNL INVFNSLD+PFLLS
Sbjct  24   EDPYRFYNWNVTYGDIYPLGLKQRGILINGQFPGPQIESVTNDNLIINVFNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQIGS++YFPSL FHKAAGGFGGI+
Sbjct  84   WNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLGFHKAAGGFGGIK  143

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  144  IASRSVIPVP  153



>ref|XP_010103300.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB95367.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=548

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W +TY  IYPLGV Q+GILINGQFPGP+I  VTNDN+ INV N+L +PFLLS
Sbjct  27   EDPYRFFDWKITYGDIYPLGVRQRGILINGQFPGPDIFSVTNDNIIINVQNNLPEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+QNR+NSFEDGVYGTTCPI PG NFTY LQ+KDQIG+F+YFPSLAFHKAAGGFGGI+
Sbjct  87   WSGVQNRKNSFEDGVYGTTCPIPPGKNFTYKLQMKDQIGTFFYFPSLAFHKAAGGFGGIK  146

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  147  ILSRPRIPVP  156



>gb|ACL53812.1| unknown [Zea mays]
 tpg|DAA62866.1| TPA: L-ascorbate oxidase [Zea mays]
Length=550

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFN L++PFLLS
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+Q RRNSFEDGV GTTCPI PG NFTY++Q KDQIG++YYFPSLAFHKAAGGFGGIR
Sbjct  90   WSGLQQRRNSFEDGVAGTTCPIPPGSNFTYIMQAKDQIGTYYYFPSLAFHKAAGGFGGIR  149

Query  534  ILSR  545
            +LSR
Sbjct  150  VLSR  153



>dbj|BAK04971.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNV+Y  IYPLGV QQGILINGQFPGP+I+ VTNDNL +NVFN L++PFLLS
Sbjct  33   EDPYRFFTWNVSYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVVNVFNKLNEPFLLS  92

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+Q RRNSFEDGV GTTCPI  G NFTY+LQVKDQIG+++YFPSLAFHKAAGGFG IR
Sbjct  93   WSGVQQRRNSFEDGVAGTTCPIPAGANFTYILQVKDQIGTYFYFPSLAFHKAAGGFGAIR  152

Query  534  ILSR  545
            +LSR
Sbjct  153  VLSR  156



>emb|CDP19581.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL INVFN+LD+PFL+S
Sbjct  26   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPAIESVTNDNLIINVFNNLDEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG++ RRNS++DGV+GT CPI PG N+TY LQVKDQIGS++YFPSLAFHKAAGG+GGI+
Sbjct  86   WNGLEQRRNSWQDGVWGTNCPIPPGKNYTYALQVKDQIGSYFYFPSLAFHKAAGGYGGIK  145

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  146  IASRSVIPVP  155



>ref|NP_001152000.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG45329.1| L-ascorbate oxidase precursor [Zea mays]
Length=550

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFN L++PFLLS
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+Q RRNSFEDGV GTTCPI PG NFTY++Q KDQIG++YYFPSLAFHKAAGGFGGIR
Sbjct  90   WSGLQQRRNSFEDGVAGTTCPIPPGSNFTYIMQAKDQIGTYYYFPSLAFHKAAGGFGGIR  149

Query  534  ILSR  545
            +LSR
Sbjct  150  VLSR  153



>ref|XP_008806480.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=542

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+ TWNVTY  I+PLGV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  24   EDPYRFLTWNVTYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+  RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGGFGG R
Sbjct  84   WNGVLQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFGGFR  143

Query  534  ILSR  545
            ILSR
Sbjct  144  ILSR  147



>ref|XP_006348131.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=548

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +3

Query  177  DPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLSW  356
            +PYRY+TW +TY  IYPLGV QQGILINGQFPGP+I+CVTNDNL I+V+N L +PFL+SW
Sbjct  31   NPYRYYTWKITYGNIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVYNYLSEPFLISW  90

Query  357  NGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  536
            NGIQ RRNS++DGVYG+TCPILPG NFTY LQ KDQIGS++YFPSLA HKAAGG+G IR+
Sbjct  91   NGIQQRRNSWQDGVYGSTCPILPGKNFTYTLQAKDQIGSYFYFPSLAMHKAAGGYGAIRV  150

Query  537  LSRPRILSP  563
             SRPRI  P
Sbjct  151  YSRPRIPVP  159



>ref|XP_003540295.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=536

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLG+ QQGILINGQFPGP+IE VTNDNL ++VFNSLD+PFL+S
Sbjct  23   EDPYRFYTWNVTYGDIYPLGMKQQGILINGQFPGPQIESVTNDNLILHVFNSLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGG+GG +
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLAFHKAAGGYGGFK  142

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  143  IASRSVIPVP  152



>ref|XP_008789823.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Phoenix dactylifera]
Length=549

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  31   DDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  90

