BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF049P20

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP02088.1|  unnamed protein product                                259   3e-80   Coffea canephora [robusta coffee]
ref|XP_011097422.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    257   2e-79   Sesamum indicum [beniseed]
ref|XP_009768205.1|  PREDICTED: isocitrate dehydrogenase [NADP]         256   4e-79   Nicotiana sylvestris
ref|NP_001275253.1|  isocitrate dehydrogenase [NADP], chloroplast...    253   4e-78   Solanum tuberosum [potatoes]
gb|EYU34732.1|  hypothetical protein MIMGU_mgv1a005695mg                253   5e-78   Erythranthe guttata [common monkey flower]
ref|XP_004232313.1|  PREDICTED: isocitrate dehydrogenase [NADP]         253   9e-78   Solanum lycopersicum
ref|XP_009625432.1|  PREDICTED: isocitrate dehydrogenase [NADP]         250   8e-77   Nicotiana tomentosiformis
ref|XP_007215326.1|  hypothetical protein PRUPE_ppa005200mg             248   4e-76   
ref|XP_009334109.1|  PREDICTED: isocitrate dehydrogenase [NADP]         248   5e-76   Pyrus x bretschneideri [bai li]
emb|CAA65504.1|  isocitrate dehydrogenase (NADP+)                       248   6e-76   Nicotiana tabacum [American tobacco]
ref|XP_008230571.1|  PREDICTED: isocitrate dehydrogenase [NADP]         248   8e-76   Prunus mume [ume]
emb|CAA65503.1|  isocitrate dehydrogenase (NADP+)                       248   9e-76   Nicotiana tabacum [American tobacco]
emb|CAN74293.1|  hypothetical protein VITISV_015982                     248   9e-76   Vitis vinifera
ref|XP_002276200.2|  PREDICTED: isocitrate dehydrogenase [NADP]         246   2e-75   Vitis vinifera
emb|CBI34891.3|  unnamed protein product                                246   7e-75   Vitis vinifera
ref|XP_008379224.1|  PREDICTED: isocitrate dehydrogenase [NADP]         243   4e-74   
ref|XP_008368420.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    235   4e-74   
ref|XP_004306353.2|  PREDICTED: isocitrate dehydrogenase [NADP]         241   4e-73   Fragaria vesca subsp. vesca
ref|XP_006446550.1|  hypothetical protein CICLE_v100148161mg            238   7e-73   
ref|XP_009377196.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    239   2e-72   Pyrus x bretschneideri [bai li]
gb|KFK25699.1|  hypothetical protein AALP_AA8G147500                    239   2e-72   Arabis alpina [alpine rockcress]
ref|XP_010688692.1|  PREDICTED: isocitrate dehydrogenase [NADP]         238   2e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009375130.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    237   8e-72   Pyrus x bretschneideri [bai li]
ref|XP_010551914.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    236   8e-72   Tarenaya hassleriana [spider flower]
ref|XP_006470285.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    238   1e-71   Citrus sinensis [apfelsine]
ref|XP_010420101.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    237   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010108798.1|  Isocitrate dehydrogenase [NADP]                    236   2e-71   Morus notabilis
ref|XP_006399971.1|  hypothetical protein EUTSA_v10013384mg             236   3e-71   
ref|XP_010492268.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    236   3e-71   Camelina sativa [gold-of-pleasure]
emb|CAB87626.1|  isocitrate dehydrogenase-like protein                  235   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551913.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    236   3e-71   Tarenaya hassleriana [spider flower]
ref|NP_196963.2|  isocitrate dehydrogenase                              235   5e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287601.1|  hypothetical protein CARUB_v10000812mg             235   7e-71   Capsella rubella
emb|CDX78585.1|  BnaA03g04970D                                          234   8e-71   
ref|XP_007031536.1|  Isocitrate/isopropylmalate dehydrogenase fam...    232   9e-71   
ref|XP_002524672.1|  NADP-specific isocitrate dehydrogenase, puta...    233   2e-70   
gb|KDP45313.1|  hypothetical protein JCGZ_09562                         233   2e-70   Jatropha curcas
ref|XP_010453584.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    233   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009131418.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    233   3e-70   Brassica rapa
gb|KCW52908.1|  hypothetical protein EUGRSUZ_J02223                     231   4e-70   Eucalyptus grandis [rose gum]
ref|XP_007031535.1|  Isocitrate/isopropylmalate dehydrogenase fam...    231   4e-70   
emb|CDX70573.1|  BnaC03g06570D                                          232   6e-70   
ref|XP_006841065.1|  hypothetical protein AMTR_s00085p00178400          232   1e-69   Amborella trichopoda
ref|XP_008458785.1|  PREDICTED: isocitrate dehydrogenase [NADP]         231   2e-69   Cucumis melo [Oriental melon]
ref|XP_010033298.1|  PREDICTED: isocitrate dehydrogenase [NADP]         231   2e-69   Eucalyptus grandis [rose gum]
ref|XP_008812172.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    231   2e-69   Phoenix dactylifera
ref|XP_007031533.1|  Isocitrate/isopropylmalate dehydrogenase fam...    231   2e-69   
gb|KJB70909.1|  hypothetical protein B456_011G095400                    230   3e-69   Gossypium raimondii
ref|XP_010940159.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    231   3e-69   Elaeis guineensis
gb|KJB70908.1|  hypothetical protein B456_011G095400                    230   4e-69   Gossypium raimondii
ref|XP_002873679.1|  hypothetical protein ARALYDRAFT_488300             229   1e-68   
ref|XP_004156686.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    229   1e-68   
ref|XP_004142794.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    229   1e-68   
ref|XP_010248538.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    228   4e-68   Nelumbo nucifera [Indian lotus]
ref|XP_010248537.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    228   4e-68   Nelumbo nucifera [Indian lotus]
gb|KJB33783.1|  hypothetical protein B456_006G032000                    227   4e-68   Gossypium raimondii
ref|XP_010248540.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    225   4e-68   Nelumbo nucifera [Indian lotus]
gb|KHG11175.1|  Isocitrate dehydrogenase [NADP]                         228   5e-68   Gossypium arboreum [tree cotton]
ref|XP_009390156.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    222   3e-67   
ref|XP_003581407.1|  PREDICTED: isocitrate dehydrogenase [NADP]         225   4e-67   Brachypodium distachyon [annual false brome]
ref|XP_002446765.1|  hypothetical protein SORBIDRAFT_06g022050          224   7e-67   Sorghum bicolor [broomcorn]
ref|XP_004976171.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    224   8e-67   Setaria italica
ref|XP_009390155.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    224   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007031534.1|  Isocitrate/isopropylmalate dehydrogenase fam...    223   1e-66   
emb|CAE04728.1|  OSJNBa0043L24.16                                       222   3e-66   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053269.1|  Os04g0508200                                       222   4e-66   
emb|CAH67563.1|  OSIGBa0101P20.6                                        222   5e-66   Oryza sativa [red rice]
gb|EEC77605.1|  hypothetical protein OsI_16579                          221   7e-66   Oryza sativa Indica Group [Indian rice]
gb|ABR16155.1|  unknown                                                 220   9e-66   Picea sitchensis
gb|ACN40177.1|  unknown                                                 219   1e-65   Picea sitchensis
ref|XP_010940160.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    221   1e-65   Elaeis guineensis
gb|AAR05796.1|  NADP+-isocitrate dehydrogenase                          216   1e-64   Pinus pinaster [cluster pine]
ref|XP_007151010.1|  hypothetical protein PHAVU_004G011200g             218   2e-64   Phaseolus vulgaris [French bean]
gb|AIZ74341.1|  isocitrate dehydrogenase                                218   3e-64   Pinus massoniana [Chinese red pine]
ref|XP_003525669.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    217   4e-64   Glycine max [soybeans]
ref|XP_003618179.1|  Isocitrate dehydrogenase-like protein              216   6e-64   Medicago truncatula
ref|XP_002989225.1|  hypothetical protein SELMODRAFT_129507             214   1e-63   
ref|XP_002966002.1|  hypothetical protein SELMODRAFT_84397              214   1e-63   
ref|XP_011047331.1|  PREDICTED: isocitrate dehydrogenase [NADP]         216   1e-63   Populus euphratica
ref|XP_009363306.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    214   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_010669953.1|  PREDICTED: isocitrate dehydrogenase [NADP]         213   2e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010462488.1|  PREDICTED: peroxisomal isocitrate dehydrogen...    206   2e-63   
ref|XP_006858533.1|  hypothetical protein AMTR_s00071p00157830          213   2e-63   Amborella trichopoda
ref|XP_011085932.1|  PREDICTED: isocitrate dehydrogenase [NADP]         213   2e-63   Sesamum indicum [beniseed]
ref|XP_010913457.1|  PREDICTED: isocitrate dehydrogenase [NADP]         213   3e-63   Elaeis guineensis
ref|XP_002298528.2|  hypothetical protein POPTR_0001s35080g             215   3e-63   Populus trichocarpa [western balsam poplar]
ref|NP_001136968.1|  seed maturation protein PM41                       213   4e-63   Zea mays [maize]
ref|XP_010462487.1|  PREDICTED: peroxisomal isocitrate dehydrogen...    206   4e-63   
gb|KGN50927.1|  hypothetical protein Csa_5G346550                       212   4e-63   Cucumis sativus [cucumbers]
ref|XP_008798438.1|  PREDICTED: LOW QUALITY PROTEIN: isocitrate d...    213   5e-63   Phoenix dactylifera
gb|ABK24873.1|  unknown                                                 214   5e-63   Picea sitchensis
dbj|BAC77065.1|  NADP-specific isocitrate dehydrogenase                 214   6e-63   Lupinus albus
ref|XP_002969739.1|  hypothetical protein SELMODRAFT_267315             213   6e-63   Selaginella moellendorffii
emb|CAD24779.1|  isocitrate dehydrogenase                               212   7e-63   Cucumis sativus [cucumbers]
ref|XP_006596496.1|  PREDICTED: isocitrate dehydrogenase [NADP]         212   7e-63   
gb|AAA33978.1|  NADPH-specific isocitrate dehydrogenase                 213   8e-63   Glycine max [soybeans]
ref|XP_006644455.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    212   8e-63   Oryza brachyantha
pir||S33612  isocitrate dehydrogenase (NADP) (EC 1.1.1.42) - soybean    213   8e-63
ref|XP_008463133.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    212   8e-63   Cucumis melo [Oriental melon]
ref|XP_004157023.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    212   8e-63   
ref|XP_008463131.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    212   8e-63   Cucumis melo [Oriental melon]
ref|XP_008463132.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    212   9e-63   Cucumis melo [Oriental melon]
ref|XP_008371955.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    213   1e-62   
ref|XP_008371954.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    213   1e-62   
ref|XP_002981348.1|  hypothetical protein SELMODRAFT_268459             212   1e-62   Selaginella moellendorffii
ref|XP_004969349.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    211   1e-62   Setaria italica
ref|XP_004150540.1|  PREDICTED: LOW QUALITY PROTEIN: isocitrate d...    212   1e-62   
gb|EYU33810.1|  hypothetical protein MIMGU_mgv1a007171mg                211   1e-62   Erythranthe guttata [common monkey flower]
gb|AFK47062.1|  unknown                                                 206   1e-62   Lotus japonicus
gb|KHN41035.1|  Isocitrate dehydrogenase [NADP]                         211   1e-62   Glycine soja [wild soybean]
ref|NP_001241237.1|  uncharacterized protein LOC100786103               211   1e-62   Glycine max [soybeans]
ref|NP_001142417.1|  uncharacterized protein LOC100274592               211   2e-62   Zea mays [maize]
emb|CDP01688.1|  unnamed protein product                                211   2e-62   Coffea canephora [robusta coffee]
ref|XP_010924866.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    211   2e-62   Elaeis guineensis
gb|AEB78733.1|  putative NADP+-dependent isocitrate dehydrogenase       202   2e-62   Lupinus luteus
ref|XP_002312216.2|  NADP-dependent isocitrate dehydrogenase fami...    211   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_010528595.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    211   3e-62   Tarenaya hassleriana [spider flower]
gb|KHG29051.1|  Isocitrate dehydrogenase [NADP], chloroplastic          212   3e-62   Gossypium arboreum [tree cotton]
ref|XP_002315093.2|  NADP-dependent isocitrate dehydrogenase fami...    211   3e-62   
dbj|BAA34112.1|  NADP specific isocitrate dehydrogenase                 210   3e-62   Daucus carota [carrots]
ref|XP_010260857.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    210   4e-62   Nelumbo nucifera [Indian lotus]
ref|XP_004489246.1|  PREDICTED: LOW QUALITY PROTEIN: isocitrate d...    211   4e-62   
ref|XP_010260858.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    210   4e-62   
dbj|BAC77063.1|  NADP-specific isocitrate dehydrogenase                 210   4e-62   Lupinus albus
gb|EYU41407.1|  hypothetical protein MIMGU_mgv1a005492mg                211   4e-62   Erythranthe guttata [common monkey flower]
ref|XP_006372414.1|  isocitrate dehydrogenase family protein            210   4e-62   
gb|EYU41406.1|  hypothetical protein MIMGU_mgv1a005492mg                212   5e-62   Erythranthe guttata [common monkey flower]
ref|NP_001043749.1|  Os01g0654500                                       210   5e-62   
ref|XP_007022796.1|  Isocitrate dehydrogenase (NADP) isoform 2          208   5e-62   
gb|ACU21054.1|  unknown                                                 210   6e-62   Glycine max [soybeans]
gb|KHN21348.1|  Isocitrate dehydrogenase [NADP], chloroplastic          209   6e-62   Glycine soja [wild soybean]
gb|KJB81470.1|  hypothetical protein B456_013G147100                    205   6e-62   Gossypium raimondii
ref|XP_010101074.1|  Isocitrate dehydrogenase [NADP]                    209   7e-62   Morus notabilis
ref|XP_003569476.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    209   7e-62   Brachypodium distachyon [annual false brome]
gb|KDO46553.1|  hypothetical protein CISIN_1g015012mg                   206   8e-62   Citrus sinensis [apfelsine]
ref|NP_001236203.1|  NADP-dependent isocitrate dehydrogenase            209   8e-62   
ref|XP_011038412.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    209   8e-62   Populus euphratica
dbj|BAE99739.1|  NADP specific isocitrate dehydrogenase                 204   8e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009395062.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    209   9e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010415138.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    200   9e-62   
gb|KDP39826.1|  hypothetical protein JCGZ_04236                         209   1e-61   Jatropha curcas
ref|XP_010480188.1|  PREDICTED: peroxisomal isocitrate dehydrogen...    209   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_011038411.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    209   1e-61   Populus euphratica
gb|EPS58684.1|  hypothetical protein M569_16128                         209   1e-61   Genlisea aurea
ref|XP_003546847.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    209   1e-61   Glycine max [soybeans]
ref|XP_009384960.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    209   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO46551.1|  hypothetical protein CISIN_1g015012mg                   207   1e-61   Citrus sinensis [apfelsine]
ref|XP_002527208.1|  NADP-specific isocitrate dehydrogenase, puta...    209   1e-61   Ricinus communis
dbj|BAC77064.1|  NADP-specific isocitrate dehydrogenase                 209   1e-61   Lupinus albus
gb|EPS68007.1|  hypothetical protein M569_06765                         209   1e-61   Genlisea aurea
dbj|BAA34113.1|  NADP specific isocitrate dehydrogenase                 209   1e-61   Daucus carota [carrots]
gb|KJB81471.1|  hypothetical protein B456_013G147100                    205   2e-61   Gossypium raimondii
gb|KDO46550.1|  hypothetical protein CISIN_1g015012mg                   206   2e-61   Citrus sinensis [apfelsine]
emb|CAA73139.1|  isocitrate dehydrogenase (NADP+)                       208   2e-61   Apium graveolens
emb|CDX67740.1|  BnaA07g17800D                                          209   2e-61   
ref|XP_010551544.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    208   2e-61   Tarenaya hassleriana [spider flower]
gb|AFW83444.1|  hypothetical protein ZEAMMB73_038317                    208   2e-61   
gb|ABA18651.1|  cytosolic NADP+-isocitrate dehydrogenase                208   2e-61   Populus tremula x Populus alba [gray poplar]
ref|XP_002528517.1|  NADP-specific isocitrate dehydrogenase, puta...    208   2e-61   Ricinus communis
sp|P50218.1|IDHC_TOBAC  RecName: Full=Isocitrate dehydrogenase [N...    208   2e-61   Nicotiana tabacum [American tobacco]
sp|Q40345.1|IDHP_MEDSA  RecName: Full=Isocitrate dehydrogenase [N...    209   2e-61   Medicago sativa [alfalfa]
gb|KJB81472.1|  hypothetical protein B456_013G147100                    206   2e-61   Gossypium raimondii
ref|XP_003595878.1|  Isocitrate dehydrogenase                           208   2e-61   Medicago truncatula
ref|XP_007031322.1|  Isocitrate dehydrogenase (NADP) isoform 2          206   2e-61   
ref|XP_009624622.1|  PREDICTED: isocitrate dehydrogenase [NADP]         208   3e-61   Nicotiana tomentosiformis
ref|XP_007022795.1|  Isocitrate dehydrogenase (NADP) isoform 1          208   3e-61   
ref|XP_002270617.1|  PREDICTED: isocitrate dehydrogenase [NADP]         208   3e-61   Vitis vinifera
gb|KDO46543.1|  hypothetical protein CISIN_1g015012mg                   208   3e-61   Citrus sinensis [apfelsine]
gb|AAB39248.1|  NADP-isocitrate dehydrogenase                           208   3e-61   Eucalyptus globulus [blue gum]
gb|KJB43196.1|  hypothetical protein B456_007G188300                    205   3e-61   Gossypium raimondii
ref|XP_006432387.1|  hypothetical protein CICLE_v10001314mg             208   3e-61   
ref|XP_006494575.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    208   3e-61   Citrus sinensis [apfelsine]
gb|KDO46544.1|  hypothetical protein CISIN_1g015012mg                   208   3e-61   Citrus sinensis [apfelsine]
ref|XP_010915646.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    206   3e-61   
ref|XP_009785664.1|  PREDICTED: isocitrate dehydrogenase [NADP]         208   3e-61   Nicotiana sylvestris
ref|XP_006432389.1|  hypothetical protein CICLE_v10001314mg             208   3e-61   
gb|AAD51361.1|AF176669_1  NADP-isocitrate dehydrogenase                 208   3e-61   Citrus limon [lemon]
ref|XP_001778590.1|  predicted protein                                  208   3e-61   
ref|XP_004293807.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    208   3e-61   Fragaria vesca subsp. vesca
ref|XP_009409414.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    207   4e-61   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB43201.1|  hypothetical protein B456_007G188300                    206   4e-61   Gossypium raimondii
gb|KJB43195.1|  hypothetical protein B456_007G188300                    205   4e-61   Gossypium raimondii
ref|XP_011014465.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    208   4e-61   Populus euphratica
gb|KJB81473.1|  hypothetical protein B456_013G147100                    206   4e-61   Gossypium raimondii
dbj|BAE48792.1|  NADP-isocitrate dehydrogenase                          207   5e-61   Codonopsis lanceolata
ref|XP_009631360.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    209   5e-61   
ref|XP_009631361.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    209   5e-61   
ref|XP_001778805.1|  predicted protein                                  207   5e-61   
gb|AAS49171.1|  NADP-dependent isocitrate dehydrogenase                 207   5e-61   Pisum sativum [garden pea]
gb|EMT15199.1|  putative Isocitrate dehydrogenase (NADP), chlorop...    207   5e-61   
dbj|BAJ85136.1|  predicted protein                                      207   5e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008225974.1|  PREDICTED: isocitrate dehydrogenase [NADP]         207   5e-61   Prunus mume [ume]
ref|XP_008783873.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    207   6e-61   Phoenix dactylifera
ref|XP_007211789.1|  hypothetical protein PRUPE_ppa006334mg             207   6e-61   Prunus persica
gb|ACJ11744.1|  Isocitrate dehydrogenase                                207   7e-61   Gossypium hirsutum [American cotton]
gb|KDP35739.1|  hypothetical protein JCGZ_10511                         207   7e-61   Jatropha curcas
ref|XP_004490788.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    207   8e-61   Cicer arietinum [garbanzo]
gb|KJB43199.1|  hypothetical protein B456_007G188300                    206   8e-61   Gossypium raimondii
ref|XP_006352387.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    207   8e-61   Solanum tuberosum [potatoes]
ref|XP_004250238.2|  PREDICTED: isocitrate dehydrogenase [NADP] i...    207   8e-61   Solanum lycopersicum
emb|CDM82394.1|  unnamed protein product                                207   8e-61   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010915645.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    207   9e-61   
gb|AFL48182.1|  isocitrate dehydrogenase                                206   1e-60   Capsicum annuum
ref|XP_010915644.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    206   1e-60   Elaeis guineensis
ref|XP_007031321.1|  Cytosolic NADP+-dependent isocitrate dehydro...    207   1e-60   
gb|AEZ00844.1|  putative isocitrate dehydrogenase protein               206   1e-60   Elaeis guineensis
gb|KJB43200.1|  hypothetical protein B456_007G188300                    206   1e-60   Gossypium raimondii
ref|XP_002891883.1|  hypothetical protein ARALYDRAFT_474695             206   1e-60   
gb|AGV54671.1|  NADPH-specific isocitrate dehydrogenase                 206   1e-60   Phaseolus vulgaris [French bean]
dbj|BAJ90352.1|  predicted protein                                      206   1e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAG84436.1|  NADP-dependent isocitrate dehydrogenase                206   1e-60   Passiflora edulis [passion fruit]
ref|XP_007217240.1|  hypothetical protein PRUPE_ppa006356mg             206   1e-60   
ref|XP_004228607.1|  PREDICTED: isocitrate dehydrogenase [NADP]         206   1e-60   Solanum lycopersicum
ref|XP_010693737.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    206   1e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004488601.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    206   1e-60   Cicer arietinum [garbanzo]
gb|KJB81468.1|  hypothetical protein B456_013G147100                    206   1e-60   Gossypium raimondii
gb|KJB43203.1|  hypothetical protein B456_007G188300                    206   1e-60   Gossypium raimondii
gb|KJB43194.1|  hypothetical protein B456_007G188300                    206   1e-60   Gossypium raimondii
gb|AAL11503.1|AF367443_1  NADP-dependent isocitrate dehydrogenase       206   1e-60   Prunus persica
ref|XP_008227912.1|  PREDICTED: isocitrate dehydrogenase [NADP]         206   1e-60   Prunus mume [ume]
ref|NP_175836.1|  isocitrate dehydrogenase                              206   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008349103.1|  PREDICTED: LOW QUALITY PROTEIN: isocitrate d...    206   1e-60   
ref|XP_007141953.1|  hypothetical protein PHAVU_008G239900g             206   2e-60   Phaseolus vulgaris [French bean]
ref|XP_007149133.1|  hypothetical protein PHAVU_005G043900g             206   2e-60   Phaseolus vulgaris [French bean]
ref|XP_009104137.1|  PREDICTED: peroxisomal isocitrate dehydrogen...    206   2e-60   Brassica rapa
gb|KJB43202.1|  hypothetical protein B456_007G188300                    206   2e-60   Gossypium raimondii
ref|XP_007141952.1|  hypothetical protein PHAVU_008G239900g             206   2e-60   Phaseolus vulgaris [French bean]
gb|AGV54452.1|  NADPH-specific isocitrate dehydrogenase                 206   2e-60   Phaseolus vulgaris [French bean]
ref|XP_004961158.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    206   2e-60   Setaria italica
gb|KHF98695.1|  Isocitrate dehydrogenase [NADP]                         206   2e-60   Gossypium arboreum [tree cotton]