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPI P  NFTY+LQVKDQIGS++YFPSLAFHKAAGGFGG R
Sbjct  91   WNGIQQRRNSWQDGVYGTNCPIPPRRNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFGGFR  150

Query  534  ILSR  545
            ILSR
Sbjct  151  ILSR  154



>gb|KGN43295.1| hypothetical protein Csa_7G018770 [Cucumis sativus]
Length=444

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            + PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDN++INV NSL +PFLLS
Sbjct  29   DSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYINVHNSLPEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NS++DGVYGTTCPI PG NFTY +QVKDQIGS++YFPSLAFHKAAGGFG IR
Sbjct  89   WNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGSYFYFPSLAFHKAAGGFGSIR  148

Query  534  ILSRPRILSP  563
            +LSRP I  P
Sbjct  149  VLSRPLIPVP  158



>ref|XP_007215641.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
 gb|EMJ16840.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
Length=542

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLG+ Q+GILINGQFPGP+IE VTNDNL INVFNSLD+PFLLS
Sbjct  24   EDPYRFYNWNVTYGDIYPLGLKQRGILINGQFPGPQIESVTNDNLIINVFNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQIGS++YFPSL FHKAAGGFGGI+
Sbjct  84   WNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLGFHKAAGGFGGIK  143

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  144  IASRSVIPVP  153



>ref|XP_004957823.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=550

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFN L++PFLLS
Sbjct  32   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  91

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+Q RRNSFEDGV GTTCPI PG NFTY++Q KDQIG++YYFPSLAFHKAAGGFGGIR
Sbjct  92   WSGLQQRRNSFEDGVAGTTCPIPPGGNFTYIMQAKDQIGTYYYFPSLAFHKAAGGFGGIR  151

Query  534  ILSR  545
            +LSR
Sbjct  152  VLSR  155



>gb|KDP20733.1| hypothetical protein JCGZ_21204 [Jatropha curcas]
Length=541

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+FTW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL INVFN L +PFL+S
Sbjct  23   ENPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVFNYLREPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPILPG NFTY+LQVKDQIGSF+YFPSL  HKAAGGFG IR
Sbjct  83   WNGIQQRRNSWQDGVYGTNCPILPGRNFTYILQVKDQIGSFFYFPSLGMHKAAGGFGSIR  142

Query  534  ILSRPRILSP  563
            I SRP I  P
Sbjct  143  IWSRPLIPVP  152



>gb|EMS52588.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=890

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNV+Y  IYPLGV QQGILINGQFPGP+IE VTNDNL +NVFN L++PFLLS
Sbjct  27   EDPYRFFTWNVSYGDIYPLGVKQQGILINGQFPGPQIEAVTNDNLVVNVFNKLNEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQ RRNSFEDGV GTTCPI PG NFTY+LQ KDQIG+++YFPSLAFHKAAGGFGGIR
Sbjct  87   WSGIQQRRNSFEDGVAGTTCPIPPGANFTYILQAKDQIGTYFYFPSLAFHKAAGGFGGIR  146

Query  534  ILSR  545
            +LSR
Sbjct  147  VLSR  150



>ref|XP_007213900.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
 gb|EMJ15099.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
Length=543

 Score =   218 bits (555),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTW +TY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+VFN L +PFL+S
Sbjct  24   EDPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLREPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQ RRNS++DGVYGT CPILPG NFTY +QVKDQIGSF+YFPS  FHKAAGGFGGIR
Sbjct  84   WDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGSFFYFPSFLFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            I SRP+I  P
Sbjct  144  IWSRPKIPVP  153



>ref|XP_010929557.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=541

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTNDN+ INVFNSL +PFLLS
Sbjct  23   DDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNIIINVFNSLPEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPI P  NFTY+LQVKDQIGS++YFPSLAFHKAAGGFGG R
Sbjct  83   WNGIQQRRNSWQDGVYGTNCPIPPRRNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFGGFR  142

Query  534  ILSR  545
            ILSR
Sbjct  143  ILSR  146



>ref|XP_008384084.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=543

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+VFN L +PFL+S
Sbjct  24   EDPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLREPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQ RRNS++DGV+GTTCPI PG NFTY +QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  84   WDGIQQRRNSWQDGVFGTTCPIPPGRNFTYNIQVKDQIGSFFYFPSLQFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            I SRP+I  P
Sbjct  144  IWSRPKIPVP  153



>gb|EEE67250.1| hypothetical protein OsJ_24405 [Oryza sativa Japonica Group]
Length=546

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  I PLGV QQGILINGQFPGP IE VTNDNL INVFN L+ PFL+S
Sbjct  25   DDPYRFFTWTVTYGDITPLGVKQQGILINGQFPGPTIEAVTNDNLIINVFNKLNDPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIG+++YFPSLAFHKAAGGFG IR
Sbjct  85   WNGIQQRRNSFEDGVAGTTCPIPPGGNFTYILQVKDQIGTYFYFPSLAFHKAAGGFGAIR  144