gb|ACN32072.1|  unknown                                                 206   2e-60   Zea mays [maize]
ref|XP_009780820.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    207   2e-60   Nicotiana sylvestris
ref|NP_001140324.1|  isocitrate dehydrogenase2                          206   2e-60   
ref|XP_009780819.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    207   2e-60   Nicotiana sylvestris
ref|NP_001056381.1|  Os05g0573200                                       206   2e-60   
ref|XP_002305928.1|  isocitrate dehydrogenase family protein            206   2e-60   
ref|XP_010062317.1|  PREDICTED: isocitrate dehydrogenase [NADP]         206   2e-60   Eucalyptus grandis [rose gum]
ref|XP_011086317.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    206   3e-60   Sesamum indicum [beniseed]
ref|XP_003616186.1|  Isocitrate dehydrogenase                           205   3e-60   Medicago truncatula
gb|KFK35526.1|  hypothetical protein AALP_AA4G002200                    205   4e-60   Arabis alpina [alpine rockcress]
dbj|BAJ89315.1|  predicted protein                                      205   4e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001042583.1|  Os01g0248400                                       205   4e-60   
ref|XP_006422322.1|  hypothetical protein CICLE_v10005058mg             205   4e-60   Citrus clementina [clementine]
ref|XP_011005927.1|  PREDICTED: isocitrate dehydrogenase [NADP]         205   4e-60   Populus euphratica
gb|KHG15210.1|  Isocitrate dehydrogenase [NADP]                         205   5e-60   Gossypium arboreum [tree cotton]
ref|XP_010470469.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    204   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010415139.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    204   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010511516.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    204   6e-60   Camelina sativa [gold-of-pleasure]
ref|XP_006354121.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    204   6e-60   Solanum tuberosum [potatoes]
sp|P50217.1|IDHC_SOLTU  RecName: Full=Isocitrate dehydrogenase [N...    204   6e-60   Solanum tuberosum [potatoes]
ref|XP_009370567.1|  PREDICTED: isocitrate dehydrogenase [NADP]         204   7e-60   Pyrus x bretschneideri [bai li]
gb|KDO61504.1|  hypothetical protein CISIN_1g040623mg                   205   7e-60   Citrus sinensis [apfelsine]
gb|ADU20197.1|  NADP-dependent isocitric acid dehydrogenase             204   7e-60   Pyrus pyrifolia [sha li]
ref|XP_010553875.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    204   9e-60   Tarenaya hassleriana [spider flower]
ref|XP_010230691.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    204   9e-60   Brachypodium distachyon [annual false brome]
ref|XP_010470465.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    204   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_004309437.1|  PREDICTED: isocitrate dehydrogenase [NADP]         204   1e-59   Fragaria vesca subsp. vesca
emb|CDY39261.1|  BnaC06g27300D                                          203   2e-59   Brassica napus [oilseed rape]
emb|CAA53300.1|  isocitrate dehydrogenase (NADP+)                       204   2e-59   Solanum tuberosum [potatoes]
ref|XP_009367131.1|  PREDICTED: isocitrate dehydrogenase [NADP]         203   2e-59   Pyrus x bretschneideri [bai li]
emb|CDY07472.1|  BnaA07g25510D                                          203   2e-59   Brassica napus [oilseed rape]
ref|XP_011012153.1|  PREDICTED: isocitrate dehydrogenase [NADP]-l...    203   2e-59   Populus euphratica
ref|NP_001130558.1|  uncharacterized protein LOC100191657               203   2e-59   Zea mays [maize]
gb|AAM65674.1|  isocitrate dehydrogenase, putative                      202   3e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CAD24782.1|  isocitrate dehydrogenase                               202   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009127460.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    202   3e-59   Brassica rapa
ref|NP_176768.1|  NADP+-dependent isocitrate dehydrogenase              202   4e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13090.1|  similar to NADP-specific isocitrate dehydrogenase       202   4e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302327.1|  hypothetical protein CARUB_v10020383mg             202   4e-59   Capsella rubella
ref|XP_009105173.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    202   4e-59   Brassica rapa
ref|XP_002886987.1|  hypothetical protein ARALYDRAFT_475696             202   4e-59   
emb|CDY20354.1|  BnaC02g24620D                                          202   5e-59   Brassica napus [oilseed rape]
ref|XP_009124158.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    202   6e-59   Brassica rapa
gb|KDO55218.1|  hypothetical protein CISIN_1g0090411mg                  198   8e-59   Citrus sinensis [apfelsine]
ref|XP_006654817.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    201   8e-59   Oryza brachyantha
ref|XP_006643991.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    201   9e-59   Oryza brachyantha
ref|XP_006391328.1|  hypothetical protein EUTSA_v10018635mg             197   2e-58   
emb|CDY60868.1|  BnaCnng36970D                                          201   2e-58   Brassica napus [oilseed rape]
gb|KDO55216.1|  hypothetical protein CISIN_1g0090411mg                  199   5e-58   Citrus sinensis [apfelsine]
gb|KDO55215.1|  hypothetical protein CISIN_1g0090411mg                  199   5e-58   
ref|XP_009368602.1|  PREDICTED: isocitrate dehydrogenase [NADP]-like    193   5e-58   
ref|XP_006391329.1|  hypothetical protein EUTSA_v10018635mg             199   6e-58   
gb|KDO55217.1|  hypothetical protein CISIN_1g0090411mg                  199   7e-58   
ref|XP_006653587.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    201   7e-58   
ref|WP_026326986.1|  isocitrate dehydrogenase                           198   1e-57   
gb|KDO55214.1|  hypothetical protein CISIN_1g0090411mg                  199   2e-57   
ref|WP_035354144.1|  isocitrate dehydrogenase                           197   2e-57   
ref|WP_003629065.1|  isocitrate dehydrogenase                           197   2e-57   
ref|XP_002268982.1|  PREDICTED: isocitrate dehydrogenase [NADP]         198   2e-57   
ref|WP_003622491.1|  isocitrate dehydrogenase                           197   2e-57   
gb|AGO09969.1|  AaceriAAL022Wp                                          197   3e-57   
ref|NP_982520.1|  AAL022Wp                                              197   3e-57   
ref|WP_012812609.1|  isocitrate dehydrogenase                           197   3e-57   
ref|WP_031448165.1|  isocitrate dehydrogenase                           197   3e-57   
ref|WP_025309346.1|  isocitrate dehydrogenase                           197   3e-57   
gb|EGE47400.1|  Isocitrate dehydrogenase                                197   3e-57   
gb|EMS50043.1|  Isocitrate dehydrogenase [NADP], chloroplastic          197   3e-57   
ref|WP_020944600.1|  isocitrate dehydrogenase, NADP-dependent           197   4e-57   
gb|AAD55056.1|  isocitrate dehydrogenase                                192   5e-57   
ref|WP_029311658.1|  isocitrate dehydrogenase                           196   6e-57   
ref|XP_001901252.1|  isocitrate dehydrogenase                           189   6e-57   
emb|CDH51698.1|  isocitrate dehydrogenase                               196   8e-57   
emb|CDS04902.1|  Putative Isocitrate dehydrogenase                      196   9e-57   
ref|WP_042788668.1|  isocitrate dehydrogenase                           196   1e-56   
ref|WP_019089822.1|  isocitrate dehydrogenase                           196   1e-56   
ref|WP_012111501.1|  isocitrate dehydrogenase                           195   1e-56   
emb|CBY42168.1|  unnamed protein product                                196   2e-56   
ref|WP_014101919.1|  isocitrate dehydrogenase                           195   2e-56   
ref|WP_015466729.1|  Isocitrate dehydrogenase [NADP]                    195   3e-56   
emb|CEA16418.1|  Isocitrate dehydrogenase [NADP]                        195   3e-56   
emb|CDS05850.1|  Putative Isocitrate dehydrogenase                      196   3e-56   
ref|WP_029638909.1|  isocitrate dehydrogenase                           194   4e-56   
ref|WP_016776139.1|  isocitrate dehydrogenase                           194   4e-56   
ref|WP_010418844.1|  isocitrate dehydrogenase                           194   4e-56   
ref|XP_011097423.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    194   4e-56   
emb|CDH57071.1|  isocitrate dehydrogenase                               194   7e-56   
emb|CDH56616.1|  isocitrate dehydrogenase                               194   8e-56   
ref|XP_002163048.2|  PREDICTED: isocitrate dehydrogenase [NADP], ...    194   8e-56   
dbj|GAA07465.1|  isocitrate dehydrogenase                               194   1e-55   
ref|XP_002124548.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    194   1e-55   
emb|CEG66300.1|  Putative Isocitrate dehydrogenase [NADP]               194   1e-55   
gb|ADD38654.1|  Isocitrate dehydrogenase, mitochondrial                 194   1e-55   
ref|WP_037015284.1|  isocitrate dehydrogenase                           193   1e-55   
ref|WP_041873822.1|  isocitrate dehydrogenase                           193   1e-55   
ref|WP_007423101.1|  MULTISPECIES: isocitrate dehydrogenase             193   1e-55   
gb|EJW84436.1|  isocitrate dehydrogenase                                191   1e-55   
ref|WP_039903374.1|  isocitrate dehydrogenase                           192   2e-55   
ref|WP_019401689.1|  isocitrate dehydrogenase                           192   2e-55   
emb|CEG78961.1|  Putative Isocitrate dehydrogenase [NADP]               189   2e-55   
dbj|GAN00656.1|  isocitrate dehydrogenase                               192   2e-55   
emb|CEP10715.1|  hypothetical protein                                   192   2e-55   
gb|KDN50061.1|  hypothetical protein RSAG8_01397                        191   3e-55   
ref|WP_036358096.1|  isocitrate dehydrogenase                           192   3e-55   
emb|CDO77728.1|  hypothetical protein BN946_scf184969.g79               192   3e-55   
ref|XP_005971542.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    192   3e-55   
ref|XP_006574401.1|  PREDICTED: uncharacterized protein LOC100786...    192   4e-55   
gb|EAY99113.1|  hypothetical protein OsI_21072                          192   4e-55   
ref|WP_006843862.1|  isocitrate dehydrogenase                           192   4e-55   
emb|CDR37049.1|  CYFA0S01e06788g1_1                                     192   5e-55   
ref|XP_011457662.1|  PREDICTED: cytosolic isocitrate dehydrogenas...    190   5e-55   
ref|WP_027132674.1|  isocitrate dehydrogenase                           191   5e-55   
ref|WP_002729399.1|  isocitrate dehydrogenase                           191   5e-55   
ref|WP_010528150.1|  isocitrate dehydrogenase                           191   6e-55   
emb|CDS08807.1|  Putative Isocitrate dehydrogenase                      191   6e-55   
ref|WP_010667410.1|  isocitrate dehydrogenase                           191   6e-55   
emb|CCA77827.1|  probable isocitrate dehydrogenase [NADP] precursor     192   6e-55   
ref|WP_025860989.1|  isocitrate dehydrogenase                           191   6e-55   
ref|WP_042691261.1|  isocitrate dehydrogenase                           188   7e-55   
ref|XP_002556390.1|  KLTH0H12012p                                       191   7e-55   
ref|XP_008381384.1|  PREDICTED: isocitrate dehydrogenase [NADP]         191   8e-55   
emb|CDJ41182.1|  Isocitrate dehydrogenase [NADP] , related              187   1e-54   
emb|CDO95882.1|  unnamed protein product                                191   1e-54   
ref|WP_018342570.1|  isocitrate dehydrogenase                           191   1e-54   
dbj|GAL98306.1|  isocitrate dehydrogenase                               191   1e-54   
ref|WP_035378026.1|  isocitrate dehydrogenase                           191   1e-54   
ref|XP_003959128.1|  hypothetical protein KAFR_0I02130                  191   1e-54   
ref|WP_026475623.1|  isocitrate dehydrogenase                           191   1e-54   
gb|EIE89109.1|  isocitrate dehydrogenase [NADP]                         191   1e-54   
ref|XP_004830955.1|  isocitrate dehydrogenase, putative                 192   1e-54   
gb|EEC70311.1|  hypothetical protein OsI_01162                          191   1e-54   
ref|WP_043551875.1|  isocitrate dehydrogenase                           190   1e-54   
ref|WP_011166031.1|  isocitrate dehydrogenase                           190   1e-54   
ref|WP_036350640.1|  isocitrate dehydrogenase                           190   1e-54   
ref|WP_011584616.1|  isocitrate dehydrogenase                           190   1e-54   
ref|WP_008944825.1|  isocitrate dehydrogenase                           190   1e-54   
gb|EKD02703.1|  isocitrate dehydrogenase (NADP+)                        191   1e-54   
ref|WP_009494151.1|  isocitrate dehydrogenase                           190   1e-54   
gb|ABK25438.1|  unknown                                                 190   2e-54   
ref|WP_011383051.1|  isocitrate dehydrogenase                           190   2e-54   
ref|XP_004346514.1|  isocitrate dehydrogenase Idp1, putative            184   2e-54   
ref|WP_036639842.1|  isocitrate dehydrogenase                           190   2e-54   
ref|XP_005707627.1|  isocitrate dehydrogenase, NADP dependent           191   2e-54   
gb|KIM25436.1|  hypothetical protein M408DRAFT_331189                   191   2e-54   
ref|WP_041620265.1|  isocitrate dehydrogenase                           190   2e-54   
gb|KIW08750.1|  isocitrate dehydrogenase [NADP], mitochondrial          191   2e-54   
gb|ADQ79193.1|  isocitrate dehydrogenase (NADP)                         190   2e-54   
gb|KIO31652.1|  hypothetical protein M407DRAFT_19391                    191   2e-54   
ref|WP_027315619.1|  isocitrate dehydrogenase                           190   2e-54   
ref|XP_005885262.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    191   2e-54   
gb|EJU04561.1|  isocitrate dehydrogenase                                190   2e-54   
ref|XP_006392554.1|  hypothetical protein EUTSA_v10012325mg             191   2e-54   
ref|XP_003958861.1|  hypothetical protein KAFR_0H03160                  190   3e-54   
ref|WP_003619402.1|  isocitrate dehydrogenase                           189   3e-54   
gb|AJQ30121.1|  isocitrate dehydrogenase 2                              190   3e-54   
ref|WP_026397507.1|  isocitrate dehydrogenase                           189   3e-54   
emb|CDQ02452.1|  Protein BM-IDH-2, isoform a                            189   3e-54   
ref|WP_020695356.1|  isocitrate dehydrogenase                           189   3e-54   
ref|WP_007397524.1|  MULTISPECIES: isocitrate dehydrogenase             189   3e-54   
gb|EJT51777.1|  isocitrate dehydrogenase (NADP+)                        191   3e-54   
ref|XP_004036662.1|  nadp-specific isocitrate dehydrogenase, puta...    190   3e-54   
emb|CDQ02451.1|  Protein BM-IDH-2, isoform b                            190   3e-54   
ref|WP_029014634.1|  isocitrate dehydrogenase                           189   4e-54   
ref|WP_014105464.1|  isocitrate dehydrogenase                           189   4e-54   
ref|XP_006540975.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    184   4e-54   
ref|WP_009871035.1|  COG0538: Isocitrate dehydrogenases                 189   4e-54   
ref|XP_002644007.1|  Hypothetical protein CBG17397                      190   4e-54   
ref|WP_006801662.1|  isocitrate dehydrogenase                           189   4e-54   
ref|WP_021696197.1|  isocitrate dehydrogenase [NADP]                    189   4e-54   
ref|WP_021130624.1|  isocitrate dehydrogenase                           189   4e-54   
ref|WP_004622786.1|  isocitrate dehydrogenase (NADP)                    189   5e-54   
ref|XP_008043356.1|  isocitrate dehydrogenase                           190   5e-54   
ref|WP_010515252.1|  isocitrate dehydrogenase                           189   5e-54   
ref|XP_008362528.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    188   5e-54   
gb|EPB92750.1|  isocitrate dehydrogenase [NADP], mitochondrial          189   5e-54   
ref|WP_010508687.1|  isocitrate dehydrogenase                           189   5e-54   
ref|WP_015398128.1|  isocitrate dehydrogenase                           189   5e-54   
ref|WP_039732457.1|  isocitrate dehydrogenase                           189   5e-54   
ref|WP_014247978.1|  isocitrate dehydrogenase                           189   5e-54   
ref|WP_015494738.1|  isocitrate dehydrogenase2 (NADP)                   189   5e-54   
ref|WP_025437327.1|  isocitrate dehydrogenase                           189   5e-54   
dbj|GAK44713.1|  isocitrate dehydrogenase                               189   6e-54   
ref|WP_042672317.1|  isocitrate dehydrogenase                           182   6e-54   
ref|WP_029086543.1|  isocitrate dehydrogenase                           189   6e-54   
ref|WP_039000813.1|  isocitrate dehydrogenase                           188   6e-54   
ref|XP_005962778.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    188   6e-54   
ref|WP_013078352.1|  isocitrate dehydrogenase                           189   6e-54   
ref|WP_025829415.1|  isocitrate dehydrogenase                           188   6e-54   
ref|XP_002776759.1|  isocitrate dehydrogenase, putative                 189   7e-54   
gb|EIF47929.1|  isocitrate dehydrogenase                                180   7e-54   
ref|XP_002784050.1|  isocitrate dehydrogenase, putative                 189   7e-54   
ref|XP_007395085.1|  hypothetical protein PHACADRAFT_254949             189   7e-54   
emb|CDJ65052.1|  Isocitrate dehydrogenase [NADP] , related              185   8e-54   
ref|WP_025813109.1|  isocitrate dehydrogenase                           188   8e-54   
dbj|BAO39444.1|  isocitrate dehydrogenase [NADP] cytoplasmic            188   8e-54   
ref|WP_020177617.1|  isocitrate dehydrogenase                           188   8e-54   
ref|WP_012974296.1|  isocitrate dehydrogenase                           188   8e-54   
gb|ESW99650.1|  Isocitrate dehydrogenase [NADP], mitochondrial          189   8e-54   
dbj|BAP70942.1|  isocitrate dehydrogenase [NADP] cytoplasmic            188   9e-54   
ref|WP_011749235.1|  isocitrate dehydrogenase                           188   9e-54   
ref|WP_012553597.1|  isocitrate dehydrogenase                           188   9e-54   
ref|WP_012223716.1|  isocitrate dehydrogenase                           188   9e-54   
ref|XP_001943698.1|  PREDICTED: isocitrate dehydrogenase [NADP] c...    189   9e-54   
ref|WP_010664092.1|  isocitrate dehydrogenase                           188   9e-54   
ref|WP_021097110.1|  isocitrate dehydrogenase (NADP)                    188   1e-53   
ref|WP_015092690.1|  isocitrate dehydrogenase                           188   1e-53   
ref|XP_007262628.1|  isocitrate dehydrogenase                           188   1e-53   
ref|WP_029416955.1|  isocitrate dehydrogenase                           188   1e-53   
ref|WP_011646195.1|  MULTISPECIES: isocitrate dehydrogenase             188   1e-53   
emb|CEL57816.1|  isocitrate dehydrogenase                               189   1e-53   
ref|WP_027839860.1|  isocitrate dehydrogenase                           187   1e-53   
ref|WP_011963977.1|  isocitrate dehydrogenase                           187   1e-53   
ref|WP_035083395.1|  isocitrate dehydrogenase                           187   2e-53   
ref|WP_028467411.1|  isocitrate dehydrogenase                           187   2e-53   
ref|WP_019221677.1|  isocitrate dehydrogenase                           187   2e-53   
ref|XP_009265801.1|  hypothetical protein J056_000128                   188   2e-53   
emb|CEI97135.1|  Putative Isocitrate dehydrogenase [NADP]               188   2e-53   
ref|WP_004861971.1|  isocitrate dehydrogenase                           187   2e-53   
ref|XP_004032348.1|  isocitrate dehydrogenase, putative                 187   2e-53   
ref|WP_014678688.1|  isocitrate dehydrogenase                           187   2e-53   
ref|WP_039723625.1|  isocitrate dehydrogenase                           178   2e-53   
ref|XP_002776758.1|  isocitrate dehydrogenase, putative                 187   2e-53   
ref|WP_018148222.1|  isocitrate dehydrogenase                           187   2e-53   
ref|WP_003166034.1|  isocitrate dehydrogenase                           187   2e-53   
emb|CDW76063.1|  isocitrate dehydrogenase                               187   2e-53   
ref|WP_017506659.1|  isocitrate dehydrogenase                           187   2e-53   
gb|KIK61499.1|  hypothetical protein GYMLUDRAFT_73423                   188   2e-53   
ref|WP_027301785.1|  isocitrate dehydrogenase                           187   2e-53   
ref|WP_024848736.1|  isocitrate dehydrogenase                           187   2e-53   
ref|WP_008620829.1|  isocitrate dehydrogenase                           187   2e-53   
ref|WP_039246750.1|  isocitrate dehydrogenase                           187   2e-53   
gb|EKE17623.1|  hypothetical protein ACD_10C00363G0002                  187   2e-53   
ref|WP_037095643.1|  isocitrate dehydrogenase                           187   2e-53   
ref|WP_005865147.1|  isocitrate dehydrogenase                           187   2e-53   
gb|KFG50110.1|  isocitrate dehydrogenase                                186   2e-53   
ref|WP_010705146.1|  isocitrate dehydrogenase                           187   3e-53   
gb|KJF42679.1|  isocitrate dehydrogenase                                187   3e-53   
gb|KHN84378.1|  Isocitrate dehydrogenase [NADP], mitochondrial          188   3e-53   
ref|WP_038559471.1|  isocitrate dehydrogenase                           187   3e-53   
ref|WP_015399150.1|  isocitrate dehydrogenase                           187   3e-53   
ref|WP_009541420.1|  Isocitrate dehydrogenase                           187   3e-53   
ref|WP_029915390.1|  isocitrate dehydrogenase                           187   3e-53   
ref|WP_006924664.1|  isocitrate dehydrogenase                           187   3e-53   
ref|WP_022719665.1|  isocitrate dehydrogenase                           187   3e-53   
ref|XP_003644361.1|  hypothetical protein Ecym_1306                     187   3e-53   
ref|WP_024585765.1|  isocitrate dehydrogenase                           187   3e-53   
gb|AIJ37423.1|  Isocitrate dehydrogenase [NADP]                         187   3e-53   
ref|WP_006925178.1|  isocitrate dehydrogenase                           186   3e-53   
ref|WP_029029257.1|  isocitrate dehydrogenase                           186   3e-53   
ref|XP_003671104.2|  hypothetical protein NDAI_0G00850                  187   3e-53   
ref|XP_005851119.1|  hypothetical protein CHLNCDRAFT_55969              188   4e-53   
dbj|GAM18756.1|  hypothetical protein SAMD00019534_019310               187   4e-53   
ref|WP_035071038.1|  isocitrate dehydrogenase                           186   4e-53   
ref|WP_028040028.1|  isocitrate dehydrogenase                           186   4e-53   
gb|KDR77167.1|  hypothetical protein GALMADRAFT_246407                  188   4e-53   
ref|WP_010920379.1|  isocitrate dehydrogenase                           186   4e-53   
ref|WP_009360421.1|  isocitrate dehydrogenase                           186   4e-53   
ref|WP_040290692.1|  isocitrate dehydrogenase                           186   4e-53   
ref|WP_035044550.1|  isocitrate dehydrogenase                           186   4e-53   
ref|WP_012287551.1|  isocitrate dehydrogenase                           186   4e-53   
ref|WP_008493047.1|  isocitrate dehydrogenase                           186   4e-53   
ref|XP_004468953.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    187   4e-53   
ref|XP_006958425.1|  isocitrate dehydrogenase NADP-dependent            187   4e-53   
ref|WP_014085366.1|  isocitrate dehydrogenase                           186   4e-53   
ref|XP_006540974.1|  PREDICTED: isocitrate dehydrogenase [NADP], ...    184   5e-53   
ref|WP_041693481.1|  isocitrate dehydrogenase                           186   5e-53   
ref|WP_025199040.1|  hypothetical protein                               180   5e-53   
emb|CCE43346.1|  hypothetical protein CPAR2_209910                      186   5e-53   
ref|WP_035600860.1|  isocitrate dehydrogenase                           186   5e-53   
gb|EHM02138.1|  isocitrate dehydrogenase, NADP-dependent                187   5e-53   
ref|XP_004250239.1|  PREDICTED: isocitrate dehydrogenase [NADP] i...    186   5e-53   



>emb|CDP02088.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 147/178 (83%), Gaps = 11/178 (6%)
 Frame = +3

Query  102  TSSPKLF-KEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDE  278
             + PKLF +++   NRLS P  LP  S+RCFAST++   P  T DKI+VQNPIVEMDGDE
Sbjct  28   ATDPKLFNQQLLLNNRLSLPATLPAVSLRCFASTST---PTATMDKIKVQNPIVEMDGDE  84

Query  279  MTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATIT  458
            M RVIW MIK+KLIFP+LELDIKY+DLGILNRDATDD+VT+ESAEATLKYNVA+KCATIT
Sbjct  85   MARVIWKMIKDKLIFPYLELDIKYFDLGILNRDATDDRVTVESAEATLKYNVAVKCATIT  144

Query  459  PDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            PDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPI+C+        +++   +GR+ F
Sbjct  145  PDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPIICQNIPRIVPGWKKPICIGRHAF  202



>ref|XP_011097422.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Sesamum 
indicum]
Length=483

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 135/154 (88%), Gaps = 7/154 (5%)
 Frame = +3

Query  111  PKLFKEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRV  290
            P+L  E+F   RLS  TR PNASIRCFA+ A+        +K+RVQNP+VEMDGDEMTRV
Sbjct  39   PQLSGEMFLGKRLSLSTRFPNASIRCFAAAAA-------NEKVRVQNPVVEMDGDEMTRV  91

Query  291  IWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDET  470
            IW MIK+KLIFPH+ELDIKY+DLGILNRDATDDKVT+ESAEA LKYNVAIKCATITPDE+
Sbjct  92   IWKMIKDKLIFPHVELDIKYFDLGILNRDATDDKVTVESAEAALKYNVAIKCATITPDES  151

Query  471  RVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            RVKEFGLK+MW+SPNGTIRNILNGTVFREPILC+
Sbjct  152  RVKEFGLKAMWRSPNGTIRNILNGTVFREPILCR  185



>ref|XP_009768205.1| PREDICTED: isocitrate dehydrogenase [NADP] [Nicotiana sylvestris]
Length=482

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 144/176 (82%), Gaps = 14/176 (8%)
 Frame = +3

Query  105  SSPKLFKEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMT  284
            S P +     F++R+  P R+PNASIRCFAST + +       KIRV+NPIVEMDGDEMT
Sbjct  36   SFPTISNRQLFKSRVYLPHRIPNASIRCFASTTASS-------KIRVENPIVEMDGDEMT  88

Query  285  RVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPD  464
            RVIWTMIK+KLI+P+LELD KYYDLGILNRDATDD+VT+ESAEATLKYNVA+KCATITPD
Sbjct  89   RVIWTMIKDKLIYPYLELDTKYYDLGILNRDATDDQVTVESAEATLKYNVAVKCATITPD  148

Query  465  ETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            ETRVKEFGLKSMW+SPNGTIRNILNGTVFREPILCK        +++   +GR+ F
Sbjct  149  ETRVKEFGLKSMWRSPNGTIRNILNGTVFREPILCKNVPRIVPGWKKPICIGRHAF  204



>ref|NP_001275253.1| isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
[Solanum tuberosum]
 emb|CAA63220.1| isocitrate dehydrogenase (NAD+) [Solanum tuberosum]
Length=470

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 132/146 (90%), Gaps = 6/146 (4%)
 Frame = +3

Query  132  FFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKE  311
             F +R+S  TR+PNASIRCFAS++  T+      KIRVQNPIVEMDGDEMTRVIW MIK+
Sbjct  33   LFNSRVSLTTRIPNASIRCFASSSGPTS------KIRVQNPIVEMDGDEMTRVIWKMIKD  86

Query  312  KLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGL  491
            KLI+P+LELD KYYDLGILNRDATDD+VT+ESAEATLKYNVA+KCATITPDETRVKEFGL
Sbjct  87   KLIYPYLELDTKYYDLGILNRDATDDQVTVESAEATLKYNVAVKCATITPDETRVKEFGL  146

Query  492  KSMWKSPNGTIRNILNGTVFREPILC  569
            KSMWKSPNGTIRNILNGTVFREPILC
Sbjct  147  KSMWKSPNGTIRNILNGTVFREPILC  172



>gb|EYU34732.1| hypothetical protein MIMGU_mgv1a005695mg [Erythranthe guttata]
Length=474

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 143/178 (80%), Gaps = 13/178 (7%)
 Frame = +3

Query  99   ITSSPKLFKEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDE  278
            I  +PKL  ++F  NRLS  TR  N S+RCFA+ A+  AP    +K+RVQ+PIVEMDGDE
Sbjct  25   IPHNPKLSSDIFCSNRLSLSTRFSNGSVRCFAAVAA--AP----EKVRVQSPIVEMDGDE  78

Query  279  MTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATIT  458
            MTRVIW MIK+KLIFPHLELDIKY+DLG+LNRDATDDKVT+ESAEA L+YNVAIKCATIT
Sbjct  79   MTRVIWKMIKDKLIFPHLELDIKYFDLGVLNRDATDDKVTVESAEAALEYNVAIKCATIT  138

Query  459  PDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-------FLVGRNPF  611
            PDE RVKEFGLK+MW+SPNGTIRNILNGTVFREPILC+    L         +GR+ F
Sbjct  139  PDEARVKEFGLKNMWRSPNGTIRNILNGTVFREPILCQNIPRLVPGWKKPICIGRHAF  196



>ref|XP_004232313.1| PREDICTED: isocitrate dehydrogenase [NADP] [Solanum lycopersicum]
Length=483

 Score =   253 bits (645),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 131/146 (90%), Gaps = 6/146 (4%)
 Frame = +3

Query  132  FFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKE  311
             F NR+S  TR+PNASIRCFAST+  T+      KI VQNPIVEMDGDEMTRVIW MIK+
Sbjct  45   LFNNRVSLTTRIPNASIRCFASTSGPTS------KILVQNPIVEMDGDEMTRVIWKMIKD  98

Query  312  KLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGL  491
            KLI+P+LELD KYYDLGILNRDATDD+VT+ESAEATLKYNVA+KCATITPDETRVKEFGL
Sbjct  99   KLIYPYLELDTKYYDLGILNRDATDDQVTVESAEATLKYNVAVKCATITPDETRVKEFGL  158

Query  492  KSMWKSPNGTIRNILNGTVFREPILC  569
            KSMWKSPNGTIRNILNGTVFREPILC
Sbjct  159  KSMWKSPNGTIRNILNGTVFREPILC  184



>ref|XP_009625432.1| PREDICTED: isocitrate dehydrogenase [NADP] [Nicotiana tomentosiformis]
Length=482

 Score =   250 bits (639),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 138/167 (83%), Gaps = 14/167 (8%)
 Frame = +3

Query  132  FFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKE  311
             F  R+  P R+PNASIRCFAST + +       KIRV+NPIVEMDGDEMTRVIWTMIK+
Sbjct  45   LFNIRVYLPHRIPNASIRCFASTTASS-------KIRVENPIVEMDGDEMTRVIWTMIKD  97

Query  312  KLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGL  491
            KLI+P+LELD KYYDLGILNRDATDD+VT+ESAEA LKYNVA+KCATITPDETRVKEFGL
Sbjct  98   KLIYPYLELDTKYYDLGILNRDATDDQVTVESAEAALKYNVAVKCATITPDETRVKEFGL  157

Query  492  KSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            KSMW+SPNGTIRNILNGTVFREPILCK        +++   +GR+ F
Sbjct  158  KSMWRSPNGTIRNILNGTVFREPILCKNVPRIVPGWKKPICIGRHAF  204



>ref|XP_007215326.1| hypothetical protein PRUPE_ppa005200mg [Prunus persica]
 gb|EMJ16525.1| hypothetical protein PRUPE_ppa005200mg [Prunus persica]
Length=472

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 141/178 (79%), Gaps = 14/178 (8%)
 Frame = +3

Query  99   ITSSPKLFKEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDE  278
             +SSP+LF  V   NR+S   R  + S+RC+AS+          DKIRVQNPIVEMDGDE
Sbjct  24   FSSSPRLFNGVPVGNRVSFSVRFSHTSLRCYASSPG-------LDKIRVQNPIVEMDGDE  76

Query  279  MTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATIT  458
            MTR+IW  IK+KLIFPHL+LDIKYYDLGILNRDATDD+VT+ESAEA LKYNVA+KCATIT
Sbjct  77   MTRIIWKTIKDKLIFPHLDLDIKYYDLGILNRDATDDRVTVESAEAALKYNVAVKCATIT  136

Query  459  PDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            PDETRVKEFGLKSMW+SPNGTIRNILNGTVFREPILC+        +++   +GR+ F
Sbjct  137  PDETRVKEFGLKSMWRSPNGTIRNILNGTVFREPILCRNIPRIVPGWKKPICIGRHAF  194



>ref|XP_009334109.1| PREDICTED: isocitrate dehydrogenase [NADP] [Pyrus x bretschneideri]
Length=484

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 143/178 (80%), Gaps = 14/178 (8%)
 Frame = +3

Query  99   ITSSPKLFKEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDE  278
             +SSP+LF  V   NR+S   R    S+RC+AS+A         DK+RVQNPIVEMDGDE
Sbjct  36   FSSSPRLFNGVPLGNRVSFAARFRRTSLRCYASSAGF-------DKVRVQNPIVEMDGDE  88

Query  279  MTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATIT  458
            MTR+IWT IK+KLIFP+L+LDIKYYDLGILNR+ATDD+VTIESAEATLKYNVA+KCATIT
Sbjct  89   MTRIIWTTIKDKLIFPYLDLDIKYYDLGILNREATDDRVTIESAEATLKYNVAVKCATIT  148

Query  459  PDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            PDETRVKEFGLKSMW+SPNGTIRNIL+GTVFREPILCK        +++   +GR+ F
Sbjct  149  PDETRVKEFGLKSMWRSPNGTIRNILDGTVFREPILCKNIPRIVAGWKKPICIGRHAF  206



>emb|CAA65504.1| isocitrate dehydrogenase (NADP+) [Nicotiana tabacum]
Length=470

 Score =   248 bits (632),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 138/167 (83%), Gaps = 14/167 (8%)
 Frame = +3

Query  132  FFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKE  311
             F+NR+    R+PNASIR FAST + +       KIRV+NPIVEMDGDEMTRVIWTMIKE
Sbjct  33   LFKNRVYLLHRIPNASIRSFASTTASS-------KIRVENPIVEMDGDEMTRVIWTMIKE  85

Query  312  KLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGL  491
            KLI+P+LELD KYYDLGILNRDATDD+VT+ESAEATLKYNVA+KCATITPDETRVKEFGL
Sbjct  86   KLIYPYLELDTKYYDLGILNRDATDDQVTVESAEATLKYNVAVKCATITPDETRVKEFGL  145

Query  492  KSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            KSMW+SPN TIRNILNGTVFREPILCK        +++   +GR+ F
Sbjct  146  KSMWRSPNATIRNILNGTVFREPILCKNVPRIVPGWKKPICIGRHAF  192



>ref|XP_008230571.1| PREDICTED: isocitrate dehydrogenase [NADP] [Prunus mume]
Length=482

 Score =   248 bits (632),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 141/178 (79%), Gaps = 14/178 (8%)
 Frame = +3

Query  99   ITSSPKLFKEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDE  278
             +SSP+LF  V   NR+S   R  + S+RC+AS+          DKIRVQNPIVEMDGDE
Sbjct  34   FSSSPRLFNGVPAGNRVSFSVRFSHTSLRCYASSPGF-------DKIRVQNPIVEMDGDE  86

Query  279  MTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATIT  458
            MTR+IW  IK+KLIFPHL+LDIKYYDLGILNRDATDD+VT+ESAEA LKYNVA+KCATIT
Sbjct  87   MTRIIWKTIKDKLIFPHLDLDIKYYDLGILNRDATDDRVTVESAEAALKYNVAVKCATIT  146

Query  459  PDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            PDETRVKEFGLKSMW+SPNGTIRNILNGTVFREPILC+        +++   +GR+ F
Sbjct  147  PDETRVKEFGLKSMWRSPNGTIRNILNGTVFREPILCRNIPRIVPGWKKPICIGRHAF  204



>emb|CAA65503.1| isocitrate dehydrogenase (NADP+) [Nicotiana tabacum]
Length=482

 Score =   248 bits (632),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 138/167 (83%), Gaps = 14/167 (8%)
 Frame = +3

Query  132  FFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKE  311
             F+NR+    R+PNASIR FAST + +       KIRV+NPIVEMDGDEMTRVIWTMIKE
Sbjct  45   LFKNRVYLLHRIPNASIRSFASTTASS-------KIRVENPIVEMDGDEMTRVIWTMIKE  97

Query  312  KLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGL  491
            KLI+P+LELD KYYDLGILNRDATDD+VT+ESAEATLKYNVA+KCATITPDETRVKEFGL
Sbjct  98   KLIYPYLELDTKYYDLGILNRDATDDQVTVESAEATLKYNVAVKCATITPDETRVKEFGL  157

Query  492  KSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            KSMW+SPN TIRNILNGTVFREPILCK        +++   +GR+ F
Sbjct  158  KSMWRSPNATIRNILNGTVFREPILCKNVPRIVPGWKKPICIGRHAF  204



>emb|CAN74293.1| hypothetical protein VITISV_015982 [Vitis vinifera]
Length=486

 Score =   248 bits (632),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 133/157 (85%), Gaps = 7/157 (4%)
 Frame = +3

Query  99   ITSSPKLFKEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDE  278
            I+S  + F  + F+N  +   R PNAS+RCFAS A       T D++RVQNPIVEMDGDE
Sbjct  22   ISSDQRFFNGILFKNGSTLHDRFPNASLRCFASAA-------TFDRVRVQNPIVEMDGDE  74

Query  279  MTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATIT  458
            M R++W MIK+KLIFP+L+LDI+Y+DLGILNRDATDDKVT+ESAEATLKYNVA+KCATIT
Sbjct  75   MARIMWRMIKDKLIFPYLDLDIRYFDLGILNRDATDDKVTVESAEATLKYNVAVKCATIT  134

Query  459  PDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILC  569
            PDE RVKEFGLKSMW+SPNGTIRNILNGTVFREPILC
Sbjct  135  PDEARVKEFGLKSMWRSPNGTIRNILNGTVFREPILC  171



>ref|XP_002276200.2| PREDICTED: isocitrate dehydrogenase [NADP] [Vitis vinifera]
Length=486

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 133/158 (84%), Gaps = 7/158 (4%)
 Frame = +3

Query  99   ITSSPKLFKEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDE  278
            I+S  + F  + F+N      R PNAS+RCFAS A       T D++RVQNPIVEMDGDE
Sbjct  35   ISSDQRFFNGILFKNGSILHDRFPNASLRCFASAA-------TFDRVRVQNPIVEMDGDE  87

Query  279  MTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATIT  458
            M R++W MIK+KLIFP+L+LDI+Y+DLGILNRDATDDKVT+ESAEATLKYNVA+KCATIT
Sbjct  88   MARIMWRMIKDKLIFPYLDLDIRYFDLGILNRDATDDKVTVESAEATLKYNVAVKCATIT  147

Query  459  PDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            PDE RVKEFGLKSMW+SPNGTIRNILNGTVFREPILC+
Sbjct  148  PDEARVKEFGLKSMWRSPNGTIRNILNGTVFREPILCQ  185



>emb|CBI34891.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   246 bits (629),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 133/158 (84%), Gaps = 7/158 (4%)
 Frame = +3

Query  99   ITSSPKLFKEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDE  278
            I+S  + F  + F+N      R PNAS+RCFAS A       T D++RVQNPIVEMDGDE
Sbjct  89   ISSDQRFFNGILFKNGSILHDRFPNASLRCFASAA-------TFDRVRVQNPIVEMDGDE  141

Query  279  MTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATIT  458
            M R++W MIK+KLIFP+L+LDI+Y+DLGILNRDATDDKVT+ESAEATLKYNVA+KCATIT
Sbjct  142  MARIMWRMIKDKLIFPYLDLDIRYFDLGILNRDATDDKVTVESAEATLKYNVAVKCATIT  201

Query  459  PDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            PDE RVKEFGLKSMW+SPNGTIRNILNGTVFREPILC+
Sbjct  202  PDEARVKEFGLKSMWRSPNGTIRNILNGTVFREPILCQ  239



>ref|XP_008379224.1| PREDICTED: isocitrate dehydrogenase [NADP] [Malus domestica]
Length=484

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 141/178 (79%), Gaps = 14/178 (8%)
 Frame = +3

Query  99   ITSSPKLFKEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDE  278
             +SSP+LF  V   NR+S      + S+RC+AS+A         DK+RVQNPIVEMDGDE
Sbjct  36   FSSSPRLFNGVPLGNRVSFSAGFRSTSLRCYASSAG-------FDKVRVQNPIVEMDGDE  88

Query  279  MTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATIT  458
            M R+IWT IK+KLIFP+L+LDIKYYDLGILNRD TDD+VT+ESAEATLKYNVA+KCATIT
Sbjct  89   MARIIWTTIKDKLIFPYLDLDIKYYDLGILNRDXTDDRVTVESAEATLKYNVAVKCATIT  148

Query  459  PDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            PDETRVKEFGLKSMW+SPNGTIRNIL+GTVFREPILCK        +++   +GR+ F
Sbjct  149  PDETRVKEFGLKSMWRSPNGTIRNILDGTVFREPILCKNIPRIVPGWKKPICIGRHAF  206



>ref|XP_008368420.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
[Malus domestica]
Length=237

 Score =   235 bits (600),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 135/171 (79%), Gaps = 14/171 (8%)
 Frame = +3

Query  120  FKEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWT  299
            F  V   NR+S   R    S+RCFAS+A         DK+RVQNPIVEMDGDEMTR+IW 
Sbjct  42   FNGVPIGNRVSFAARFSRTSLRCFASSAG-------FDKVRVQNPIVEMDGDEMTRIIWK  94

Query  300  MIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVK  479
             IK+KLIFP+L+LDIKYYDLGILNRDATDD+VT+ESAEA LKYNVA+KCATITPDETRVK
Sbjct  95   TIKDKLIFPYLDLDIKYYDLGILNRDATDDRVTVESAEAALKYNVAVKCATITPDETRVK  154

Query  480  EFGLKSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            EFGLKSMW+SPNGTIRNIL+GTVFREPILCK        +++   +GR+ F
Sbjct  155  EFGLKSMWRSPNGTIRNILDGTVFREPILCKNIPRIVPGWKKPICIGRHAF  205