Query  534  ILSR  545
            +LSR
Sbjct  145  VLSR  148



>gb|EEC82126.1| hypothetical protein OsI_26158 [Oryza sativa Indica Group]
Length=546

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  I PLGV QQGILINGQFPGP IE VTNDNL INVFN L+ PFL+S
Sbjct  25   DDPYRFFTWTVTYGDITPLGVKQQGILINGQFPGPTIEAVTNDNLIINVFNKLNDPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIG+++YFPSLAFHKAAGGFG IR
Sbjct  85   WNGIQQRRNSFEDGVAGTTCPIPPGGNFTYILQVKDQIGTYFYFPSLAFHKAAGGFGAIR  144

Query  534  ILSR  545
            +LSR
Sbjct  145  VLSR  148



>ref|XP_009803721.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=558

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++ +NVTY TI PLGV Q+GILINGQFPGP+I  VTNDN+ INVFN LD+PFL+S
Sbjct  41   ESPYRFYEFNVTYGTISPLGVKQKGILINGQFPGPDIYSVTNDNVIINVFNYLDEPFLIS  100

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQNRRNSF+DGV+GTTCPI PG NFTY+LQVKDQIGSFYYFPS AFHKAAGGFGG R
Sbjct  101  WNGIQNRRNSFQDGVWGTTCPIPPGKNFTYVLQVKDQIGSFYYFPSTAFHKAAGGFGGFR  160

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  161  ILSRPGIPVP  170



>gb|KHG04142.1| L-ascorbate oxidase [Gossypium arboreum]
Length=550

 Score =   218 bits (555),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQ ILINGQFPGP+IE VTN+NL INVFNSLDQPFL+S
Sbjct  30   EDPYRFYTWNVTYGDIYPLGVKQQVILINGQFPGPQIETVTNENLIINVFNSLDQPFLIS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY LQVKDQIGS++YFPSLA HKAAGG+GG R
Sbjct  90   WNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGSYFYFPSLALHKAAGGYGGFR  149

Query  534  ILSR  545
            ILSR
Sbjct  150  ILSR  153



>ref|XP_004231076.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=536

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W +TY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N L  PFLL+
Sbjct  26   EDPYRYFDWRITYGDIHPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNHLPHPFLLT  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NSF+DGVYGTTCPI PG NFTY +QVKDQIGSF+YFPSL FHKAAGGFGGIR
Sbjct  86   WNGLQQRKNSFQDGVYGTTCPIPPGKNFTYTMQVKDQIGSFFYFPSLQFHKAAGGFGGIR  145

Query  534  ILSRPRILSP  563
            ILSRP+I  P
Sbjct  146  ILSRPKIPVP  155



>ref|XP_002301616.1| hypothetical protein POPTR_0002s21400g [Populus trichocarpa]
 gb|EEE80889.1| hypothetical protein POPTR_0002s21400g [Populus trichocarpa]
Length=545

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQGILING+FPGP+IE VTNDNL I+VFNSLD+PFLLS
Sbjct  27   EDPYRFYTWNVTYGDIYPLGVKQQGILINGKFPGPQIESVTNDNLIISVFNSLDEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSL  HKAAGGFGG +
Sbjct  87   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLGMHKAAGGFGGFK  146

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  147  IASRSVIPVP  156



>gb|KDP22727.1| hypothetical protein JCGZ_01829 [Jatropha curcas]
Length=541

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+++WNVTY  IYPLGV QQGILINGQFPGP+IE VTN+NL IN+FNSLD+PFLLS
Sbjct  23   EDPYRFYSWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLIINIFNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTYMLQVKDQIGS++YFPSL  HKAAGG GG +
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYMLQVKDQIGSYFYFPSLGMHKAAGGIGGFK  142

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  143  IASRSVIPVP  152



>gb|ABR18324.1| unknown [Picea sitchensis]
Length=542

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY++FTWNVT+ TI+PLG+PQQGILINGQFPGP I+ VTNDN+ +NVFNSLDQPFL+S
Sbjct  24   EDPYKFFTWNVTWGTIWPLGIPQQGILINGQFPGPRIDSVTNDNIIVNVFNSLDQPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQ RRNS++DGV+GT CPI PG NFTY  QVKDQIGS+YYFPS+  HKAAGGFGG+ 
Sbjct  84   WSGIQQRRNSWQDGVFGTNCPIPPGQNFTYKFQVKDQIGSYYYFPSMYMHKAAGGFGGLS  143

Query  534  ILSRPRILSP  563
            ++SRP I  P
Sbjct  144  VVSRPLIPVP  153



>ref|XP_002272880.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI23230.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   218 bits (554),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+V+N L +PFL+S
Sbjct  22   EDPYRFYTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLREPFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+G+Q RRNS++DG+YGT CPI PG N TY LQVKDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  82   WSGLQQRRNSWQDGMYGTNCPIPPGRNMTYALQVKDQIGSFFYFPSLAFHKAAGGFGGIR  141