>ref|XP_004306353.2| PREDICTED: isocitrate dehydrogenase [NADP] [Fragaria vesca subsp. 
vesca]
Length=482

 Score =   241 bits (614),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 135/165 (82%), Gaps = 13/165 (8%)
 Frame = +3

Query  138  RNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKL  317
            RNR+S        S+RC+A+ A G       D++RVQNPIVEMDGDEMTR+IWT IKEKL
Sbjct  46   RNRVSFAPTTNRTSLRCYAAAAGGF------DRVRVQNPIVEMDGDEMTRIIWTAIKEKL  99

Query  318  IFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKS  497
            IFP+++LDIKYYDLGILNRDATDDKVT+ESAEATLKYNVA+KCATITPDETR+KEFGLKS
Sbjct  100  IFPYVDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAVKCATITPDETRMKEFGLKS  159

Query  498  MWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            MW+SPNGTIRNILNGTVFREPILCK        +++   +GR+ F
Sbjct  160  MWRSPNGTIRNILNGTVFREPILCKNIPRIVPGWKKPICIGRHAF  204



>ref|XP_006446550.1| hypothetical protein CICLE_v100148161mg, partial [Citrus clementina]
 gb|ESR59790.1| hypothetical protein CICLE_v100148161mg, partial [Citrus clementina]
Length=419

 Score =   238 bits (607),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 138/168 (82%), Gaps = 19/168 (11%)
 Frame = +3

Query  129  VFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIK  308
            V FRN+L+     P  S RCFAS A+G       D+++VQNPIVEMDGDEMTR+IW MIK
Sbjct  58   VSFRNQLA-----PAMSFRCFAS-ATGI------DRVKVQNPIVEMDGDEMTRIIWQMIK  105

Query  309  EKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFG  488
            +KLIFP+L+LDIKYYDLGILNRDATDDKVT+ESAEATLKYNVAIKCATITPDETR+KEFG
Sbjct  106  DKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFG  165

Query  489  LKSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            LKSMW+SPNGTIRNILNGTVFREPILC+        +++   +GR+ F
Sbjct  166  LKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAF  213



>ref|XP_009377196.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Pyrus x bretschneideri]
Length=483

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 135/171 (79%), Gaps = 14/171 (8%)
 Frame = +3

Query  120  FKEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWT  299
            F  V   NR+S   R    S+RCFAS AS        DK+RVQNPIVEMDGDEMTR+IW 
Sbjct  42   FNGVPVGNRVSFAARFSRTSLRCFASAASF-------DKVRVQNPIVEMDGDEMTRIIWK  94

Query  300  MIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVK  479
             IK+KLIFP+L+LDIKYYDLGILNRDATDD+VT+ESAEA LKYNVA+KCATITPDETRVK
Sbjct  95   TIKDKLIFPYLDLDIKYYDLGILNRDATDDRVTVESAEAALKYNVAVKCATITPDETRVK  154

Query  480  EFGLKSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            EFGLKSMW+SPNGTIRNIL+GTVFREPILCK        +++   +GR+ F
Sbjct  155  EFGLKSMWRSPNGTIRNILDGTVFREPILCKNIPRIVPGWKKPICIGRHAF  205



>gb|KFK25699.1| hypothetical protein AALP_AA8G147500 [Arabis alpina]
Length=490

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 136/176 (77%), Gaps = 15/176 (9%)
 Frame = +3

Query  108  SPKLFKEVFFRNRLSSPTRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMT  284
            S  +F  V +RNR++ P +   A S+RCFAS+          D+I+VQNPIVEMDGDEMT
Sbjct  49   SSGVFSGVAWRNRVAFPVQFRRALSVRCFASSGG-------SDRIQVQNPIVEMDGDEMT  101

Query  285  RVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPD  464
            RVIW+MIK+KLI P+L+LDIKYYDLGILNRDATDDKVT+ESAEA LKYNVAIKCATITPD
Sbjct  102  RVIWSMIKDKLILPYLDLDIKYYDLGILNRDATDDKVTVESAEAALKYNVAIKCATITPD  161

Query  465  ETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-------FLVGRNPF  611
            E RVKEFGL SMW+SPNGTIRNILNGTVFREPI+C     L         +GR+ F
Sbjct  162  EDRVKEFGLNSMWRSPNGTIRNILNGTVFREPIMCSNIPRLVPGWKKPICIGRHAF  217



>ref|XP_010688692.1| PREDICTED: isocitrate dehydrogenase [NADP] [Beta vulgaris subsp. 
vulgaris]
Length=465

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 139/169 (82%), Gaps = 11/169 (7%)
 Frame = +3

Query  129  VFFRN-RLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMI  305
            +FF N +     R   +S+RCF+S+   TAP+E   +I+VQNPIVEMDGDEMTR+IW MI
Sbjct  23   IFFNNSKTLHFRRFKFSSLRCFSSSPMATAPIE---RIKVQNPIVEMDGDEMTRIIWKMI  79

Query  306  KEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEF  485
            K++LIFP L+LDIKYYDLGILNRDATDD+VT+ESAEATLKYNVA+KCATITPDETRVKEF
Sbjct  80   KDRLIFPFLDLDIKYYDLGILNRDATDDRVTVESAEATLKYNVAVKCATITPDETRVKEF  139

Query  486  GLKSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            GLKSMW+SPNGTIRNIL+GTVFREPI+CK        +++   VGR+ F
Sbjct  140  GLKSMWRSPNGTIRNILDGTVFREPIMCKNIPRIVSGWKKPICVGRHAF  188



>ref|XP_009375130.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Pyrus x bretschneideri]
Length=483

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 135/171 (79%), Gaps = 14/171 (8%)
 Frame = +3

Query  120  FKEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWT  299
            F  V   NR+S   R    S+RCFAS+A         DK+RVQNPIVEMDGDEMTR+IW 
Sbjct  42   FNGVPVGNRVSFAARCSRTSLRCFASSAG-------FDKVRVQNPIVEMDGDEMTRIIWK  94

Query  300  MIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVK  479
             IK+KLIFP+L+LDIKYYDLGILNRDATDD+VT+ESAEA LKYNVA+KCATITPDETRVK
Sbjct  95   TIKDKLIFPYLDLDIKYYDLGILNRDATDDRVTVESAEAALKYNVAVKCATITPDETRVK  154

Query  480  EFGLKSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            EFGLKSMW+SPNGTIRNIL+GTVFREPILCK        +++   +GR+ F
Sbjct  155  EFGLKSMWRSPNGTIRNILDGTVFREPILCKNIPRIVPGWKKPICIGRHAF  205



>ref|XP_010551914.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial 
isoform X2 [Tarenaya hassleriana]
Length=425

 Score =   236 bits (601),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 138/166 (83%), Gaps = 15/166 (9%)
 Frame = +3

Query  138  RNRLSSPTRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEK  314
            R+R++ P +  +A S+RCFAS+ +        D+I+V+NPIVEMDGDEMTRVIW+MIKEK
Sbjct  52   RSRIAFPLQFRHAISVRCFASSGA-------SDRIQVKNPIVEMDGDEMTRVIWSMIKEK  104

Query  315  LIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLK  494
            LI P+L+LDIKY+DLGILNRDATDDKVT+ESAEA LKYNVAIKCATITPDETRVKEFGLK
Sbjct  105  LILPYLDLDIKYFDLGILNRDATDDKVTVESAEAALKYNVAIKCATITPDETRVKEFGLK  164

Query  495  SMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            SMW+SPNGTIRNILNGTVFREPILC+        +++   +GR+ F
Sbjct  165  SMWRSPNGTIRNILNGTVFREPILCRNIPRIVPGWKKPICIGRHAF  210



>ref|XP_006470285.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
[Citrus sinensis]
Length=533

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 138/168 (82%), Gaps = 19/168 (11%)
 Frame = +3

Query  129  VFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIK  308
            V FRN+L+     P  S RCFAS A+G       D+++VQNPIVEMDGDEMTR+IW MIK
Sbjct  58   VSFRNQLA-----PAMSFRCFAS-ATGI------DRVKVQNPIVEMDGDEMTRIIWQMIK  105

Query  309  EKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFG  488
            +KLIFP+L+LDIKYYDLGILNRDATDDKVT+ESAEATLKYNVAIKCATITPDETR+KEFG
Sbjct  106  DKLIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAIKCATITPDETRMKEFG  165

Query  489  LKSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            LKSMW+SPNGTIRNILNGTVFREPILC+        +++   +GR+ F
Sbjct  166  LKSMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAF  213



>ref|XP_010420101.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial 
[Camelina sativa]
Length=492

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 135/173 (78%), Gaps = 15/173 (9%)
 Frame = +3

Query  117  LFKEVFFRNRLSSPTR-LPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVI  293
            +F     RNR++ P + L  +S+RCFAS+          DKI+VQNPIVEMDGDEMTRVI
Sbjct  49   IFSGGVSRNRVAFPVQFLRASSVRCFASSGG-------SDKIQVQNPIVEMDGDEMTRVI  101

Query  294  WTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETR  473
            WTMIKEKLI P+L+LDIKY+DLGILNRDATDDKVT+ESAEA LKYNVAIKCATITPDE R
Sbjct  102  WTMIKEKLILPYLDLDIKYFDLGILNRDATDDKVTVESAEAALKYNVAIKCATITPDEGR  161

Query  474  VKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-------FLVGRNPF  611
            VKEFGLKSMW+SPNGTIRNIL+GTVFREPI+C     L         +GR+ F
Sbjct  162  VKEFGLKSMWRSPNGTIRNILDGTVFREPIMCSNIPRLVPGWKKPICIGRHAF  214



>ref|XP_010108798.1| Isocitrate dehydrogenase [NADP] [Morus notabilis]
 gb|EXC20313.1| Isocitrate dehydrogenase [NADP] [Morus notabilis]
Length=484

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 127/144 (88%), Gaps = 7/144 (5%)
 Frame = +3

Query  141  NRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLI  320
            NR+    R  ++S+RC+AS+          D+I+VQNPIVEMDGDEMTR+IW MIK+KLI
Sbjct  50   NRVCFSPRFAHSSLRCYASSLG-------FDRIQVQNPIVEMDGDEMTRIIWRMIKDKLI  102

Query  321  FPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSM  500
            FP+L+LDIKYYDLGILNRDATDD+VT+ESAEATLKYNVA+KCATITPDETRVKEFGLK+M
Sbjct  103  FPYLDLDIKYYDLGILNRDATDDRVTVESAEATLKYNVAVKCATITPDETRVKEFGLKAM  162

Query  501  WKSPNGTIRNILNGTVFREPILCK  572
            W+SPNGTIRNILNGTVFREPILCK
Sbjct  163  WRSPNGTIRNILNGTVFREPILCK  186



>ref|XP_006399971.1| hypothetical protein EUTSA_v10013384mg [Eutrema salsugineum]
 gb|ESQ41424.1| hypothetical protein EUTSA_v10013384mg [Eutrema salsugineum]
Length=488

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 133/166 (80%), Gaps = 15/166 (9%)
 Frame = +3

Query  138  RNRLSSPTRLPNAS-IRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEK  314
            RNR+S P +   AS +RCFAS+          D+I+VQNPIVEMDGDEMTRVIW+MIK+K
Sbjct  57   RNRVSFPVQFHRASSVRCFASSGG-------SDRIQVQNPIVEMDGDEMTRVIWSMIKDK  109

Query  315  LIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLK  494
            LIFP+L+LDIKY+DLGILNRDATDDKVT+ESAEA LKYNVAIKCATITPDE RVKEFGLK
Sbjct  110  LIFPYLDLDIKYFDLGILNRDATDDKVTVESAEAALKYNVAIKCATITPDEGRVKEFGLK  169

Query  495  SMWKSPNGTIRNILNGTVFREPILCKIFQEL-------FLVGRNPF  611
            SMW+SPNGTIRNIL+GTVFREPI+C     L         +GR+ F
Sbjct  170  SMWRSPNGTIRNILDGTVFREPIMCSNIPRLVPGWSKPICIGRHAF  215



>ref|XP_010492268.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=493

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 136/173 (79%), Gaps = 15/173 (9%)
 Frame = +3

Query  117  LFKEVFFRNRLSSPTR-LPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVI  293
            LF     RNR++ P + L  +S+RCFAS++         DKI+VQNP+VEMDGDEMTRVI
Sbjct  50   LFSGGVSRNRVAFPVQFLRASSVRCFASSSG-------SDKIQVQNPVVEMDGDEMTRVI  102

Query  294  WTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETR  473
            W+MIKEKLI P+L+LDIKY+DLGILNRDATDDKVT+ESAEA LKYNVAIKCATITPDE R
Sbjct  103  WSMIKEKLILPYLDLDIKYFDLGILNRDATDDKVTVESAEAALKYNVAIKCATITPDEGR  162

Query  474  VKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-------FLVGRNPF  611
            VKEFGLKSMW+SPNGTIRNIL+GTVFREPI+C     L         +GR+ F
Sbjct  163  VKEFGLKSMWRSPNGTIRNILDGTVFREPIMCSNIPRLVPGWKKPICIGRHAF  215



>emb|CAB87626.1| isocitrate dehydrogenase-like protein [Arabidopsis thaliana]
Length=465

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 135/176 (77%), Gaps = 15/176 (9%)
 Frame = +3

Query  108  SPKLFKEVFFRNRLSSPTRLPNAS-IRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMT  284
            S  +F     RNR++ P +   AS +RCFAS+          D+I+VQNPIVEMDGDEMT
Sbjct  21   SSGIFSSGASRNRVTFPVQFHRASAVRCFASSGG-------SDRIQVQNPIVEMDGDEMT  73

Query  285  RVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPD  464
            RVIW+MIKEKLI P+L+LDIKY+DLGILNRDATDDKVT+ESAEA LKYNVAIKCATITPD
Sbjct  74   RVIWSMIKEKLILPYLDLDIKYFDLGILNRDATDDKVTVESAEAALKYNVAIKCATITPD  133

Query  465  ETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-------FLVGRNPF  611
            E RVKEFGLKSMW+SPNGTIRNIL+GTVFREPI+C     L         +GR+ F
Sbjct  134  EGRVKEFGLKSMWRSPNGTIRNILDGTVFREPIMCSNIPRLVPGWEKPICIGRHAF  189



>ref|XP_010551913.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial 
isoform X1 [Tarenaya hassleriana]
Length=488

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 130/146 (89%), Gaps = 8/146 (5%)
 Frame = +3

Query  138  RNRLSSPTRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEK  314
            R+R++ P +  +A S+RCFAS+ +        D+I+V+NPIVEMDGDEMTRVIW+MIKEK
Sbjct  52   RSRIAFPLQFRHAISVRCFASSGA-------SDRIQVKNPIVEMDGDEMTRVIWSMIKEK  104

Query  315  LIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLK  494
            LI P+L+LDIKY+DLGILNRDATDDKVT+ESAEA LKYNVAIKCATITPDETRVKEFGLK
Sbjct  105  LILPYLDLDIKYFDLGILNRDATDDKVTVESAEAALKYNVAIKCATITPDETRVKEFGLK  164

Query  495  SMWKSPNGTIRNILNGTVFREPILCK  572
            SMW+SPNGTIRNILNGTVFREPILC+
Sbjct  165  SMWRSPNGTIRNILNGTVFREPILCR  190



>ref|NP_196963.2| isocitrate dehydrogenase [Arabidopsis thaliana]
 sp|Q8LPJ5.1|ICDHP_ARATH RecName: Full=Isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAM20534.1| isocitrate dehydrogenase-like protein [Arabidopsis thaliana]
 gb|AAN15595.1| isocitrate dehydrogenase-like protein [Arabidopsis thaliana]
 gb|AED92051.1| isocitrate dehydrogenase [Arabidopsis thaliana]
Length=485

 Score =   235 bits (600),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 135/176 (77%), Gaps = 15/176 (9%)
 Frame = +3

Query  108  SPKLFKEVFFRNRLSSPTRLPNAS-IRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMT  284
            S  +F     RNR++ P +   AS +RCFAS+          D+I+VQNPIVEMDGDEMT
Sbjct  39   SSGIFSSGASRNRVTFPVQFHRASAVRCFASSGG-------SDRIQVQNPIVEMDGDEMT  91

Query  285  RVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPD  464
            RVIW+MIKEKLI P+L+LDIKY+DLGILNRDATDDKVT+ESAEA LKYNVAIKCATITPD
Sbjct  92   RVIWSMIKEKLILPYLDLDIKYFDLGILNRDATDDKVTVESAEAALKYNVAIKCATITPD  151

Query  465  ETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-------FLVGRNPF  611
            E RVKEFGLKSMW+SPNGTIRNIL+GTVFREPI+C     L         +GR+ F
Sbjct  152  EGRVKEFGLKSMWRSPNGTIRNILDGTVFREPIMCSNIPRLVPGWEKPICIGRHAF  207



>ref|XP_006287601.1| hypothetical protein CARUB_v10000812mg [Capsella rubella]
 gb|EOA20499.1| hypothetical protein CARUB_v10000812mg [Capsella rubella]
Length=492

 Score =   235 bits (599),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 132/165 (80%), Gaps = 15/165 (9%)
 Frame = +3

Query  141  NRLSSPTRLPNAS-IRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKL  317
            NR++ P +L  AS +RCFAS+          D+I+VQNPIVEMDGDEMTRVIWTMIKEKL
Sbjct  57   NRVAFPAQLHRASSVRCFASSG-------VSDRIQVQNPIVEMDGDEMTRVIWTMIKEKL  109

Query  318  IFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKS  497
            I P+L+LDIKY+DLGILNRDATDDKVT+ESAEA LKYNVAIKCATITPDE RVKEFGLKS
Sbjct  110  ILPYLDLDIKYFDLGILNRDATDDKVTVESAEAALKYNVAIKCATITPDEGRVKEFGLKS  169

Query  498  MWKSPNGTIRNILNGTVFREPILCKIFQEL-------FLVGRNPF  611
            MW+SPNGTIRNIL+GTVFREPI+C     L         +GR+ F
Sbjct  170  MWRSPNGTIRNILDGTVFREPIMCSNIPRLVPGWKKPICIGRHAF  214



>emb|CDX78585.1| BnaA03g04970D [Brassica napus]
Length=485

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 135/178 (76%), Gaps = 13/178 (7%)
 Frame = +3

Query  102  TSSPKLFKEVFF-----RNRLSSPTRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVE  263
            + SP+      F     RNR++ P R   A S+RCFAS+          D+I+VQNPIVE
Sbjct  37   SKSPRFLSSGVFSGGASRNRVAFPVRFHRALSVRCFASSGG-------SDRIQVQNPIVE  89

Query  264  MDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIK  443
            MDGDEMTRVIW+MIK+KLI P+L+LDIKY+DLGILNRDATDD+VT+ESAEA LKYNVAIK
Sbjct  90   MDGDEMTRVIWSMIKDKLILPYLDLDIKYFDLGILNRDATDDRVTVESAEAALKYNVAIK  149

Query  444  CATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQELFLVGRNPFVL  617
            CATITPDE RVKEFGLKSMW+SPNGTIRNIL+GTVFREPI+C     L    R P  +
Sbjct  150  CATITPDEGRVKEFGLKSMWRSPNGTIRNILDGTVFREPIMCGNIPRLVPGWRKPICI  207



>ref|XP_007031536.1| Isocitrate/isopropylmalate dehydrogenase family protein isoform 
4 [Theobroma cacao]
 gb|EOY02462.1| Isocitrate/isopropylmalate dehydrogenase family protein isoform 
4 [Theobroma cacao]
Length=384

 Score =   232 bits (591),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 127/157 (81%), Gaps = 8/157 (5%)
 Frame = +3

Query  105  SSPKLFKEVFFRNRLSSPTRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEM  281
            SS + F      NR+   +  P A S+RCFAS+          D+++VQNPIVEMDGDEM
Sbjct  46   SSSRHFSNGALGNRVVFSSHFPRAVSLRCFASSTG-------FDRVQVQNPIVEMDGDEM  98

Query  282  TRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITP  461
            TR+IW+MIKEKLIFP+L LD+KY+DLGILNRDATDD VT ESAEA LKYNVAIKCATITP
Sbjct  99   TRIIWSMIKEKLIFPYLNLDVKYFDLGILNRDATDDNVTTESAEAALKYNVAIKCATITP  158

Query  462  DETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            DE RVKEFGLKSMW+SPNGTIRNILNGTVFREPILC+
Sbjct  159  DEARVKEFGLKSMWRSPNGTIRNILNGTVFREPILCR  195



>ref|XP_002524672.1| NADP-specific isocitrate dehydrogenase, putative [Ricinus communis]
 gb|EEF37691.1| NADP-specific isocitrate dehydrogenase, putative [Ricinus communis]
Length=470

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 131/145 (90%), Gaps = 4/145 (3%)
 Frame = +3

Query  141  NRLSSPTRLPNA--SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEK  314
            NRL+  ++  NA  S+RCFAS++  ++     D+++VQNPIVEMDGDEMTRVIW MIK+K
Sbjct  49   NRLAFSSQFANAAVSLRCFASSS--SSSSTGFDRVKVQNPIVEMDGDEMTRVIWRMIKDK  106

Query  315  LIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLK  494
            LIFP+L+LDIKY+DLGILNRDATDDKVT+ESAEATLKYNVA+KCATITPDETRVKEFGLK
Sbjct  107  LIFPYLDLDIKYFDLGILNRDATDDKVTVESAEATLKYNVAVKCATITPDETRVKEFGLK  166

Query  495  SMWKSPNGTIRNILNGTVFREPILC  569
            SMW+SPNGTIRNILNGTVFREPILC
Sbjct  167  SMWRSPNGTIRNILNGTVFREPILC  191



>gb|KDP45313.1| hypothetical protein JCGZ_09562 [Jatropha curcas]
Length=476

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 138/166 (83%), Gaps = 13/166 (8%)
 Frame = +3

Query  138  RNRLSSPTRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEK  314
            ++R++  ++   A S+RCFAS++S        D+++VQNPIVEMDGDEMTR+IW MIKEK
Sbjct  38   KSRVALSSQFARAISLRCFASSSSIGF-----DRVKVQNPIVEMDGDEMTRIIWKMIKEK  92