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  142  ILSRPRIPVP  151



>ref|XP_010498473.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=538

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W++TY  IYP+GV QQGILIN  FPGPEI CVTNDNL INVFN LD+PFL+S
Sbjct  25   EDPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIINVFNHLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W GIQNR+NSF+DGVYGTTCPI PG N+TY LQVKDQIGSFYYF SL FHKAAGGFG IR
Sbjct  85   WAGIQNRKNSFQDGVYGTTCPIPPGKNYTYALQVKDQIGSFYYFRSLGFHKAAGGFGAIR  144

Query  534  ILSR  545
            I SR
Sbjct  145  ISSR  148



>ref|XP_006855939.1| hypothetical protein AMTR_s00037p00216460 [Amborella trichopoda]
 gb|ERN17406.1| hypothetical protein AMTR_s00037p00216460 [Amborella trichopoda]
Length=545

 Score =   217 bits (553),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VT+  IYPLGV QQGILINGQFPGP+IE VTNDNL INVFN+L +PFLLS
Sbjct  27   DDPYRFFTWQVTWGDIYPLGVKQQGILINGQFPGPQIEAVTNDNLVINVFNNLTEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPI PG NFTY LQ KDQIGS++YFPSLAFHKAAGGFGGIR
Sbjct  87   WNGIQQRRNSWQDGVYGTNCPIPPGGNFTYNLQAKDQIGSYFYFPSLAFHKAAGGFGGIR  146

Query  534  ILSR  545
            +LSR
Sbjct  147  VLSR  150



>ref|XP_008362259.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=542

 Score =   217 bits (553),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL INVFNSLD+PFL+S
Sbjct  24   EDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIDSVTNDNLIINVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGV+GT CPI PG NFTY LQVKDQIGS++YFPSL FHKAAGGFGGI+
Sbjct  84   WNGVQQRRNSWQDGVFGTNCPIPPGQNFTYALQVKDQIGSYFYFPSLGFHKAAGGFGGIK  143

Query  534  ILSR  545
            I SR
Sbjct  144  IDSR  147



>ref|XP_003605947.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES88144.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=538

 Score =   217 bits (553),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLGV QQGILINGQFPGP+IE VTNDNL INVFNSLD+PFL+S
Sbjct  23   EDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNSLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+  RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLAFHKAAGG+GG  
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPISPGQNFTYILQVKDQIGSYFYFPSLAFHKAAGGYGGFT  142

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  143  IASRSVIPVP  152



>dbj|BAC83966.1| putative PS60 [Oryza sativa Japonica Group]
Length=563

 Score =   218 bits (554),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  I PLGV QQGILINGQFPGP IE VTNDNL INVFN L+ PFL+S
Sbjct  25   DDPYRFFTWTVTYGDITPLGVKQQGILINGQFPGPTIEAVTNDNLIINVFNKLNDPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQIG+++YFPSLAFHKAAGGFG IR
Sbjct  85   WNGIQQRRNSFEDGVAGTTCPIPPGGNFTYILQVKDQIGTYFYFPSLAFHKAAGGFGAIR  144

Query  534  ILSR  545
            +LSR
Sbjct  145  VLSR  148



>ref|XP_010278638.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=541

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTW VTY  IYPLGV Q+GILINGQFPGP+I+CVTNDNL ++V+N LD+PFL+S
Sbjct  23   EDPYRFFTWKVTYGDIYPLGVKQRGILINGQFPGPQIDCVTNDNLIVSVYNYLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSF+YFPSL FHKAAGGFGGI+
Sbjct  83   WNGIQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLGFHKAAGGFGGIK  142

Query  534  ILSR  545
            I SR
Sbjct  143  INSR  146



>ref|XP_004144874.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004152953.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            + PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDN++INV NSL +PFLLS
Sbjct  29   DSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYINVHNSLPEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NS++DGVYGTTCPI PG NFTY +QVKDQIGS++YFPSLAFHKAAGGFG IR
Sbjct  89   WNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGSYFYFPSLAFHKAAGGFGSIR  148

Query  534  ILSRPRILSP  563
            +LSRP I  P
Sbjct  149  VLSRPLIPVP  158



>ref|XP_008224692.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=543

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR FTW +TY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+VFN L +PFL+S
Sbjct  24   EDPYRLFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLREPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQ RRNS++DGVYGT CPILPG NFTY +QVKDQIGSF+YFPS  FHKAAGGFGGIR
Sbjct  84   WDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGSFFYFPSFLFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            I SRP+I  P
Sbjct  144  IWSRPKIPVP  153



>gb|EMS67789.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=610

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVT+  IYPLGV QQGILINGQFPGP+I+ VTNDN+ INVFN+L  PFLLS
Sbjct  155  EDPYRFYTWNVTFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPAPFLLS  214

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W GIQ RR+S++DGVYGT CPI PG NFTY +Q KDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  215  WQGIQQRRSSWQDGVYGTNCPIPPGGNFTYNMQFKDQIGSYYYFPSLAFHKAAGGYGGIR  274