Query  315  LIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLK  494
            LIFP+L+LDIKYYDLGILNRDATDDKVT+ESAEATLKYNVA+KCATITPDETRVKEF LK
Sbjct  93   LIFPYLDLDIKYYDLGILNRDATDDKVTVESAEATLKYNVAVKCATITPDETRVKEFNLK  152

Query  495  SMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            SMW+SPNGTIRNILNGTVFREPILC+        +++   +GR+ F
Sbjct  153  SMWRSPNGTIRNILNGTVFREPILCQNIPRIVPGWKKPICIGRHAF  198



>ref|XP_010453584.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
[Camelina sativa]
Length=490

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 133/173 (77%), Gaps = 17/173 (10%)
 Frame = +3

Query  117  LFKEVFFRNRLSSPTR-LPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVI  293
            LF     RNR++ P + L  +S RCFA  +         DKI+VQNPIVEMDGDEMTRVI
Sbjct  49   LFSGGVSRNRVAFPVQFLRASSARCFAGGS---------DKIQVQNPIVEMDGDEMTRVI  99

Query  294  WTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETR  473
            WTMIKEKLI P+L+LDIKY+DLGILNRDATDDKVT+ESAEA LKYNVAIKCATITPDE R
Sbjct  100  WTMIKEKLILPYLDLDIKYFDLGILNRDATDDKVTVESAEAALKYNVAIKCATITPDEGR  159

Query  474  VKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-------FLVGRNPF  611
            VKEFGLKSMW+SPNGTIRNIL+GTVFREPI+C     L         +GR+ F
Sbjct  160  VKEFGLKSMWRSPNGTIRNILDGTVFREPIMCSNIPRLVPGWKKPICIGRHAF  212



>ref|XP_009131418.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial 
[Brassica rapa]
Length=483

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 132/171 (77%), Gaps = 8/171 (5%)
 Frame = +3

Query  108  SPKLFKEVFFRNRLSSPTRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMT  284
            S  +F     RNR++ P R   A S+RCFAS+          D+I+VQNPIVEMDGDEMT
Sbjct  42   SSGVFSGAASRNRVAFPVRFHRALSVRCFASSGG-------SDRIQVQNPIVEMDGDEMT  94

Query  285  RVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPD  464
            RVIW+MIK+KLI P+L+LDIKY+DLGILNRDATDD+VT+ESAEA LKYNVAIKCATITPD
Sbjct  95   RVIWSMIKDKLILPYLDLDIKYFDLGILNRDATDDRVTVESAEAALKYNVAIKCATITPD  154

Query  465  ETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQELFLVGRNPFVL  617
              RVKEFGLKSMW+SPNGTIRNIL+GTVFREPI+C     L    R P  +
Sbjct  155  GGRVKEFGLKSMWRSPNGTIRNILDGTVFREPIMCGNIPRLVPGWRKPICI  205



>gb|KCW52908.1| hypothetical protein EUGRSUZ_J02223 [Eucalyptus grandis]
Length=430

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 132/165 (80%), Gaps = 14/165 (8%)
 Frame = +3

Query  138  RNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKL  317
            R R+         S+RCFAS+ S        D+I+V NPIVEMDGDEMTR+IW+MIKEKL
Sbjct  55   RTRVQFSGGFARVSLRCFASSPS-------LDRIQVGNPIVEMDGDEMTRIIWSMIKEKL  107

Query  318  IFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKS  497
            IFP+L+LDIKYYDLGILNRDAT+D+VT+ESAEA LKYNVA+KCATITPDETRVKEFGLKS
Sbjct  108  IFPYLDLDIKYYDLGILNRDATEDRVTVESAEAALKYNVAVKCATITPDETRVKEFGLKS  167

Query  498  MWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            MW+SPNGTIRNILNGTVFREPILC+        +++   +GR+ F
Sbjct  168  MWRSPNGTIRNILNGTVFREPILCRNIPRIVPGWKKPICIGRHAF  212



>ref|XP_007031535.1| Isocitrate/isopropylmalate dehydrogenase family protein isoform 
3, partial [Theobroma cacao]
 gb|EOY02461.1| Isocitrate/isopropylmalate dehydrogenase family protein isoform 
3, partial [Theobroma cacao]
Length=430

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 127/157 (81%), Gaps = 8/157 (5%)
 Frame = +3

Query  105  SSPKLFKEVFFRNRLSSPTRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEM  281
            SS + F      NR+   +  P A S+RCFAS+          D+++VQNPIVEMDGDEM
Sbjct  48   SSSRHFSNGALGNRVVFSSHFPRAVSLRCFASSTG-------FDRVQVQNPIVEMDGDEM  100

Query  282  TRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITP  461
            TR+IW+MIKEKLIFP+L LD+KY+DLGILNRDATDD VT ESAEA LKYNVAIKCATITP
Sbjct  101  TRIIWSMIKEKLIFPYLNLDVKYFDLGILNRDATDDNVTTESAEAALKYNVAIKCATITP  160

Query  462  DETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            DE RVKEFGLKSMW+SPNGTIRNILNGTVFREPILC+
Sbjct  161  DEARVKEFGLKSMWRSPNGTIRNILNGTVFREPILCR  197



>emb|CDX70573.1| BnaC03g06570D [Brassica napus]
Length=483

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 134/176 (76%), Gaps = 13/176 (7%)
 Frame = +3

Query  108  SPKLFKEVFF-----RNRLSSPTRLPNAS-IRCFASTASGTAPVETKDKIRVQNPIVEMD  269
            SP+  +   F     RNR++   R   AS +RCFAS+          D+I+VQNPIVEMD
Sbjct  37   SPRFLRSGVFSGGASRNRVAFAVRFHRASAVRCFASSGG-------SDRIQVQNPIVEMD  89

Query  270  GDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCA  449
            GDEMTRVIW+MIK+KLI P+L+LDIKY+DLGILNRDATDD+VT+ESAEA LKYNVAIKCA
Sbjct  90   GDEMTRVIWSMIKDKLILPYLDLDIKYFDLGILNRDATDDRVTVESAEAALKYNVAIKCA  149

Query  450  TITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQELFLVGRNPFVL  617
            TITPDE RVKEFGLKSMW+SPNGTIRNIL+GTVFREPI+C     L    R P  +
Sbjct  150  TITPDEGRVKEFGLKSMWRSPNGTIRNILDGTVFREPIMCGNIPRLVPGWRKPICI  205



>ref|XP_006841065.1| hypothetical protein AMTR_s00085p00178400 [Amborella trichopoda]
 gb|ERN02740.1| hypothetical protein AMTR_s00085p00178400 [Amborella trichopoda]
Length=500

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 131/171 (77%), Gaps = 16/171 (9%)
 Frame = +3

Query  120  FKEVFFRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWT  299
            F   F  N   S   L   S+ CFA TA       T D+I+VQNPIVEMDGDEMTRVIW 
Sbjct  61   FHGAFLGN--PSSLSLSKCSVHCFAQTA-------TIDRIKVQNPIVEMDGDEMTRVIWK  111

Query  300  MIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVK  479
            MIK+KLI+P+L+L+IKY+DLGILNRDATDD++TIESAEATLKYNV +KCATITPDE+RVK
Sbjct  112  MIKDKLIYPYLDLNIKYFDLGILNRDATDDQITIESAEATLKYNVGVKCATITPDESRVK  171

Query  480  EFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-------FLVGRNPF  611
            EFGLKSMWKSPNGTIRNILNGTVFREPILC+    L         VGR+ F
Sbjct  172  EFGLKSMWKSPNGTIRNILNGTVFREPILCRNIPRLVPGWKKPICVGRHAF  222



>ref|XP_008458785.1| PREDICTED: isocitrate dehydrogenase [NADP] [Cucumis melo]
Length=479

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 6/142 (4%)
 Frame = +3

Query  147  LSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFP  326
            L+SP R    S+RC+AS+ S        D++ V NP+VEMDGDEMTR+IWTMIKEKLIFP
Sbjct  44   LTSPLRSHAVSLRCYASSPSAF------DRVPVLNPVVEMDGDEMTRIIWTMIKEKLIFP  97

Query  327  HLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWK  506
             L+LDIKYYDLGILNRDATDD+VT+ESAEATLKYNVA+KCATITPDE RVKEFGLK+MW+
Sbjct  98   FLDLDIKYYDLGILNRDATDDRVTVESAEATLKYNVAVKCATITPDEARVKEFGLKTMWR  157

Query  507  SPNGTIRNILNGTVFREPILCK  572
            SPNGTIRNILNGTVFREPILC+
Sbjct  158  SPNGTIRNILNGTVFREPILCE  179



>ref|XP_010033298.1| PREDICTED: isocitrate dehydrogenase [NADP] [Eucalyptus grandis]
 gb|KCW52907.1| hypothetical protein EUGRSUZ_J02223 [Eucalyptus grandis]
Length=490

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 132/165 (80%), Gaps = 14/165 (8%)
 Frame = +3

Query  138  RNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKL  317
            R R+         S+RCFAS+ S        D+I+V NPIVEMDGDEMTR+IW+MIKEKL
Sbjct  55   RTRVQFSGGFARVSLRCFASSPS-------LDRIQVGNPIVEMDGDEMTRIIWSMIKEKL  107

Query  318  IFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKS  497
            IFP+L+LDIKYYDLGILNRDAT+D+VT+ESAEA LKYNVA+KCATITPDETRVKEFGLKS
Sbjct  108  IFPYLDLDIKYYDLGILNRDATEDRVTVESAEAALKYNVAVKCATITPDETRVKEFGLKS  167

Query  498  MWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            MW+SPNGTIRNILNGTVFREPILC+        +++   +GR+ F
Sbjct  168  MWRSPNGTIRNILNGTVFREPILCRNIPRIVPGWKKPICIGRHAF  212



>ref|XP_008812172.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Phoenix dactylifera]
Length=493

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 136/178 (76%), Gaps = 19/178 (11%)
 Frame = +3

Query  105  SSPKLFKEVFFRNRLSSPTRL--PNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDE  278
            S P+ F  V F    + P R    + S+RCFAS+      V T DKI+VQNPIVEMDGDE
Sbjct  45   SGPRRFDGVLF----AFPARRLGCDVSLRCFASS------VATADKIKVQNPIVEMDGDE  94

Query  279  MTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATIT  458
            MTRVIW MIKEKLI PHL+LDIKY+DLGI NRDATDD+VT+ESAEATLKYNVA+KCATIT
Sbjct  95   MTRVIWKMIKEKLIHPHLDLDIKYFDLGIFNRDATDDRVTVESAEATLKYNVAVKCATIT  154

Query  459  PDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILC-------KIFQELFLVGRNPF  611
            PDE R+KEF L SMW+SPNGTIRNILNGTVFREPILC       + +++   +GR+ F
Sbjct  155  PDEARMKEFKLNSMWRSPNGTIRNILNGTVFREPILCRNIPRIVRGWKKPICIGRHAF  212



>ref|XP_007031533.1| Isocitrate/isopropylmalate dehydrogenase family protein isoform 
1 [Theobroma cacao]
 gb|EOY02459.1| Isocitrate/isopropylmalate dehydrogenase family protein isoform 
1 [Theobroma cacao]
Length=494

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 127/157 (81%), Gaps = 8/157 (5%)
 Frame = +3

Query  105  SSPKLFKEVFFRNRLSSPTRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEM  281
            SS + F      NR+   +  P A S+RCFAS+          D+++VQNPIVEMDGDEM
Sbjct  46   SSSRHFSNGALGNRVVFSSHFPRAVSLRCFASSTG-------FDRVQVQNPIVEMDGDEM  98

Query  282  TRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITP  461
            TR+IW+MIKEKLIFP+L LD+KY+DLGILNRDATDD VT ESAEA LKYNVAIKCATITP
Sbjct  99   TRIIWSMIKEKLIFPYLNLDVKYFDLGILNRDATDDNVTTESAEAALKYNVAIKCATITP  158

Query  462  DETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            DE RVKEFGLKSMW+SPNGTIRNILNGTVFREPILC+
Sbjct  159  DEARVKEFGLKSMWRSPNGTIRNILNGTVFREPILCR  195



>gb|KJB70909.1| hypothetical protein B456_011G095400 [Gossypium raimondii]
Length=464

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 128/154 (83%), Gaps = 8/154 (5%)
 Frame = +3

Query  114  KLFKEVFFRNRLSSPTRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRV  290
            + F      N+L    R P A S+RCFAS++         DK++V NPIVEMDGDEMTR+
Sbjct  44   RFFSNGVLNNQLVFSPRFPRAISLRCFASSSG-------FDKVQVLNPIVEMDGDEMTRI  96

Query  291  IWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDET  470
            IW++IK+KLIFP+L LD+KY+DLGILNRDATDDKVT+ESAEA LKYN+AIKCATITPDET
Sbjct  97   IWSLIKDKLIFPYLNLDVKYFDLGILNRDATDDKVTVESAEAALKYNIAIKCATITPDET  156

Query  471  RVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            RVKEFGLKSMW+SPNGTIRNILNGTVFREPILC+
Sbjct  157  RVKEFGLKSMWRSPNGTIRNILNGTVFREPILCR  190



>ref|XP_010940159.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Elaeis 
guineensis]
Length=489

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 121/133 (91%), Gaps = 6/133 (5%)
 Frame = +3

Query  171  NASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKY  350
            + S+RCFAS+      + T D+I+VQNPIVEMDGDEMTRVIW MIKEKLI+PHL+LDIKY
Sbjct  64   DVSLRCFASS------IATVDRIKVQNPIVEMDGDEMTRVIWKMIKEKLIYPHLDLDIKY  117

Query  351  YDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRN  530
            +DLGILNRDATDD+VT+ESAEATLKYNVA+KCATITPDE R+KEF LKSMW+SPNGTIRN
Sbjct  118  FDLGILNRDATDDRVTVESAEATLKYNVAVKCATITPDEARMKEFKLKSMWRSPNGTIRN  177

Query  531  ILNGTVFREPILC  569
            ILNGTVFREPILC
Sbjct  178  ILNGTVFREPILC  190



>gb|KJB70908.1| hypothetical protein B456_011G095400 [Gossypium raimondii]
 gb|KJB70910.1| hypothetical protein B456_011G095400 [Gossypium raimondii]
Length=489

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 128/154 (83%), Gaps = 8/154 (5%)
 Frame = +3

Query  114  KLFKEVFFRNRLSSPTRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRV  290
            + F      N+L    R P A S+RCFAS++         DK++V NPIVEMDGDEMTR+
Sbjct  44   RFFSNGVLNNQLVFSPRFPRAISLRCFASSSGF-------DKVQVLNPIVEMDGDEMTRI  96

Query  291  IWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDET  470
            IW++IK+KLIFP+L LD+KY+DLGILNRDATDDKVT+ESAEA LKYN+AIKCATITPDET
Sbjct  97   IWSLIKDKLIFPYLNLDVKYFDLGILNRDATDDKVTVESAEAALKYNIAIKCATITPDET  156

Query  471  RVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            RVKEFGLKSMW+SPNGTIRNILNGTVFREPILC+
Sbjct  157  RVKEFGLKSMWRSPNGTIRNILNGTVFREPILCR  190



>ref|XP_002873679.1| hypothetical protein ARALYDRAFT_488300 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49938.1| hypothetical protein ARALYDRAFT_488300 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 130/165 (79%), Gaps = 15/165 (9%)
 Frame = +3

Query  141  NRLSSPTRLPNAS-IRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKL  317
            NR+S   +   AS +RCFAS+          D+I+VQNPIVEMDGDEMTRVIW+MIKEKL
Sbjct  57   NRVSFHVQSHRASAVRCFASSGG-------SDRIQVQNPIVEMDGDEMTRVIWSMIKEKL  109

Query  318  IFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKS  497
            I P+L+LDIKY+DLGILNRDATDDKVT+ESAEA LKYNVAIKCATITPDE RVKEFGLKS
Sbjct  110  ILPYLDLDIKYFDLGILNRDATDDKVTVESAEAALKYNVAIKCATITPDEGRVKEFGLKS  169

Query  498  MWKSPNGTIRNILNGTVFREPILCKIFQEL-------FLVGRNPF  611
            MW+SPNGTIRNIL+GTVFREPI+C     L         +GR+ F
Sbjct  170  MWRSPNGTIRNILDGTVFREPIMCSNIPRLVPGWKKPICIGRHAF  214



>ref|XP_004156686.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
[Cucumis sativus]
 gb|KGN51373.1| hypothetical protein Csa_5G523180 [Cucumis sativus]
Length=481

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 127/142 (89%), Gaps = 4/142 (3%)
 Frame = +3

Query  147  LSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFP  326
            L+SP R P  S+RC+AS++S      + D++ V NP+VEMDGDEMTR+IWTMIKEKLIFP
Sbjct  44   LTSPLRSPALSLRCYASSSS----SSSSDRVPVLNPVVEMDGDEMTRIIWTMIKEKLIFP  99

Query  327  HLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWK  506
             L+LDIKY+DLGILNRDATDD+VT+ESAEATLKYNVA+KCATITPDE RVKEFGLK+MW+
Sbjct  100  FLDLDIKYFDLGILNRDATDDRVTVESAEATLKYNVAVKCATITPDEARVKEFGLKAMWR  159

Query  507  SPNGTIRNILNGTVFREPILCK  572
            SPNGTIRNILNGTVFREPILC+
Sbjct  160  SPNGTIRNILNGTVFREPILCQ  181



>ref|XP_004142794.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
[Cucumis sativus]
Length=480

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 127/142 (89%), Gaps = 5/142 (4%)
 Frame = +3

Query  147  LSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFP  326
            L+SP R P  S+RC+AS++S      + D++ V NP+VEMDGDEMTR+IWTMIKEKLIFP
Sbjct  44   LTSPLRSPALSLRCYASSSS-----SSSDRVPVLNPVVEMDGDEMTRIIWTMIKEKLIFP  98

Query  327  HLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWK  506
             L+LDIKY+DLGILNRDATDD+VT+ESAEATLKYNVA+KCATITPDE RVKEFGLK+MW+
Sbjct  99   FLDLDIKYFDLGILNRDATDDRVTVESAEATLKYNVAVKCATITPDEARVKEFGLKAMWR  158

Query  507  SPNGTIRNILNGTVFREPILCK  572
            SPNGTIRNILNGTVFREPILC+
Sbjct  159  SPNGTIRNILNGTVFREPILCQ  180



>ref|XP_010248538.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] isoform 
X2 [Nelumbo nucifera]
Length=475

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 128/154 (83%), Gaps = 14/154 (9%)
 Frame = +3

Query  171  NASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKY  350
            N S+RCFAS +         ++I+V NPIVEMDGDEMTR+IW MIK+KLI+P+L+LDIKY
Sbjct  54   NTSLRCFASASH-------VERIKVLNPIVEMDGDEMTRIIWRMIKDKLIYPYLDLDIKY  106

Query  351  YDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRN  530
            YDLGILNRDATDDKVT+ESAEATLKYNVA+KCATITPDE RVKEFGLKSMW+SPNGTIRN
Sbjct  107  YDLGILNRDATDDKVTVESAEATLKYNVAVKCATITPDEGRVKEFGLKSMWRSPNGTIRN  166

Query  531  ILNGTVFREPILCK-------IFQELFLVGRNPF  611
            ILNGTVFREPILC+        +++   +GR+ F
Sbjct  167  ILNGTVFREPILCRNIPRIVPGWKKPICIGRHAF  200



>ref|XP_010248537.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Nelumbo 
nucifera]
Length=478

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 128/154 (83%), Gaps = 14/154 (9%)
 Frame = +3

Query  171  NASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKY  350
            N S+RCFAS +         ++I+V NPIVEMDGDEMTR+IW MIK+KLI+P+L+LDIKY
Sbjct  54   NTSLRCFASASH-------VERIKVLNPIVEMDGDEMTRIIWRMIKDKLIYPYLDLDIKY  106

Query  351  YDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRN  530
            YDLGILNRDATDDKVT+ESAEATLKYNVA+KCATITPDE RVKEFGLKSMW+SPNGTIRN
Sbjct  107  YDLGILNRDATDDKVTVESAEATLKYNVAVKCATITPDEGRVKEFGLKSMWRSPNGTIRN  166

Query  531  ILNGTVFREPILCK-------IFQELFLVGRNPF  611
            ILNGTVFREPILC+        +++   +GR+ F
Sbjct  167  ILNGTVFREPILCRNIPRIVPGWKKPICIGRHAF  200



>gb|KJB33783.1| hypothetical protein B456_006G032000 [Gossypium raimondii]
 gb|KJB33784.1| hypothetical protein B456_006G032000 [Gossypium raimondii]
 gb|KJB33785.1| hypothetical protein B456_006G032000 [Gossypium raimondii]
Length=468

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 127/145 (88%), Gaps = 8/145 (6%)
 Frame = +3

Query  141  NRLSSPTRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKL  317
            NR+    + P A S+RC+AS++         D+++V+NP+VEMDGDEMTR+IW MIK+KL
Sbjct  33   NRVVFTAQFPRAVSLRCYASSSGF-------DRVQVRNPVVEMDGDEMTRIIWNMIKDKL  85

Query  318  IFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKS  497
            IFP+L+LDIKY+DLGIL+RDATDDKVT+E+AEA LKYNVAIKCATITPDETRVKEFGLKS
Sbjct  86   IFPYLDLDIKYFDLGILSRDATDDKVTVEAAEAALKYNVAIKCATITPDETRVKEFGLKS  145

Query  498  MWKSPNGTIRNILNGTVFREPILCK  572
            MW+SPNGTIRNILNGTVFREPILCK
Sbjct  146  MWRSPNGTIRNILNGTVFREPILCK  170



>ref|XP_010248540.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial 
isoform X3 [Nelumbo nucifera]
Length=409

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 128/154 (83%), Gaps = 14/154 (9%)
 Frame = +3

Query  171  NASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKY  350
            N S+RCFAS +         ++I+V NPIVEMDGDEMTR+IW MIK+KLI+P+L+LDIKY
Sbjct  54   NTSLRCFASASH-------VERIKVLNPIVEMDGDEMTRIIWRMIKDKLIYPYLDLDIKY  106

Query  351  YDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRN  530
            YDLGILNRDATDDKVT+ESAEATLKYNVA+KCATITPDE RVKEFGLKSMW+SPNGTIRN
Sbjct  107  YDLGILNRDATDDKVTVESAEATLKYNVAVKCATITPDEGRVKEFGLKSMWRSPNGTIRN  166