Query  534  ILSRPRILSP  563
            +LSRPRI  P
Sbjct  275  VLSRPRIPVP  284



>ref|XP_002866796.1| hypothetical protein ARALYDRAFT_490604 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43055.1| hypothetical protein ARALYDRAFT_490604 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+F W VTY  I PLG+PQ+GILINGQ+PGP+I  VTNDNL INV N LD+PFLLS
Sbjct  14   DDPYRFFDWRVTYGNISPLGIPQRGILINGQYPGPDIYSVTNDNLIINVHNDLDEPFLLS  73

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLA HKAAGGFGG R
Sbjct  74   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAVHKAAGGFGGFR  133

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  134  ILSRPRIPVP  143



>ref|XP_009402574.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=541

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW+V Y  IYPLGV QQGILI+GQFPGP+IE VTNDNL +NVFN+L +PFL+S
Sbjct  23   DDPYRFFTWSVIYGDIYPLGVKQQGILIDGQFPGPQIEAVTNDNLIVNVFNNLTEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ R+NS+EDGVYGT CPILPG N+TY++QVKDQIGS++YFP+L FHKAAGGFGGIR
Sbjct  83   WNGIQQRKNSWEDGVYGTNCPILPGQNYTYVMQVKDQIGSYFYFPTLDFHKAAGGFGGIR  142

Query  534  ILSR  545
            +LSR
Sbjct  143  VLSR  146



>ref|XP_008447902.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=546

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            + PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDN++INV NSL +PFLLS
Sbjct  29   DSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYINVHNSLPEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NS++DGVYGTTCPI PG NFTY +QVKDQIGS++YFPSLAFHKAAGGFG IR
Sbjct  89   WNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGSYFYFPSLAFHKAAGGFGSIR  148

Query  534  ILSRPRILSP  563
            +LSRP I  P
Sbjct  149  VLSRPLIPVP  158



>ref|NP_195555.2| protein SKU5 similar 9 [Arabidopsis thaliana]
 gb|AAL60036.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAM20243.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEE86927.1| protein SKU5 similar 9 [Arabidopsis thaliana]
Length=549

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+F W VTY  I PLG+PQ+GILINGQ+PGP+I  VTNDNL INV N LD+PFLLS
Sbjct  26   DDPYRFFDWRVTYGNISPLGIPQRGILINGQYPGPDIYSVTNDNLIINVHNDLDEPFLLS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLA HKAAGGFGG R
Sbjct  86   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAVHKAAGGFGGFR  145

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  146  ILSRPRIPVP  155



>ref|XP_009597920.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=541

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++TWN+TY  IYPLGV QQGILINGQFPGP IECVTNDNL ++VFN+LD+PFL+S
Sbjct  23   ESPYRFYTWNITYGDIYPLGVKQQGILINGQFPGPPIECVTNDNLIVSVFNNLDEPFLMS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSF+YFPSLA HKAAGG+GGI+
Sbjct  83   WDGIQQRRNSWQDGVYGTNCPIPPGQNFTYILQVKDQIGSFFYFPSLAMHKAAGGYGGIK  142

Query  534  ILSR  545
            I SR
Sbjct  143  IDSR  146



>emb|CAB37498.1| putative pectinesterase [Arabidopsis thaliana]
 emb|CAB80507.1| putative pectinesterase [Arabidopsis thaliana]
Length=548

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+F W VTY  I PLG+PQ+GILINGQ+PGP+I  VTNDNL INV N LD+PFLLS
Sbjct  26   DDPYRFFDWRVTYGNISPLGIPQRGILINGQYPGPDIYSVTNDNLIINVHNDLDEPFLLS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLA HKAAGGFGG R
Sbjct  86   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAVHKAAGGFGGFR  145

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  146  ILSRPRIPVP  155



>ref|XP_002518462.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF43849.1| multicopper oxidase, putative [Ricinus communis]
Length=541

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+FTW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL INVFN L +PFL+S
Sbjct  23   ENPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDVVTNDNLIINVFNYLREPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPILPG NFTY+LQVKDQIGS++YFPSL  HKAAGGFGGIR
Sbjct  83   WNGIQQRRNSWQDGVYGTNCPILPGRNFTYILQVKDQIGSYFYFPSLGMHKAAGGFGGIR  142

Query  534  ILSR  545
            + SR
Sbjct  143  VWSR  146



>gb|KGN43515.1| hypothetical protein Csa_7G043570 [Cucumis sativus]
Length=453

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+  WN+TY  I+PLGV QQGILINGQFPGP+IE VTN+NL INVFNSLD+PFL+S
Sbjct  25   EDPYRFLNWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLA HKAAGGFGG +
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLALHKAAGGFGGFK  144

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  145  IQSRSIIPIP  154



>ref|XP_009794440.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
sylvestris]
Length=541

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++TWN+TY  IYPLGV QQGILINGQFPGP IECVTNDNL ++VFN+LD+PFL+S
Sbjct  23   ESPYRFYTWNITYGDIYPLGVKQQGILINGQFPGPPIECVTNDNLIVSVFNNLDEPFLMS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSF+YFPSLA HKAAGG+GG++
Sbjct  83   WDGIQQRRNSWQDGVYGTNCPIPPGQNFTYILQVKDQIGSFFYFPSLAMHKAAGGYGGVK  142

Query  534  ILSR  545
            I SR
Sbjct  143  IDSR  146



>ref|XP_002524823.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF37543.1| multicopper oxidase, putative [Ricinus communis]
Length=538

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+++WN++Y  IYPLGV QQGILINGQFPGP+IE VTNDNL INVFNSLD+PFL+S
Sbjct  25   EDPYRFYSWNISYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSL  HKAAGG+GG +
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLGMHKAAGGYGGFK  144

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  145  IASRSVIPVP  154



>ref|XP_006366591.1| PREDICTED: L-ascorbate oxidase homolog, partial [Solanum tuberosum]
Length=568

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++ WN+TY  IYPLGV QQGILINGQFPGP+I+ VTNDNL INVFNSLD+PFLLS
Sbjct  50   ESPYRWYNWNITYGDIYPLGVKQQGILINGQFPGPQIDSVTNDNLIINVFNSLDEPFLLS  109

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSF+YFPSLA HKAAGG+GGI 
Sbjct  110  WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSFFYFPSLAMHKAAGGYGGII  169

Query  534  ILSR  545
            I SR
Sbjct  170  IRSR  173



>dbj|BAK00459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVT+  +YPLGV QQGILINGQFPGP+I+ VTNDN+ INVFN+L  PFLLS
Sbjct  23   EDPYRFYTWNVTFGDVYPLGVKQQGILINGQFPGPQIDAVTNDNIVINVFNNLPAPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W GIQ RR+S++DGVYGT CP  PG NFTY +Q KDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  83   WQGIQQRRSSWQDGVYGTNCPTPPGGNFTYNMQFKDQIGSYYYFPSLAFHKAAGGYGGIR  142

Query  534  ILSRPRILSP  563
            +LSRPRI  P
Sbjct  143  VLSRPRIPVP  152



>ref|XP_007026110.1| SKU5 similar 4 isoform 3 [Theobroma cacao]
 gb|EOY28732.1| SKU5 similar 4 isoform 3 [Theobroma cacao]
Length=543

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYRY TW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+V+N L++PFL+S
Sbjct  23   ENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLNEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQIGSF+YFPSL FHKAAGG+GGIR
Sbjct  83   WNGVQQRRNSWQDGVFGTNCPIRPGKNFTYVLQVKDQIGSFFYFPSLLFHKAAGGYGGIR  142

Query  534  ILSRPRILSP  563
            I SRP+I  P
Sbjct  143  IWSRPKIPVP  152



>ref|XP_004166771.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=543

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+  WN+TY  I+PLGV QQGILINGQFPGP+IE VTN+NL INVFNSLD+PFL+S
Sbjct  25   EDPYRFLNWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLA HKAAGGFGG +
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLALHKAAGGFGGFK  144

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  145  IQSRSIIPIP  154



>ref|XP_004144498.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=543

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+  WN+TY  I+PLGV QQGILINGQFPGP+IE VTN+NL INVFNSLD+PFL+S
Sbjct  25   EDPYRFLNWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSLA HKAAGGFGG +
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLALHKAAGGFGGFK  144

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  145  IQSRSIIPIP  154



>ref|XP_007026108.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 ref|XP_007026109.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 gb|EOY28730.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 gb|EOY28731.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
Length=542

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYRY TW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+V+N L++PFL+S
Sbjct  23   ENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLNEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQIGSF+YFPSL FHKAAGG+GGIR
Sbjct  83   WNGVQQRRNSWQDGVFGTNCPIRPGKNFTYVLQVKDQIGSFFYFPSLLFHKAAGGYGGIR  142

Query  534  ILSRPRILSP  563
            I SRP+I  P
Sbjct  143  IWSRPKIPVP  152



>dbj|BAJ91397.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVT+  +YPLGV QQGILINGQFPGP+I+ VTNDN+ INVFN+L  PFLLS
Sbjct  23   EDPYRFYTWNVTFGDVYPLGVRQQGILINGQFPGPQIDAVTNDNIVINVFNNLPAPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W GIQ RR+S++DGVYGT CP  PG NFTY +Q KDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  83   WQGIQQRRSSWQDGVYGTNCPTPPGGNFTYNMQFKDQIGSYYYFPSLAFHKAAGGYGGIR  142

Query  534  ILSRPRILSP  563
            +LSRPRI  P
Sbjct  143  VLSRPRIPVP  152



>ref|XP_006383902.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|ERP61699.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=544