Query  531  ILNGTVFREPILCK-------IFQELFLVGRNPF  611
            ILNGTVFREPILC+        +++   +GR+ F
Sbjct  167  ILNGTVFREPILCRNIPRIVPGWKKPICIGRHAF  200



>gb|KHG11175.1| Isocitrate dehydrogenase [NADP] [Gossypium arboreum]
Length=489

 Score =   228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 127/154 (82%), Gaps = 8/154 (5%)
 Frame = +3

Query  114  KLFKEVFFRNRLSSPTRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRV  290
            + F      N+L      P + S+RCFAS++         DK++V NPIVEMDGDEMTR+
Sbjct  44   RFFSNGVLNNQLVFSPHFPRSISLRCFASSSEF-------DKVQVLNPIVEMDGDEMTRI  96

Query  291  IWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDET  470
            IW++IK+KLIFP+L LD+KY+DLGILNRDATDDKVT+ESAEA LKYNVAIKCATITPDET
Sbjct  97   IWSLIKDKLIFPYLNLDVKYFDLGILNRDATDDKVTVESAEAALKYNVAIKCATITPDET  156

Query  471  RVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            RVKEFGLKSMW+SPNGTIRNILNGTVFREPILC+
Sbjct  157  RVKEFGLKSMWRSPNGTIRNILNGTVFREPILCR  190



>ref|XP_009390156.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=359

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 123/144 (85%), Gaps = 9/144 (6%)
 Frame = +3

Query  144  RLSSPTR--LPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKL  317
            R S PTR  +  +S+RC AS +    P E   +I+V NPIVEMDGDEMTRVIW MIKEKL
Sbjct  40   RFSFPTRFVVVGSSVRCLASFS----PAE---RIKVHNPIVEMDGDEMTRVIWRMIKEKL  92

Query  318  IFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKS  497
            IFP LELDIKY+DLG+LNRDATDD+VT+ESAEATLK+NVA+KCATITPDE RVKEF LKS
Sbjct  93   IFPFLELDIKYFDLGLLNRDATDDRVTVESAEATLKHNVAVKCATITPDEARVKEFKLKS  152

Query  498  MWKSPNGTIRNILNGTVFREPILC  569
            MW+SPNGTIRNILNGTVFREPILC
Sbjct  153  MWRSPNGTIRNILNGTVFREPILC  176



>ref|XP_003581407.1| PREDICTED: isocitrate dehydrogenase [NADP] [Brachypodium distachyon]
Length=481

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 137/174 (79%), Gaps = 20/174 (11%)
 Frame = +3

Query  138  RNRLSSPTR-LP--------NASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRV  290
            R RL SP   LP         AS+RC+A+ A+    V    +I+VQNPIVEMDGDEMTRV
Sbjct  35   RGRLHSPLACLPAPGGRSFRGASLRCYAAAAA----VAEHQRIKVQNPIVEMDGDEMTRV  90

Query  291  IWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDET  470
            IW MIK+KLIFP+LELD+KY+DLG+LNRDATDDKVT+ESAEATL+YNVA+KCATITPDET
Sbjct  91   IWKMIKDKLIFPYLELDVKYFDLGVLNRDATDDKVTVESAEATLEYNVAVKCATITPDET  150

Query  471  RVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            RVKEF LKSMW+SPNGTIRNILNGTVFREPILCK        +++   +GR+ F
Sbjct  151  RVKEFKLKSMWRSPNGTIRNILNGTVFREPILCKNIPRILSGWKKPICIGRHAF  204



>ref|XP_002446765.1| hypothetical protein SORBIDRAFT_06g022050 [Sorghum bicolor]
 gb|EES11093.1| hypothetical protein SORBIDRAFT_06g022050 [Sorghum bicolor]
Length=487

 Score =   224 bits (572),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 135/168 (80%), Gaps = 20/168 (12%)
 Frame = +3

Query  156  PTRLP---------NASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIK  308
            P RLP          AS+RC+A+ A+    V  + +I+VQNPIVEMDGDEMTRVIW +IK
Sbjct  47   PARLPVPGSARVLRGASLRCYAAAAA----VAEQSRIKVQNPIVEMDGDEMTRVIWKLIK  102

Query  309  EKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFG  488
            +KLIFP+LELD+KYYDLGILNRDAT+D+VT+ESAEATLKYNVA+KCATITPDETRVKEF 
Sbjct  103  DKLIFPYLELDVKYYDLGILNRDATNDEVTVESAEATLKYNVAVKCATITPDETRVKEFK  162

Query  489  LKSMWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            LKSMW+SPNGTIRNILNGTVFREPILCK        +++   +GR+ F
Sbjct  163  LKSMWRSPNGTIRNILNGTVFREPILCKNIPRILSGWKKPICIGRHAF  210



>ref|XP_004976171.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
[Setaria italica]
Length=493

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 132/154 (86%), Gaps = 10/154 (6%)
 Frame = +3

Query  171  NASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKY  350
             AS+RC+A+ A+  A    + +I+VQNPIVEMDGDEMTRVIW+MIK+KLIFP+LELD+KY
Sbjct  64   GASLRCYAAAAAVVA---EQGRIKVQNPIVEMDGDEMTRVIWSMIKDKLIFPYLELDVKY  120

Query  351  YDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRN  530
            YDLGILNRDAT+D+VT+ESAEATLKYNVA+KCATITPDETRVKEF LKSMW+SPNGTIRN
Sbjct  121  YDLGILNRDATNDEVTVESAEATLKYNVAVKCATITPDETRVKEFKLKSMWRSPNGTIRN  180

Query  531  ILNGTVFREPILCK-------IFQELFLVGRNPF  611
            ILNGTVFREPILCK        +++   +GR+ F
Sbjct  181  ILNGTVFREPILCKNIPRILSGWKKPICIGRHAF  214



>ref|XP_009390155.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=502

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 123/144 (85%), Gaps = 9/144 (6%)
 Frame = +3

Query  144  RLSSPTR--LPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKL  317
            R S PTR  +  +S+RC AS +    P E   +I+V NPIVEMDGDEMTRVIW MIKEKL
Sbjct  67   RFSFPTRFVVVGSSVRCLASFS----PAE---RIKVHNPIVEMDGDEMTRVIWRMIKEKL  119

Query  318  IFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKS  497
            IFP LELDIKY+DLG+LNRDATDD+VT+ESAEATLK+NVA+KCATITPDE RVKEF LKS
Sbjct  120  IFPFLELDIKYFDLGLLNRDATDDRVTVESAEATLKHNVAVKCATITPDEARVKEFKLKS  179

Query  498  MWKSPNGTIRNILNGTVFREPILC  569
            MW+SPNGTIRNILNGTVFREPILC
Sbjct  180  MWRSPNGTIRNILNGTVFREPILC  203



>ref|XP_007031534.1| Isocitrate/isopropylmalate dehydrogenase family protein isoform 
2, partial [Theobroma cacao]
 gb|EOY02460.1| Isocitrate/isopropylmalate dehydrogenase family protein isoform 
2, partial [Theobroma cacao]
Length=443

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 127/168 (76%), Gaps = 19/168 (11%)
 Frame = +3

Query  105  SSPKLFKEVFFRNRLSSPTRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEM  281
            SS + F      NR+   +  P A S+RCFAS+          D+++VQNPIVEMDGDEM
Sbjct  48   SSSRHFSNGALGNRVVFSSHFPRAVSLRCFASSTG-------FDRVQVQNPIVEMDGDEM  100

Query  282  TRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITP  461
            TR+IW+MIKEKLIFP+L LD+KY+DLGILNRDATDD VT ESAEA LKYNVAIKCATITP
Sbjct  101  TRIIWSMIKEKLIFPYLNLDVKYFDLGILNRDATDDNVTTESAEAALKYNVAIKCATITP  160

Query  462  DETRVKEFGLKSMWKSPNGTIRNILN-----------GTVFREPILCK  572
            DE RVKEFGLKSMW+SPNGTIRNILN           GTVFREPILC+
Sbjct  161  DEARVKEFGLKSMWRSPNGTIRNILNVLPDLRVALFVGTVFREPILCR  208



>emb|CAE04728.1| OSJNBa0043L24.16 [Oryza sativa Japonica Group]
 gb|EEE61309.1| hypothetical protein OsJ_15408 [Oryza sativa Japonica Group]
Length=468

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 131/157 (83%), Gaps = 10/157 (6%)
 Frame = +3

Query  162  RLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELD  341
            R   AS+RC+A+ A+  A    + +I+V NPIVEMDGDEMTRVIW MIK+KLIFP+LELD
Sbjct  38   RRGGASLRCYAAAAAAVA---EQHRIKVHNPIVEMDGDEMTRVIWKMIKDKLIFPYLELD  94

Query  342  IKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGT  521
            +KY+DLG+LNRDATDDKVT+ESAEATL+YNVA+KCATITPDETRVKEF LKSMW+SPNGT
Sbjct  95   VKYFDLGLLNRDATDDKVTVESAEATLEYNVAVKCATITPDETRVKEFKLKSMWRSPNGT  154

Query  522  IRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            IRNILNGTVFREPILCK        +++   +GR+ F
Sbjct  155  IRNILNGTVFREPILCKNVPRILSGWKKPICIGRHAF  191



>ref|NP_001053269.1| Os04g0508200 [Oryza sativa Japonica Group]
 dbj|BAF15183.1| Os04g0508200 [Oryza sativa Japonica Group]
 dbj|BAG91739.1| unnamed protein product [Oryza sativa Japonica Group]
Length=478

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 131/157 (83%), Gaps = 10/157 (6%)
 Frame = +3

Query  162  RLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELD  341
            R   AS+RC+A+ A+  A    + +I+V NPIVEMDGDEMTRVIW MIK+KLIFP+LELD
Sbjct  48   RRGGASLRCYAAAAAAVA---EQHRIKVHNPIVEMDGDEMTRVIWKMIKDKLIFPYLELD  104

Query  342  IKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGT  521
            +KY+DLG+LNRDATDDKVT+ESAEATL+YNVA+KCATITPDETRVKEF LKSMW+SPNGT
Sbjct  105  VKYFDLGLLNRDATDDKVTVESAEATLEYNVAVKCATITPDETRVKEFKLKSMWRSPNGT  164

Query  522  IRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            IRNILNGTVFREPILCK        +++   +GR+ F
Sbjct  165  IRNILNGTVFREPILCKNVPRILSGWKKPICIGRHAF  201



>emb|CAH67563.1| OSIGBa0101P20.6 [Oryza sativa Indica Group]
Length=468

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 131/157 (83%), Gaps = 10/157 (6%)
 Frame = +3

Query  162  RLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELD  341
            R   AS+RC+A+ A+  A    + +I+V NPIVEMDGDEMTRVIW MIK+KLIFP+LELD
Sbjct  38   RRGGASLRCYAAAAAAVA---EQHRIKVHNPIVEMDGDEMTRVIWKMIKDKLIFPYLELD  94

Query  342  IKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGT  521
            +KY+DLG+LNRDATDDKVT+ESAEATL+YNVA+KCATITPDETRVKE+ LKSMW+SPNGT
Sbjct  95   VKYFDLGLLNRDATDDKVTVESAEATLEYNVAVKCATITPDETRVKEYKLKSMWRSPNGT  154

Query  522  IRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            IRNILNGTVFREPILCK        +++   +GR+ F
Sbjct  155  IRNILNGTVFREPILCKNVPRILSGWKKPICIGRHAF  191



>gb|EEC77605.1| hypothetical protein OsI_16579 [Oryza sativa Indica Group]
Length=468

 Score =   221 bits (564),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 131/157 (83%), Gaps = 10/157 (6%)
 Frame = +3

Query  162  RLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELD  341
            R   AS+RC+A+ A+  A    + +I+V NPIVEMDGDEMTRVIW MIK+KLIFP+LELD
Sbjct  38   RRGGASLRCYAAAAAAVA---EQHRIKVHNPIVEMDGDEMTRVIWKMIKDKLIFPYLELD  94

Query  342  IKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGT  521
            +KY+DLG+LNRDATDDKVT+ESAEATL+YNVA+KCATITPDETRVKE+ LKSMW+SPNGT
Sbjct  95   VKYFDLGLLNRDATDDKVTVESAEATLEYNVAVKCATITPDETRVKEYKLKSMWRSPNGT  154

Query  522  IRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            IRNILNGTVFREPILCK        +++   +GR+ F
Sbjct  155  IRNILNGTVFREPILCKNVPRILSGWKKPICIGRHAF  191



>gb|ABR16155.1| unknown [Picea sitchensis]
Length=418

 Score =   220 bits (560),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 118/134 (88%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+VQNPIVEMDGDEMTRVIWTMIK+KLIFP +ELDIKY+DLG+ +RDATDDKVT+ESA
Sbjct  4    EKIKVQNPIVEMDGDEMTRVIWTMIKDKLIFPFVELDIKYFDLGLPHRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEFGLK+MWKSPNGTIRNILNGTVFREPI+CK   +L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFGLKAMWKSPNGTIRNILNGTVFREPIMCKNVPKLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|ACN40177.1| unknown [Picea sitchensis]
Length=418

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 118/134 (88%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+VQNPIVEMDGDEMTRVIWTMIK+KLIFP +ELDIKY+DLG+ +RDATDDKVT+ESA
Sbjct  4    EKIKVQNPIVEMDGDEMTRVIWTMIKDKLIFPFVELDIKYFDLGLPHRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEFGLK+MWKSPNGTIRNILNGTVFREPI+CK   +L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFGLKAMWKSPNGTIRNILNGTVFREPIMCKNVPKLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_010940160.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X2 [Elaeis 
guineensis]
Length=487

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 119/133 (89%), Gaps = 8/133 (6%)
 Frame = +3

Query  171  NASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKY  350
            + S+RCFAS+      + T D+I+VQNPIVEMDGDEMTRVIW MIKEKLI+PHL+LDIKY
Sbjct  64   DVSLRCFASS------IATVDRIKVQNPIVEMDGDEMTRVIWKMIKEKLIYPHLDLDIKY  117

Query  351  YDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRN  530
            +DLGILNRDATDD+VT+ESAEATLKYNVA+KCATITPDE R+KEF LKSMW+SPNGTIRN
Sbjct  118  FDLGILNRDATDDRVTVESAEATLKYNVAVKCATITPDEARMKEFKLKSMWRSPNGTIRN  177

Query  531  ILNGTVFREPILC  569
            ILN  VFREPILC
Sbjct  178  ILN--VFREPILC  188



>gb|AAR05796.1| NADP+-isocitrate dehydrogenase [Pinus pinaster]
Length=417

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 117/134 (87%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V+NPIVEMDGDEMTRVIWTMIK+KLIFP +ELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVENPIVEMDGDEMTRVIWTMIKDKLIFPFVELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK+MWKSPNGTIRNILNGTVFREPILCK   +L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFDLKAMWKSPNGTIRNILNGTVFREPILCKNVPKLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKAICIGRHAF  137



>ref|XP_007151010.1| hypothetical protein PHAVU_004G011200g [Phaseolus vulgaris]
 gb|ESW23004.1| hypothetical protein PHAVU_004G011200g [Phaseolus vulgaris]
Length=475

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 124/146 (85%), Gaps = 16/146 (11%)
 Frame = +3

Query  135  FRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEK  314
            F NRLS         +RC+A+ A+        +++ V NPIVEMDGDEMTR+IW+MIK+K
Sbjct  48   FSNRLS---------LRCYAARAAF-------NRLPVLNPIVEMDGDEMTRIIWSMIKDK  91

Query  315  LIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLK  494
            LIFP+L+L+IKY+DLG+ NRDATDDKVT+ESAEATLKYNVA+KCATITPDETRVKEFGLK
Sbjct  92   LIFPYLDLNIKYFDLGLQNRDATDDKVTVESAEATLKYNVAVKCATITPDETRVKEFGLK  151

Query  495  SMWKSPNGTIRNILNGTVFREPILCK  572
            SMW+SPNGTIRNILNGTVFREPI+C+
Sbjct  152  SMWRSPNGTIRNILNGTVFREPIICR  177



>gb|AIZ74341.1| isocitrate dehydrogenase [Pinus massoniana]
Length=490

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DKI+V+NP+VEMDGDEMTRVIW MIK+KLIFP+LELD+KY+DLG+ NRDAT+D+VT+ESA
Sbjct  76   DKIKVENPVVEMDGDEMTRVIWHMIKDKLIFPYLELDLKYFDLGLPNRDATNDRVTVESA  135

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQELF  590
            EATLKYNVA+KCATITPDE R+KEFGLKSMWKSPNGTIRNILNGTVFREPI+CK   +L 
Sbjct  136  EATLKYNVAVKCATITPDEGRLKEFGLKSMWKSPNGTIRNILNGTVFREPIMCKNIPKLI  195

Query  591  LVGRNPFVL  617
               + P  +
Sbjct  196  AGWKKPICI  204



>ref|XP_003525669.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial-like 
[Glycine max]
Length=470

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 122/145 (84%), Gaps = 16/145 (11%)
 Frame = +3

Query  135  FRNRLSSPTRLPNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEK  314
            F NRLS         +RC+A+ A+        D++ V NPIVEMDGDEMTR+IW MIK+K
Sbjct  43   FSNRLS---------LRCYAARAAF-------DRVPVLNPIVEMDGDEMTRIIWRMIKDK  86

Query  315  LIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLK  494
            LIFP+L+L+IKY+DLG+ NRDATDD+VT+ESAEATLKYNVA+KCATITPDETRVKEFGLK
Sbjct  87   LIFPYLDLNIKYFDLGLQNRDATDDRVTVESAEATLKYNVAVKCATITPDETRVKEFGLK  146

Query  495  SMWKSPNGTIRNILNGTVFREPILC  569
            SMW+SPNGTIRNILNGTVFREPI+C
Sbjct  147  SMWRSPNGTIRNILNGTVFREPIIC  171



>ref|XP_003618179.1| Isocitrate dehydrogenase-like protein [Medicago truncatula]
 gb|AES74397.1| NADP-dependent isocitrate dehydrogenase [Medicago truncatula]
Length=482

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 117/135 (87%), Gaps = 10/135 (7%)
 Frame = +3

Query  168  PNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIK  347
            P   +RCFAS+            I V NPIVEMDGDEMTR+IW MIK+KLIFP+L+L+IK
Sbjct  60   PFIPLRCFASSTP----------IHVANPIVEMDGDEMTRIIWKMIKDKLIFPYLDLNIK  109

Query  348  YYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIR  527
            Y+DLG+LNRDAT+D+VT+ESAEATLKYNVA+KCATITPDETRVKEFGLKSMW+SPNGTIR
Sbjct  110  YFDLGVLNRDATEDRVTVESAEATLKYNVAVKCATITPDETRVKEFGLKSMWRSPNGTIR  169

Query  528  NILNGTVFREPILCK  572
            NILNGTVFREPI+C+
Sbjct  170  NILNGTVFREPIICR  184



>ref|XP_002989225.1| hypothetical protein SELMODRAFT_129507 [Selaginella moellendorffii]
 gb|EFJ09663.1| hypothetical protein SELMODRAFT_129507 [Selaginella moellendorffii]
Length=416

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 116/134 (87%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            ++I+V NPIVEMDGDEM RVIW+MIKEKL+ P +++DIKYYDLGILNRDATDDKVT ESA
Sbjct  4    ERIKVDNPIVEMDGDEMARVIWSMIKEKLVVPFVDVDIKYYDLGILNRDATDDKVTAESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK------  572
            +ATL+YNVA+KCATITPDETRVKEFGLK MWKSPNGTIRNILNGTVFREPILCK      
Sbjct  64   QATLRYNVAVKCATITPDETRVKEFGLKRMWKSPNGTIRNILNGTVFREPILCKNIPRLV  123

Query  573  -IFQELFLVGRNPF  611
              +Q+   +GR+ F
Sbjct  124  PGWQKPICIGRHAF  137



>ref|XP_002966002.1| hypothetical protein SELMODRAFT_84397 [Selaginella moellendorffii]
 gb|EFJ33422.1| hypothetical protein SELMODRAFT_84397 [Selaginella moellendorffii]
Length=416

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 116/134 (87%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            ++I+V NPIVEMDGDEM RVIW+MIKEKL+ P +++DIKYYDLGILNRDATDDKVT ESA
Sbjct  4    ERIKVDNPIVEMDGDEMARVIWSMIKEKLVVPFVDVDIKYYDLGILNRDATDDKVTAESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK------  572
            +ATL+YNVA+KCATITPDETRVKEFGLK MWKSPNGTIRNILNGTVFREPILCK      
Sbjct  64   QATLRYNVAVKCATITPDETRVKEFGLKRMWKSPNGTIRNILNGTVFREPILCKNIPRLV  123

Query  573  -IFQELFLVGRNPF  611
              +Q+   +GR+ F
Sbjct  124  PGWQKPICIGRHAF  137



>ref|XP_011047331.1| PREDICTED: isocitrate dehydrogenase [NADP] [Populus euphratica]
Length=504

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 130/152 (86%), Gaps = 6/152 (4%)
 Frame = +3

Query  129  VFFRNRL--SSP-TRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIW  296
             F +NR+  SSP +    A S+RCF+S++  ++     D+++VQNPIVEMDGDEM R+IW
Sbjct  57   AFVKNRVTFSSPASHFTRALSLRCFSSSS--SSSSSGFDRVQVQNPIVEMDGDEMARIIW  114

Query  297  TMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRV  476
             MIK+KLI+P+L+LDIKY+DLGILNRDATDDKVT+ESA A L+YNVA+KCATITPDE RV
Sbjct  115  KMIKDKLIYPYLDLDIKYFDLGILNRDATDDKVTVESALAALEYNVAVKCATITPDEARV  174

Query  477  KEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            KEFGLKSMW+SPNGTIRNILNGTVFREPILC+
Sbjct  175  KEFGLKSMWRSPNGTIRNILNGTVFREPILCR  206



>ref|XP_009363306.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Pyrus x bretschneideri]
Length=417

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 115/138 (83%), Gaps = 7/138 (5%)
 Frame = +3