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+ TW +TY  IYPLGV QQGILINGQFPGP+I+ VTN+NL I+V+N L +PFL+S
Sbjct  25   EDPYRFITWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNENLIISVYNYLREPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT+CPI PG NFTY LQVKDQIGSF+YFPSL FHKAAG FGGIR
Sbjct  85   WNGIQQRRNSWQDGVYGTSCPIPPGKNFTYALQVKDQIGSFFYFPSLGFHKAAGAFGGIR  144

Query  534  ILSRPRILSP  563
            I SRPRI  P
Sbjct  145  IWSRPRIPVP  154



>ref|XP_006656379.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=546

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR++TWNVT+  IYPLGV QQGILINGQFPGP+I+ VTNDN+ INV+NSL  PFLLS
Sbjct  27   DDPYRFYTWNVTFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIVINVYNSLPSPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W GIQ RR+S++DGVYGT CPI PG NFTY++Q KDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  87   WQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGIR  146

Query  534  ILSRPRILSP  563
            +LSRP I  P
Sbjct  147  VLSRPGIPVP  156



>ref|XP_006283464.1| hypothetical protein CARUB_v10004509mg [Capsella rubella]
 gb|EOA16362.1| hypothetical protein CARUB_v10004509mg [Capsella rubella]
Length=554

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W VTY TI PLG+P +GILINGQ+PGP+I  VTNDNL INV N LD+PFLLS
Sbjct  29   EDPYRFFDWRVTYGTISPLGIPLRGILINGQYPGPDIYSVTNDNLIINVHNDLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQIGSF+YFPSLA HKA GGFGG R
Sbjct  89   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAVHKAVGGFGGFR  148

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  149  ILSRPRIPVP  158



>ref|XP_010555198.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=553

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W V+Y  IYPLG PQ+GILINGQFPGP I  VTNDNL INV N LD+PFLLS
Sbjct  28   EDPYRFFDWTVSYGLIYPLGFPQRGILINGQFPGPNIYSVTNDNLIINVHNDLDEPFLLS  87

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NS++DGVYGTTCPI PG NFTY+ QVKDQIGSF+YFPSL  HKAAGGFGG+R
Sbjct  88   WNGVQMRKNSYQDGVYGTTCPIPPGKNFTYVFQVKDQIGSFFYFPSLGLHKAAGGFGGLR  147

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  148  ILSRPLIPVP  157



>ref|XP_009353293.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=542

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLG+ QQGILINGQFPGP+IE VTNDNL I+VFNSLD+PFL+S
Sbjct  24   EDPYRFYNWNVTYGDIYPLGIKQQGILINGQFPGPQIESVTNDNLIISVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQIGS++YFPSL  HKAAGGFGGI+
Sbjct  84   WNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLGLHKAAGGFGGIK  143

Query  534  ILSR  545
            I SR
Sbjct  144  IDSR  147



>ref|NP_173603.1| SKU5 similar 8 protein [Arabidopsis thaliana]
 gb|AAF16544.1|AC013482_18 T26F17.6 [Arabidopsis thaliana]
 gb|ABE65639.1| multi-copper oxidase type I family protein [Arabidopsis thaliana]
 gb|AEE30162.1| SKU5 similar 8 protein [Arabidopsis thaliana]
Length=551

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY++F W+VTY  I PL V QQGILING+FPGP+I  VTNDNL INVFN LD+PFL+S
Sbjct  25   EDPYKFFEWHVTYGNISPLKVAQQGILINGKFPGPDIAAVTNDNLIINVFNHLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W+GI+N RNS++DGVYGTTCPI PG N+TY LQVKDQIGSFYYFPSL FHKAAGGFG IR
Sbjct  85   WSGIRNWRNSYQDGVYGTTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGFGAIR  144

Query  534  ILSRPRILSP  563
            I SRPRI  P
Sbjct  145  ISSRPRIPVP  154



>gb|EAZ38022.1| hypothetical protein OsJ_22366 [Oryza sativa Japonica Group]
Length=532

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR++TWN+T+  IYPLGV QQGILINGQFPGP+I+ VTNDN+ INVFN+L  PFLLS
Sbjct  13   DDPYRFYTWNITFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPSPFLLS  72

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W GIQ RR+S++DGVYGT CPI PG NFTY++Q KDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  73   WQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGIR  132

Query  534  ILSRPRILSP  563
            +LSRP I  P
Sbjct  133  VLSRPGIPVP  142



>gb|EAZ02087.1| hypothetical protein OsI_24168 [Oryza sativa Indica Group]
Length=542

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR++TWN+T+  IYPLGV QQGILINGQFPGP+I+ VTNDN+ INVFN+L  PFLLS
Sbjct  23   DDPYRFYTWNITFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPSPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W GIQ RR+S++DGVYGT CPI PG NFTY++Q KDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  83   WQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGIR  142

Query  534  ILSRPRILSP  563
            +LSRP I  P
Sbjct  143  VLSRPGIPVP  152



>ref|NP_001058365.1| Os06g0678800 [Oryza sativa Japonica Group]
 dbj|BAD45475.1| putative PS60 [Oryza sativa Japonica Group]
 dbj|BAD45542.1| putative PS60 [Oryza sativa Japonica Group]
 dbj|BAF20279.1| Os06g0678800 [Oryza sativa Japonica Group]
 dbj|BAG92507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=542

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR++TWN+T+  IYPLGV QQGILINGQFPGP+I+ VTNDN+ INVFN+L  PFLLS
Sbjct  23   DDPYRFYTWNITFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPSPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            W GIQ RR+S++DGVYGT CPI PG NFTY++Q KDQIGS+YYFPSLAFHKAAGG+GGIR
Sbjct  83   WQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGIR  142

Query  534  ILSRPRILSP  563
            +LSRP I  P
Sbjct  143  VLSRPGIPVP  152



>gb|KJB67220.1| hypothetical protein B456_010G181000 [Gossypium raimondii]
Length=484

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYRY TW VTY  IYPLGV QQGILINGQFPGP I+ VTNDNL I+V+N L++PFL+S
Sbjct  23   ENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNLIISVYNYLNEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGV GT CPI PG NFTY+LQVKDQIGSFYYFPSL FHKAAGG+G IR
Sbjct  83   WNGVQQRRNSWQDGVSGTNCPIRPGKNFTYVLQVKDQIGSFYYFPSLLFHKAAGGYGAIR  142

Query  534  ILSRPRILSP  563
            I SRP+I  P
Sbjct  143  IWSRPKIPVP  152



>ref|XP_009400332.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=542

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVT+  IYPLG+ QQGILINGQFPGP+I   TNDN+ +NV+NSL +PFL+S
Sbjct  24   EDPYRFFDWNVTFGDIYPLGIRQQGILINGQFPGPDIHSQTNDNIIVNVYNSLTEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R NS++DGV GT CPI PG NFTY++ +KDQIGSF+YFPSLAFHKAAGGFGGIR
Sbjct  84   WNGVQQRGNSWQDGVSGTNCPIPPGKNFTYVMHLKDQIGSFFYFPSLAFHKAAGGFGGIR  143

Query  534  ILSRPRILSP  563
            ILSRPRI  P
Sbjct  144  ILSRPRIPVP  153



>ref|XP_006413696.1| hypothetical protein EUTSA_v10024862mg [Eutrema salsugineum]
 gb|ESQ55149.1| hypothetical protein EUTSA_v10024862mg [Eutrema salsugineum]
Length=541

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            ++PYR+FTW +TY  IYPLGV QQGILINGQFPGP I+ +TNDN+ I+VFN L +PFL+S
Sbjct  22   DNPYRFFTWKITYGNIYPLGVKQQGILINGQFPGPHIDAITNDNIIISVFNYLKEPFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q R+NS++DGV GTTCPI PG NFTY++QVKDQIGSFYYFPSLAFHKAAG FG IR
Sbjct  82   WNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGAFGAIR  141

Query  534  ILSRPRILSP  563
            I SRPRI  P
Sbjct  142  IWSRPRIPVP  151



>ref|XP_011047251.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
 ref|XP_011047252.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=547

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+ TWNVTY  IYPLGV QQGILING FPGP+IE VTNDNL I+VFNSLD+PFL+S
Sbjct  29   EDPYRFHTWNVTYGDIYPLGVKQQGILINGLFPGPQIESVTNDNLIISVFNSLDEPFLIS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQIGS++YFPSL  HKAAGGFGG +
Sbjct  89   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLGMHKAAGGFGGFK  148

Query  534  ILSRPRILSP  563
            I SR  I  P
Sbjct  149  IASRSVIPVP  158



>ref|XP_010323833.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=543

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++ WN+TY  IYPLGV QQGILINGQFPGP I+ VTNDNL INVFNSLD+PFLLS
Sbjct  25   ESPYRWYNWNITYGDIYPLGVKQQGILINGQFPGPPIDSVTNDNLIINVFNSLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQIGSF+YFPSLA HKAAGG+GGI 
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSFFYFPSLAMHKAAGGYGGII  144

Query  534  ILSR  545
            I SR
Sbjct  145  IRSR  148



>ref|XP_010918208.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=541

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            ++PYR+FTWNV++  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  23   DNPYRFFTWNVSFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLSEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQIGSFYYFPSLAFHKAAGGFGGIR  533
            WNG+Q RRNS+EDGV GT CPI PG NFTY+LQVKDQIGSF+YFPSL FHKAAGGFGG R
Sbjct  83   WNGVQQRRNSWEDGVSGTNCPIPPGKNFTYILQVKDQIGSFFYFPSLYFHKAAGGFGGFR  142

Query  534  ILSRPRILSP  563
            ILSRP I  P
Sbjct  143  ILSRPLIPVP  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160