Query  219  VETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVT  398
            +E  DKI+V NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLGILNRDAT+D+VT
Sbjct  1    MEAFDKIKVTNPIVEMDGDEMTRVFWKWIKDKLIFPFLELDIKYFDLGILNRDATNDRVT  60

Query  399  IESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIF  578
            IESAEATLKYNVAIKCATITPDETRVKEF LK MW+SPNGTIRNILNGTVFREPI+C+  
Sbjct  61   IESAEATLKYNVAIKCATITPDETRVKEFNLKQMWRSPNGTIRNILNGTVFREPIICRNV  120

Query  579  QEL-------FLVGRNPF  611
              L         +GR+ F
Sbjct  121  PRLVPGWTMPICIGRHAF  138



>ref|XP_010669953.1| PREDICTED: isocitrate dehydrogenase [NADP] [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669954.1| PREDICTED: isocitrate dehydrogenase [NADP] [Beta vulgaris subsp. 
vulgaris]
Length=410

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DKI V NPIVEMDGDEMTRVIW MIK+KLIFP LELDIKY+DLG+ +RDATDDKVT+ESA
Sbjct  4    DKINVTNPIVEMDGDEMTRVIWQMIKDKLIFPFLELDIKYFDLGLPHRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            +ATLKYNVAIKCATITPDE RVKEF LKSMW+SPNGTIRNILNGTVFREPILCK    L 
Sbjct  64   QATLKYNVAIKCATITPDEARVKEFNLKSMWRSPNGTIRNILNGTVFREPILCKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_010462488.1| PREDICTED: peroxisomal isocitrate dehydrogenase [NADP]-like isoform 
X2 [Camelina sativa]
Length=178

 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NP+VEMDGDEMTRVIW  IK+KLIFP LELDIKY+DLG+ NRD+TDDKVT+ESA
Sbjct  4    EKIKVANPVVEMDGDEMTRVIWKFIKDKLIFPFLELDIKYFDLGLPNRDSTDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            EATLKYNVAIKCATITPDE RV+EFGLK MW+SPNGTIRNILNGTVFREPI+C+
Sbjct  64   EATLKYNVAIKCATITPDEARVREFGLKKMWRSPNGTIRNILNGTVFREPIICR  117



>ref|XP_006858533.1| hypothetical protein AMTR_s00071p00157830 [Amborella trichopoda]
 gb|ERN20000.1| hypothetical protein AMTR_s00071p00157830 [Amborella trichopoda]
Length=416

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 115/134 (86%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI VQNPIVEMDGDEMTR+IW MIK+KLIFP LELDIKY+DL +++RDATDD++T+ESA
Sbjct  4    EKIHVQNPIVEMDGDEMTRIIWQMIKDKLIFPFLELDIKYFDLDLMSRDATDDRITVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEFGLK+MW+SPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFGLKAMWRSPNGTIRNILNGTVFREPIMCKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_011085932.1| PREDICTED: isocitrate dehydrogenase [NADP] [Sesamum indicum]
Length=412

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLIFP LELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKFIKDKLIFPFLELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LKSMWKSPNGTIRNILNGTVFREPILCK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFNLKSMWKSPNGTIRNILNGTVFREPILCKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_010913457.1| PREDICTED: isocitrate dehydrogenase [NADP] [Elaeis guineensis]
Length=409

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DKI+V NP+VEMDGDEMTRV W  IKEKLIFP L+LDIKY+DLG+ NRDATDDKVT+ESA
Sbjct  4    DKIKVANPVVEMDGDEMTRVFWKSIKEKLIFPFLDLDIKYFDLGLPNRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LKSMWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFNLKSMWKSPNGTIRNILNGTVFREPIICKNIPRLI  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_002298528.2| hypothetical protein POPTR_0001s35080g [Populus trichocarpa]
 gb|EEE83333.2| hypothetical protein POPTR_0001s35080g [Populus trichocarpa]
Length=503

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 132/152 (87%), Gaps = 7/152 (5%)
 Frame = +3

Query  129  VFFRNRL--SSP-TRLPNA-SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIW  296
             F +NR+  SSP + +  A S+RCF+S++S ++     D+++VQNPIVEMDGDEM R+IW
Sbjct  57   AFVKNRVTFSSPASHITRALSLRCFSSSSSSSSGF---DRVQVQNPIVEMDGDEMARIIW  113

Query  297  TMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRV  476
             MIK+KLI+P+L+LDIKY+DLGILNRDATDDKVT+ESA A L+Y+VA+KCATITPDE RV
Sbjct  114  KMIKDKLIYPYLDLDIKYFDLGILNRDATDDKVTVESALAALEYSVAVKCATITPDEARV  173

Query  477  KEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            KEFGLKSMW+SPNGTIRNILNGTVFREPILC+
Sbjct  174  KEFGLKSMWRSPNGTIRNILNGTVFREPILCR  205



>ref|NP_001136968.1| seed maturation protein PM41 [Zea mays]
 gb|ACF82986.1| unknown [Zea mays]
 tpg|DAA58298.1| TPA: seed maturation protein PM41 [Zea mays]
Length=412

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IK+KLIFP L+LDIKYYDLGIL+RDATDDKVT+E+A
Sbjct  4    EKIKVSNPIVEMDGDEMTRVFWQSIKDKLIFPFLDLDIKYYDLGILHRDATDDKVTVEAA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDETRVKEF LK MWKSPNGTIRNI+NGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDETRVKEFNLKHMWKSPNGTIRNIINGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_010462487.1| PREDICTED: peroxisomal isocitrate dehydrogenase [NADP]-like isoform 
X1 [Camelina sativa]
Length=189

 Score =   206 bits (523),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NP+VEMDGDEMTRVIW  IK+KLIFP LELDIKY+DLG+ NRD+TDDKVT+ESA
Sbjct  4    EKIKVANPVVEMDGDEMTRVIWKFIKDKLIFPFLELDIKYFDLGLPNRDSTDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            EATLKYNVAIKCATITPDE RV+EFGLK MW+SPNGTIRNILNGTVFREPI+C+
Sbjct  64   EATLKYNVAIKCATITPDEARVREFGLKKMWRSPNGTIRNILNGTVFREPIICR  117



>gb|KGN50927.1| hypothetical protein Csa_5G346550 [Cucumis sativus]
Length=392

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 111/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK KLIFP LELDIKY+DLG+ +RDATDDKVTIESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVIWESIKNKLIFPFLELDIKYFDLGLPHRDATDDKVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLK MW+SPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFGLKQMWRSPNGTIRNILNGTVFREPILCKNVPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_008798438.1| PREDICTED: LOW QUALITY PROTEIN: isocitrate dehydrogenase [NADP]-like 
[Phoenix dactylifera]
Length=411

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DKI+V NP+VEMDGDEMTRV W  IKEKLIFP L+LDIKY+DLG+ NRDATDDKVT+ESA
Sbjct  4    DKIKVANPVVEMDGDEMTRVFWKSIKEKLIFPFLDLDIKYFDLGLPNRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LKSMWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFNLKSMWKSPNGTIRNILNGTVFREPIICKNIPRLI  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|ABK24873.1| unknown [Picea sitchensis]
Length=490

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DKI+V+NP+VEMDGDEM RVIW MIK+KLIFP+LELD+KY+DLG+ NRDATDD+VT+ESA
Sbjct  76   DKIKVENPVVEMDGDEMARVIWHMIKDKLIFPYLELDLKYFDLGLPNRDATDDRVTVESA  135

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            EATL+YNVA+KCATITPDE R+KEFGLKSMW+SPNGTIRNILNGTVFREPI+CK
Sbjct  136  EATLEYNVAVKCATITPDEGRLKEFGLKSMWRSPNGTIRNILNGTVFREPIMCK  189



>dbj|BAC77065.1| NADP-specific isocitrate dehydrogenase [Lupinus albus]
Length=485

 Score =   214 bits (545),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 118/132 (89%), Gaps = 7/132 (5%)
 Frame = +3

Query  177  SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYD  356
            S+RC+A     T P     +++V NPIVEMDGDEMTR+IW MIK+KLIFP+L+L+IKY+D
Sbjct  62   SLRCYA-----THP--NFHRLQVLNPIVEMDGDEMTRIIWKMIKDKLIFPYLDLNIKYFD  114

Query  357  LGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNIL  536
            LG+ NRDATDD+VT+ESAEATLKYNVA+KCATITPDETRVKEFGLKSMW+SPNGTIRNIL
Sbjct  115  LGVENRDATDDRVTVESAEATLKYNVAVKCATITPDETRVKEFGLKSMWRSPNGTIRNIL  174

Query  537  NGTVFREPILCK  572
            NGTVFREPI+C+
Sbjct  175  NGTVFREPIICR  186



>ref|XP_002969739.1| hypothetical protein SELMODRAFT_267315 [Selaginella moellendorffii]
 gb|EFJ28863.1| hypothetical protein SELMODRAFT_267315 [Selaginella moellendorffii]
Length=418

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 115/134 (86%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V+NPIVEMDGDEMTR+IW MIK+KLIFP L+LDIKY+DLG+ +RD TDDKVT+ESA
Sbjct  4    EKIKVENPIVEMDGDEMTRIIWQMIKDKLIFPFLDLDIKYFDLGLPHRDETDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEFGLK+MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFGLKAMWKSPNGTIRNILNGTVFREPIVCKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>emb|CAD24779.1| isocitrate dehydrogenase [Cucumis sativus]
Length=410

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 111/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK KLIFP LELDIKY+DLG+ +RDATDDKVTIESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVIWESIKNKLIFPFLELDIKYFDLGLPHRDATDDKVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLK MW+SPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFGLKQMWRSPNGTIRNILNGTVFREPILCKNVPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_006596496.1| PREDICTED: isocitrate dehydrogenase [NADP] [Glycine max]
 sp|Q06197.2|IDHC_SOYBN RecName: Full=Isocitrate dehydrogenase [NADP]; Short=IDH; AltName: 
Full=IDP; AltName: Full=NADP(+)-specific ICDH; AltName: 
Full=Oxalosuccinate decarboxylase [Glycine max]
Length=413

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKYYDLG+  RD TDDKVTIESAE
Sbjct  6    KIKVANPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYYDLGLPYRDETDDKVTIESAE  65

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK    L  
Sbjct  66   ATLKYNVAIKCATITPDEARVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKNIPRLVP  125

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  126  GWTKAICIGRHAF  138



>gb|AAA33978.1| NADPH-specific isocitrate dehydrogenase, partial [Glycine max]
Length=441

 Score =   213 bits (541),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKYYDLG+  RD TDDKVTIESAE
Sbjct  34   KIKVANPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYYDLGLPYRDETDDKVTIESAE  93

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK    L  
Sbjct  94   ATLKYNVAIKCATITPDEARVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKNIPRLVP  153

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  154  GWTKAICIGRHAF  166



>ref|XP_006644455.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like [Oryza 
brachyantha]
Length=412

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KIRV NPIVEMDGDEMTRV W  IK+KLIFP L+LDIKYYDLGIL+RDATDDKVT+E+A
Sbjct  4    EKIRVANPIVEMDGDEMTRVFWQSIKDKLIFPFLDLDIKYYDLGILHRDATDDKVTVEAA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNI+NGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFNLKHMWKSPNGTIRNIINGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>pir||S33612 isocitrate dehydrogenase (NADP) (EC 1.1.1.42) - soybean
Length=451

 Score =   213 bits (542),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKYYDLG+  RD TDDKVTIESAE
Sbjct  44   KIKVANPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYYDLGLPYRDETDDKVTIESAE  103

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK    L  
Sbjct  104  ATLKYNVAIKCATITPDEARVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKNIPRLVP  163

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  164  GWTKAICIGRHAF  176



>ref|XP_008463133.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] isoform 
X3 [Cucumis melo]
Length=410

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 111/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK KLIFP LELDIKY+DLG+ +RDATDDKVTIESAE
Sbjct  5    KIKVTNPIVEMDGDEMTRVIWESIKNKLIFPFLELDIKYFDLGLPHRDATDDKVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLK MW+SPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFGLKQMWRSPNGTIRNILNGTVFREPILCKNVPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_004157023.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
[Cucumis sativus]
Length=410

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 111/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK KLIFP LELDIKY+DLG+ +RDATDDKVTIESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVIWESIKNKLIFPFLELDIKYFDLGLPHRDATDDKVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLK MW+SPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFGLKQMWRSPNGTIRNILNGTVFREPILCKNVPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_008463131.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Cucumis 
melo]
Length=417

 Score =   212 bits (539),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 111/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK KLIFP LELDIKY+DLG+ +RDATDDKVTIESAE
Sbjct  5    KIKVTNPIVEMDGDEMTRVIWESIKNKLIFPFLELDIKYFDLGLPHRDATDDKVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLK MW+SPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFGLKQMWRSPNGTIRNILNGTVFREPILCKNVPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_008463132.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] isoform 
X2 [Cucumis melo]
Length=412

 Score =   212 bits (539),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 111/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK KLIFP LELDIKY+DLG+ +RDATDDKVTIESAE
Sbjct  5    KIKVTNPIVEMDGDEMTRVIWESIKNKLIFPFLELDIKYFDLGLPHRDATDDKVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLK MW+SPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFGLKQMWRSPNGTIRNILNGTVFREPILCKNVPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_008371955.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Malus 
domestica]
Length=478

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 114/140 (81%), Gaps = 7/140 (5%)
 Frame = +3

Query  213  APVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDK  392
              +E  DKI+V NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLGILNRDAT D+
Sbjct  60   GEMEAFDKIKVTNPIVEMDGDEMTRVFWKWIKDKLIFPFLELDIKYFDLGILNRDATSDR  119

Query  393  VTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            VTIESAEATLKYNVAIKCATITPDETRVKEF LK MW+SPNGTIRNILNGTVFREPI+C+
Sbjct  120  VTIESAEATLKYNVAIKCATITPDETRVKEFNLKQMWRSPNGTIRNILNGTVFREPIICR  179

Query  573  IFQEL-------FLVGRNPF  611
                L         +GR+ F
Sbjct  180  NVPRLVPGWTMPICIGRHAF  199



>ref|XP_008371954.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Malus 
domestica]
Length=480

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 114/140 (81%), Gaps = 7/140 (5%)
 Frame = +3

Query  213  APVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDK  392
              +E  DKI+V NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLGILNRDAT D+
Sbjct  62   GEMEAFDKIKVTNPIVEMDGDEMTRVFWKWIKDKLIFPFLELDIKYFDLGILNRDATSDR  121

Query  393  VTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            VTIESAEATLKYNVAIKCATITPDETRVKEF LK MW+SPNGTIRNILNGTVFREPI+C+
Sbjct  122  VTIESAEATLKYNVAIKCATITPDETRVKEFNLKQMWRSPNGTIRNILNGTVFREPIICR  181

Query  573  IFQEL-------FLVGRNPF  611
                L         +GR+ F
Sbjct  182  NVPRLVPGWTMPICIGRHAF  201



>ref|XP_002981348.1| hypothetical protein SELMODRAFT_268459 [Selaginella moellendorffii]
 gb|EFJ17536.1| hypothetical protein SELMODRAFT_268459 [Selaginella moellendorffii]
Length=418

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 114/134 (85%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V+NPIVEMDGDEMTR+IW MIK+KLIFP L+LDIKY+DLG+  RD TDDKVT+ESA
Sbjct  4    EKIKVENPIVEMDGDEMTRIIWQMIKDKLIFPFLDLDIKYFDLGLPRRDETDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEFGLK+MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFGLKAMWKSPNGTIRNILNGTVFREPIVCKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_004969349.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like [Setaria 
italica]
Length=412

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IK+KLIFP ++LDIKYYDLGIL+RDATDDKVT+E+A
Sbjct  4    EKIKVANPIVEMDGDEMTRVFWQSIKDKLIFPFVDLDIKYYDLGILHRDATDDKVTVEAA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDETRVKEF LK MWKSPNGTIRNI+NGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDETRVKEFNLKHMWKSPNGTIRNIINGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_004150540.1| PREDICTED: LOW QUALITY PROTEIN: isocitrate dehydrogenase [NADP], 
chloroplastic-like [Cucumis sativus]
Length=420

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 111/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK KLIFP LELDIKY+DLG+ +RDATDDKVTIESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVIWESIKNKLIFPFLELDIKYFDLGLPHRDATDDKVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLK MW+SPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFGLKQMWRSPNGTIRNILNGTVFREPILCKNVPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>gb|EYU33810.1| hypothetical protein MIMGU_mgv1a007171mg [Erythranthe guttata]
Length=416

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DKI+V NPIVEMDGDEMTRVIW  IKEKLI P LELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    DKIKVDNPIVEMDGDEMTRVIWKYIKEKLILPFLELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFNLKQMWKSPNGTIRNILNGTVFREPIMCKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|AFK47062.1| unknown [Lotus japonicus]
Length=231

 Score =   206 bits (523),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 112/133 (84%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW +IK+KLIFP LELDIKY+DLG+ +RDAT+D+VTIESAE
Sbjct  5    KIKVDNPIVEMDGDEMTRVIWKLIKDKLIFPFLELDIKYFDLGLPHRDATNDRVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFNLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLVS  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>gb|KHN41035.1| Isocitrate dehydrogenase [NADP] [Glycine soja]
Length=413

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKYYDLG+  RD TDDKVTIESAE
Sbjct  6    KIKVVNPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYYDLGLPYRDETDDKVTIESAE  65

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK    L  
Sbjct  66   ATLKYNVAIKCATITPDEARVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKNIPRLVP  125

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  126  GWTKAICIGRHAF  138



>ref|NP_001241237.1| uncharacterized protein LOC100786103 [Glycine max]
 gb|ACU18009.1| unknown [Glycine max]
Length=413

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKYYDLG+  RD TDDKVTIESAE
Sbjct  6    KIKVVNPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYYDLGLPYRDETDDKVTIESAE  65

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK    L  
Sbjct  66   ATLKYNVAIKCATITPDEARVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKNIPRLVP  125

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  126  GWTKAICIGRHAF  138



>ref|NP_001142417.1| uncharacterized protein LOC100274592 [Zea mays]
 gb|ACF88442.1| unknown [Zea mays]
Length=412

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IK+KLI P L+LDIKYYDLGIL+R+ATDDKVT+E+A
Sbjct  4    EKIKVSNPIVEMDGDEMTRVFWQSIKDKLILPFLDLDIKYYDLGILHREATDDKVTVEAA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDETRVKEF LK MWKSPNGTIRNI+NGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDETRVKEFNLKHMWKSPNGTIRNIINGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+PF
Sbjct  124  PGWTKPICIGRHPF  137



>emb|CDP01688.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+DLG+ +RDATDDKVT+ESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKAIKDKLILPFLELDIKYFDLGLPHRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            EATLKYNVAIKCATITPDE RVKEFGLK+MWKSPNGTIRNILNGTVFREPILCK
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFGLKAMWKSPNGTIRNILNGTVFREPILCK  117



>ref|XP_010924866.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Elaeis 
guineensis]
Length=411

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DK++V NPIVEMDGDEMTRVIW  IKEKLIFP L+LD+KY+DLG+ +RDATDDKVT+ESA
Sbjct  4    DKVKVANPIVEMDGDEMTRVIWKSIKEKLIFPFLDLDVKYFDLGLPHRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATL+YNVAIKCATITPDE RVKEF LKSMWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLRYNVAIKCATITPDEARVKEFNLKSMWKSPNGTIRNILNGTVFREPIICKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|AEB78733.1| putative NADP+-dependent isocitrate dehydrogenase [Lupinus luteus]
Length=134

 Score =   202 bits (513),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 108/130 (83%), Gaps = 1/130 (1%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK+KLI P L+LDIKYYDLG+  RD TDDK T+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVIWKSIKDKLILPFLDLDIKYYDLGLPYRDETDDKATVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQELFL  593
            ATLKYNVAIKCATI PDE RVKEFGLK MWKSPNGTIRNILNGTVFREPILCK    L L
Sbjct  65   ATLKYNVAIKCATIRPDEARVKEFGLKQMWKSPNGTIRNILNGTVFREPILCKNIPRL-L  123

Query  594  VGRNPFVLVG  623
             G N  + +G
Sbjct  124  PGWNKPICIG  133



>ref|XP_002312216.2| NADP-dependent isocitrate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE89583.2| NADP-dependent isocitrate dehydrogenase family protein [Populus 
trichocarpa]
Length=428

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DKI+V NPIVEMDGDEMTRVIW  IK+KLIFP L+LDIKY+DLG+ NRDATDD+VTIESA
Sbjct  16   DKIKVTNPIVEMDGDEMTRVIWKSIKDKLIFPFLDLDIKYFDLGLPNRDATDDRVTIESA  75

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK+MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  76   EATLKYNVAIKCATITPDEGRVKEFNLKNMWKSPNGTIRNILNGTVFREPIICKNIPRLV  135

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  136  SGWTMPICIGRHAF  149



>ref|XP_010528595.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like [Tarenaya 
hassleriana]
Length=413

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DKI+V NPIVEMDGDEMTRVIW  IK+KLIFP +ELDIKY+DLG+ +RDAT+DKVT+ESA
Sbjct  4    DKIKVTNPIVEMDGDEMTRVIWKSIKDKLIFPFVELDIKYFDLGLPHRDATNDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEFGLK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFGLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|KHG29051.1| Isocitrate dehydrogenase [NADP], chloroplastic [Gossypium arboreum]
Length=481

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 129/165 (78%), Gaps = 27/165 (16%)
 Frame = +3

Query  177  SIRCFASTASGTAPVETKDKIRVQNPIVEMDG-------------DEMTRVIWTMIKEKL  317
            S+RC+AST+         D+++V+NP+VEMDG             DEMTR+IW+MIK+KL
Sbjct  46   SLRCYASTSGF-------DRVQVRNPVVEMDGEAIDQTAIYDENRDEMTRIIWSMIKDKL  98

Query  318  IFPHLELDIKYYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKS  497
            I P+L+L+IKY+DLGIL+RDATDDKVT+E+AEA LKYNVAIKCATITPDETRVKEFGLKS
Sbjct  99   ILPYLDLNIKYFDLGILSRDATDDKVTVEAAEAALKYNVAIKCATITPDETRVKEFGLKS  158

Query  498  MWKSPNGTIRNILNGTVFREPILCK-------IFQELFLVGRNPF  611
            MW+SPNGTIRNILNGTVFREPILCK        +++   +GR+ F
Sbjct  159  MWRSPNGTIRNILNGTVFREPILCKNVPRIVPGWKKPICIGRHAF  203



>ref|XP_002315093.2| NADP-dependent isocitrate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEF01264.2| NADP-dependent isocitrate dehydrogenase family protein [Populus 
trichocarpa]
Length=428

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DKI+V NPIVEMDGDEMTRVIW  IK+KLIFP L+LDIKY+DLG+ NRDATDD+VT+ESA
Sbjct  16   DKIKVTNPIVEMDGDEMTRVIWKSIKDKLIFPFLDLDIKYFDLGLPNRDATDDRVTVESA  75

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK+MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  76   EATLKYNVAIKCATITPDEGRVKEFNLKNMWKSPNGTIRNILNGTVFREPIICKNIPRLV  135

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  136  SGWTKPICIGRHAF  149



>dbj|BAA34112.1| NADP specific isocitrate dehydrogenase [Daucus carota]
Length=412

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 112/133 (84%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLIFP +ELDIKY+DLG+ +RDATDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFVELDIKYFDLGLPHRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLK MWKSPNGTIRNILNGTVFREPI+CK   +L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFGLKQMWKSPNGTIRNILNGTVFREPIICKNIPKLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_010260857.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Nelumbo 
nucifera]
Length=418

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IKEKLIFP LELDIKY+DLG+ NRD+TDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVFWKSIKEKLIFPFLELDIKYFDLGLPNRDSTDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK------  572
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK      
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFNLKYMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  573  -IFQELFLVGRNPF  611
              + +   +GR+ F
Sbjct  124  PGWTKAICIGRHAF  137



>ref|XP_004489246.1| PREDICTED: LOW QUALITY PROTEIN: isocitrate dehydrogenase [NADP], 
chloroplastic/mitochondrial-like [Cicer arietinum]
Length=471

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 115/132 (87%), Gaps = 11/132 (8%)
 Frame = +3

Query  177  SIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYD  356
            S+RC A     T P      I V NPIVEMDGDEMTR+IW MIK+KLIFP+L+L+IKY+D
Sbjct  53   SLRCLA-----TRP------IHVINPIVEMDGDEMTRIIWKMIKDKLIFPYLDLNIKYFD  101

Query  357  LGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNIL  536
            LGI NRDATDD+VT+ESAEATLKYNVA+KCATITPDETRVKEFGLKSMW+SPNGTIRNIL
Sbjct  102  LGIENRDATDDRVTVESAEATLKYNVAVKCATITPDETRVKEFGLKSMWRSPNGTIRNIL  161

Query  537  NGTVFREPILCK  572
            NGTVFREPI+C+
Sbjct  162  NGTVFREPIICR  173



>ref|XP_010260858.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X2 [Nelumbo 
nucifera]
Length=416

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IKEKLIFP LELDIKY+DLG+ NRD+TDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVFWKSIKEKLIFPFLELDIKYFDLGLPNRDSTDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK------  572
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK      
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFNLKYMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  573  -IFQELFLVGRNPF  611
              + +   +GR+ F
Sbjct  124  PGWTKAICIGRHAF  137



>dbj|BAC77063.1| NADP-specific isocitrate dehydrogenase [Lupinus albus]
Length=412

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI V NPIVEMDGDEMTRVIW  IK+KLIFP LELDIKYYDLG+  RD TDDKVT+ESAE
Sbjct  5    KINVANPIVEMDGDEMTRVIWKSIKDKLIFPFLELDIKYYDLGLPYRDETDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQELFL  593
            ATLKYNVAIKCATITPDE RVKEFGLK MW+SPNGTIRNILNGTVFREPILCK    L L
Sbjct  65   ATLKYNVAIKCATITPDEGRVKEFGLKQMWRSPNGTIRNILNGTVFREPILCKNIPRL-L  123

Query  594  VGRNPFVLVG  623
             G N  + +G
Sbjct  124  PGWNKPICIG  133



>gb|EYU41407.1| hypothetical protein MIMGU_mgv1a005492mg [Erythranthe guttata]
Length=473

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIWT IKEKLIFP +ELDIKYYDLG+ +RDATDDKVT+ESA
Sbjct  65   EKIKVANPIVEMDGDEMTRVIWTFIKEKLIFPFVELDIKYYDLGLPHRDATDDKVTVESA  124

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE R+ EF LK+MWKSPNGTIRNILNGTVFREPILCK    L 
Sbjct  125  EATLKYNVAIKCATITPDEARMTEFNLKNMWKSPNGTIRNILNGTVFREPILCKNVPRLV  184

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  185  PGWTKPICIGRHAF  198



>ref|XP_006372414.1| isocitrate dehydrogenase family protein [Populus trichocarpa]
 gb|ERP50211.1| isocitrate dehydrogenase family protein [Populus trichocarpa]
Length=410

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IKEKLIFP LELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVFWQSIKEKLIFPFLELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK------  572
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK      
Sbjct  64   EATLKYNVAIKCATITPDEDRVKEFKLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  573  -IFQELFLVGRNPF  611
              + +   +GR+ F
Sbjct  124  PGWTKAICIGRHAF  137



>gb|EYU41406.1| hypothetical protein MIMGU_mgv1a005492mg [Erythranthe guttata]
Length=482

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIWT IKEKLIFP +ELDIKYYDLG+ +RDATDDKVT+ESA
Sbjct  65   EKIKVANPIVEMDGDEMTRVIWTFIKEKLIFPFVELDIKYYDLGLPHRDATDDKVTVESA  124

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE R+ EF LK+MWKSPNGTIRNILNGTVFREPILCK    L 
Sbjct  125  EATLKYNVAIKCATITPDEARMTEFNLKNMWKSPNGTIRNILNGTVFREPILCKNVPRLV  184

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  185  PGWTKPICIGRHAF  198



>ref|NP_001043749.1| Os01g0654500 [Oryza sativa Japonica Group]
 gb|AAD37809.1|AF155333_1 NADP-specific isocitrate dehydrogenase [Oryza sativa]
 dbj|BAB90451.1| putative NADP-specific isocitrate dehydrogenase [Oryza sativa 
Japonica Group]
 dbj|BAD72316.1| putative NADP-specific isocitrate dehydrogenase [Oryza sativa 
Japonica Group]
 dbj|BAF05663.1| Os01g0654500 [Oryza sativa Japonica Group]
 gb|EAY75221.1| hypothetical protein OsI_03110 [Oryza sativa Indica Group]
 gb|EAZ12940.1| hypothetical protein OsJ_02861 [Oryza sativa Japonica Group]
 gb|ACA50489.1| NADP-specific isocitrate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAG88091.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86866.1| NADP-specific isocitrate dehydrogenase [Oryza sativa Japonica 
Group]
Length=412

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTR+ W  IK+KLIFP L+LDIKYYDLG+L+RDATDDKVT+E+A
Sbjct  4    EKIKVANPIVEMDGDEMTRIFWQSIKDKLIFPFLDLDIKYYDLGVLHRDATDDKVTVEAA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNI+NGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFNLKQMWKSPNGTIRNIINGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_007022796.1| Isocitrate dehydrogenase (NADP) isoform 2 [Theobroma cacao]
 gb|EOY14321.1| Isocitrate dehydrogenase (NADP) isoform 2 [Theobroma cacao]
Length=362

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IKEKLI+P LELDIKY+DLG+ NRD+TDDKVTIES +
Sbjct  5    KIKVMNPIVEMDGDEMTRVIWKSIKEKLIYPFLELDIKYFDLGVHNRDSTDDKVTIESTQ  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEGRVKEFNLKKMWKSPNGTIRNILNGTVFREPIICKNIPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  SWTKPICIGRHAF  137



>gb|ACU21054.1| unknown [Glycine max]
Length=416

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 113/133 (85%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KIRV NPIVEMDGDEMTRVIW +IK+KLIFP+LELDIKY+DLG+ +RDAT+D+VTIESAE
Sbjct  5    KIRVGNPIVEMDGDEMTRVIWKLIKDKLIFPYLELDIKYFDLGLPHRDATNDRVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFNLKQMWRSPNGTIRNILNGTVFREPIICKNIPRLVS  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>gb|KHN21348.1| Isocitrate dehydrogenase [NADP], chloroplastic [Glycine soja]
Length=416

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 113/133 (85%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KIRV NPIVEMDGDEMTRVIW +IK+KLIFP+LELDIKY+DLG+ +RDAT+D+VTIESAE
Sbjct  5    KIRVGNPIVEMDGDEMTRVIWKLIKDKLIFPYLELDIKYFDLGLPHRDATNDRVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFNLKQMWRSPNGTIRNILNGTVFREPIICKNIPRLVS  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>gb|KJB81470.1| hypothetical protein B456_013G147100 [Gossypium raimondii]
Length=259

 Score =   205 bits (521),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTR+IW  IKEKLIFP LELDIKY+DLG+ NRDAT+D+VTI SAE
Sbjct  6    KIKVMNPIVEMDGDEMTRIIWKSIKEKLIFPFLELDIKYFDLGLHNRDATNDEVTIASAE  65

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK
Sbjct  66   ATLKYNVAIKCATITPDEGRVKEFNLKKMWKSPNGTIRNILNGTVFREPIICK  118



>ref|XP_010101074.1| Isocitrate dehydrogenase [NADP] [Morus notabilis]
 gb|EXB86784.1| Isocitrate dehydrogenase [NADP] [Morus notabilis]
Length=411

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLIFP L+LDIKY+DLG+ NRDATDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWQSIKDKLIFPFLDLDIKYFDLGLPNRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFNLKHMWKSPNGTIRNILNGTVFREPILCKNIPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_003569476.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] [Brachypodium 
distachyon]
Length=412

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IK+KLIFP L+LDIKYYDLG+L+RDATDDKVT+E+A
Sbjct  4    EKIKVANPIVEMDGDEMTRVFWQSIKDKLIFPFLDLDIKYYDLGVLHRDATDDKVTVEAA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MW+SPNGTIRNI+NGTVFREPI+CK   +L 
Sbjct  64   EATLKYNVAIKCATITPDEDRVKEFNLKQMWRSPNGTIRNIINGTVFREPIICKNVPKLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|KDO46553.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
Length=312

 Score =   206 bits (525),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLG+ NRDATDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFLELDIKYFDLGLPNRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFVLKQMWKSPNGTIRNILNGTVFREPIICK  117



>ref|NP_001236203.1| NADP-dependent isocitrate dehydrogenase [Glycine max]
 gb|AAC64182.1| NADP-dependent isocitrate dehydrogenase [Glycine max]
Length=416

 Score =   209 bits (533),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 113/133 (85%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KIRV NPIVEMDGDEMTRVIW +IK+KLIFP+LELDIKY+DLG+ +RDAT+D+VTIESAE
Sbjct  5    KIRVGNPIVEMDGDEMTRVIWKLIKDKLIFPYLELDIKYFDLGLPHRDATNDRVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFNLKQMWRSPNGTIRNILNGTVFREPIICKNIPRLVS  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_011038412.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Populus 
euphratica]
Length=414

 Score =   209 bits (532),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IKEKLIFP L+LDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVFWQSIKEKLIFPFLDLDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFKLKQMWKSPNGTIRNILNGTVFREPIICKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKAICIGRHAF  137



>dbj|BAE99739.1| NADP specific isocitrate dehydrogenase [Arabidopsis thaliana]
Length=246

 Score =   204 bits (519),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NP+VEMDGDEMTRVIW  IK+KLIFP LELDIKY+DLG+ NRD TDDKVTIE+A
Sbjct  4    EKIKVINPVVEMDGDEMTRVIWKFIKDKLIFPFLELDIKYFDLGLPNRDFTDDKVTIETA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            EATLKYNVAIKCATITPDE RV+EFGLK MW+SPNGTIRNILNGTVFREPI+C+
Sbjct  64   EATLKYNVAIKCATITPDEARVREFGLKKMWRSPNGTIRNILNGTVFREPIICR  117



>ref|XP_009395062.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395064.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   209 bits (532),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IKEKLIFP L+LDIKY+DLG+ NRDATDDKVTIESA
Sbjct  4    EKIKVFNPIVEMDGDEMTRVFWKSIKEKLIFPFLDLDIKYFDLGLPNRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATL YNVAIKCATITPDE RVKEF LKSMWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLNYNVAIKCATITPDEARVKEFNLKSMWKSPNGTIRNILNGTVFREPIICKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_010415138.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like [Camelina 
sativa]
Length=127

 Score =   200 bits (509),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLITPFLELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            EAT KYNVAIKCATITPDE RV EFGLK MW+SPNGTIRNILNGTVFREPI+CK
Sbjct  64   EATKKYNVAIKCATITPDEGRVTEFGLKQMWRSPNGTIRNILNGTVFREPIMCK  117



>gb|KDP39826.1| hypothetical protein JCGZ_04236 [Jatropha curcas]
Length=416

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 111/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTR+IW  IK+KLIFP L+LDIKY+DLG+ NRDATDDK+TIESAE
Sbjct  5    KIKVANPIVEMDGDEMTRIIWKSIKDKLIFPFLDLDIKYFDLGLSNRDATDDKITIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFNLKRMWKSPNGTIRNILNGTVFREPIICKNIPRLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_010480188.1| PREDICTED: peroxisomal isocitrate dehydrogenase [NADP] [Camelina 
sativa]
Length=415

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NP+VEMDGDEMTRVIW  IK+KLIFP LELDIKY+DLG+ NRD+TDDKVT+ESA
Sbjct  4    EKIKVANPVVEMDGDEMTRVIWKFIKDKLIFPFLELDIKYFDLGLPNRDSTDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            EATLKYNVAIKCATITPDE RV+EFGLK MW+SPNGTIRNILNGTVFREPI+C+
Sbjct  64   EATLKYNVAIKCATITPDEARVREFGLKKMWRSPNGTIRNILNGTVFREPIICR  117



>ref|XP_011038411.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Populus 
euphratica]
Length=416

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IKEKLIFP L+LDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVFWQSIKEKLIFPFLDLDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFKLKQMWKSPNGTIRNILNGTVFREPIICKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKAICIGRHAF  137



>gb|EPS58684.1| hypothetical protein M569_16128, partial [Genlisea aurea]
Length=415

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+DLG+ +RDATDD+VT+ESA
Sbjct  7    EKIKVANPIVEMDGDEMTRVIWKFIKDKLILPFLELDIKYFDLGLPHRDATDDRVTVESA  66

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LKSMW+SPNGTIRNILNGTVFREPILCK    L 
Sbjct  67   EATLKYNVAIKCATITPDEARVKEFNLKSMWRSPNGTIRNILNGTVFREPILCKNVPRLI  126

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  127  PGWTKPICIGRHAF  140



>ref|XP_003546847.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
isoform X1 [Glycine max]
 gb|KHN40171.1| Isocitrate dehydrogenase [NADP], chloroplastic [Glycine soja]
Length=416

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KIRV NPIVEMDGDEMTRVIW +IK+KLIFP+LELDIKY+DLG+ +RDAT+D+VTIESAE
Sbjct  5    KIRVGNPIVEMDGDEMTRVIWKLIKDKLIFPYLELDIKYFDLGLPHRDATNDRVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE R+KEF LK MW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARIKEFNLKQMWRSPNGTIRNILNGTVFREPIICKNIPRLVS  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_009384960.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like [Musa 
acuminata subsp. malaccensis]
Length=410

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NP+VEMDGDEMTRV W  IKEKLIFP ++LDIKY+DLG+ NRDATDDKVTIESA
Sbjct  4    EKIKVANPVVEMDGDEMTRVFWKSIKEKLIFPFVDLDIKYFDLGLPNRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LKSMWKSPNGTIRNI+NGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFNLKSMWKSPNGTIRNIVNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|KDO46551.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
 gb|KDO46552.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
Length=348

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLG+ NRDATDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFLELDIKYFDLGLPNRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFVLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_002527208.1| NADP-specific isocitrate dehydrogenase, putative [Ricinus communis]
 gb|EEF35175.1| NADP-specific isocitrate dehydrogenase, putative [Ricinus communis]
Length=416

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DKI+V NPIVEMDGDEMTR+IW  IK KLIFP L+LDIKY+DLG+ NRDATDD+VT+ESA
Sbjct  4    DKIKVDNPIVEMDGDEMTRIIWKSIKTKLIFPFLDLDIKYFDLGLPNRDATDDQVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDETRVKEF LK MWK+PNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDETRVKEFNLKRMWKTPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>dbj|BAC77064.1| NADP-specific isocitrate dehydrogenase [Lupinus albus]
Length=412

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 108/133 (81%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKYYDLG+  RD TDDKVT+ESAE
Sbjct  5    KINVANPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYYDLGLPYRDETDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLK MWKSPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFGLKQMWKSPNGTIRNILNGTVFREPILCKNIPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWNKPICIGRHAF  137



>gb|EPS68007.1| hypothetical protein M569_06765, partial [Genlisea aurea]
Length=412

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+DLG+ +RDATDDKVT+ESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKFIKDKLILPFLELDIKYFDLGLPHRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK+MWKSPNGTIRNILNGTVFREPILCK    L 
Sbjct  64   EATLKYNVAIKCATITPDEGRVKEFNLKNMWKSPNGTIRNILNGTVFREPILCKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>dbj|BAA34113.1| NADP specific isocitrate dehydrogenase [Daucus carota]
Length=416

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 111/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IKEKLIFP L+LDIKY+DLG+ NRDATDD+VTIESAE
Sbjct  5    KIKVLNPIVEMDGDEMTRVFWKSIKEKLIFPFLDLDIKYFDLGLPNRDATDDRVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDETR+KEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDETRLKEFNLKQMWKSPNGTIRNILNGTVFREPIICKNIPRLVQ  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWNKPICIGRHAF  137



>gb|KJB81471.1| hypothetical protein B456_013G147100 [Gossypium raimondii]
Length=289

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTR+IW  IKEKLIFP LELDIKY+DLG+ NRDAT+D+VTI SAE
Sbjct  6    KIKVMNPIVEMDGDEMTRIIWKSIKEKLIFPFLELDIKYFDLGLHNRDATNDEVTIASAE  65

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  66   ATLKYNVAIKCATITPDEGRVKEFNLKKMWKSPNGTIRNILNGTVFREPIICKNVPRLVP  125

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  126  SWTKPICIGRHAF  138



>gb|KDO46550.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
Length=335

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLG+ NRDATDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFLELDIKYFDLGLPNRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFVLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>emb|CAA73139.1| isocitrate dehydrogenase (NADP+) [Apium graveolens]
Length=412

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLIFP +ELDIKY+DLG+ +RDATDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFVELDIKYFDLGLPHRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RV+EFGLK MWKSPNGTIRNILNGTVFREPI+CK   +L  
Sbjct  65   ATLKYNVAIKCATITPDEARVEEFGLKQMWKSPNGTIRNILNGTVFREPIICKNIPKLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>emb|CDX67740.1| BnaA07g17800D [Brassica napus]
Length=426

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P+LELDIKY+DLG+ NRD+TDDKVT ESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWRFIKDKLILPYLELDIKYFDLGLPNRDSTDDKVTTESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            EATLKYNVAIKCATITPDETRV+EFGLK MW+SPNGTIRNILNGTVFREPI+C+
Sbjct  64   EATLKYNVAIKCATITPDETRVREFGLKKMWRSPNGTIRNILNGTVFREPIICR  117



>ref|XP_010551544.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] [Tarenaya 
hassleriana]
Length=412

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P +ELDIKY+DLG+ +RDATDDKVT+ESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLILPFVELDIKYFDLGLPHRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEFGLK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEGRVKEFGLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|AFW83444.1| hypothetical protein ZEAMMB73_038317 [Zea mays]
Length=412

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IK+KLI P L+LDIKYYDLGIL+R+ATDDKVT+E+A
Sbjct  4    EKIKVSNPIVEMDGDEMTRVFWQSIKDKLILPFLDLDIKYYDLGILHREATDDKVTVEAA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDETRVKEF LK MWKSPNGTIRNI+NGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDETRVKEFNLKHMWKSPNGTIRNIINGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|ABA18651.1| cytosolic NADP+-isocitrate dehydrogenase [Populus tremula x Populus 
alba]
Length=420

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IKEKLIFP LELDIKY+DLG+ +RDATDDKVTIES+
Sbjct  4    EKIKVANPIVEMDGDEMTRVFWQSIKEKLIFPFLELDIKYFDLGLPHRDATDDKVTIESS  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK------  572
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK      
Sbjct  64   EATLKYNVAIKCATITPDEDRVKEFKLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  573  -IFQELFLVGRNPF  611
              + +   +GR+ F
Sbjct  124  PGWTKAICIGRHAF  137



>ref|XP_002528517.1| NADP-specific isocitrate dehydrogenase, putative [Ricinus communis]
 gb|EEF33886.1| NADP-specific isocitrate dehydrogenase, putative [Ricinus communis]
Length=413

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTR+ W  IK+KLIFP LELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRIFWKSIKDKLIFPFLELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFNLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>sp|P50218.1|IDHC_TOBAC RecName: Full=Isocitrate dehydrogenase [NADP]; Short=IDH; AltName: 
Full=IDP; AltName: Full=NADP(+)-specific ICDH; AltName: 
Full=Oxalosuccinate decarboxylase [Nicotiana tabacum]
 emb|CAA54912.1| isocitrate dehydrogenase (NADP+) [Nicotiana tabacum]
Length=415

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 113/136 (83%), Gaps = 7/136 (5%)
 Frame = +3

Query  225  TKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIE  404
            T DKI+V+NPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+DLG+ +RDATDDKVT+E
Sbjct  2    TFDKIKVENPIVEMDGDEMTRVIWKSIKDKLICPFLELDIKYFDLGLPHRDATDDKVTVE  61

Query  405  SAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQE  584
            SAEAT KYNVAIKCATITPDE RVKEF LKSMW+SPNGTIRNILNGTVFREPI+CK    
Sbjct  62   SAEATQKYNVAIKCATITPDEARVKEFNLKSMWRSPNGTIRNILNGTVFREPIMCKNIPR  121

Query  585  L-------FLVGRNPF  611
            L         +GR+ F
Sbjct  122  LVPGWTKPICIGRHAF  137



>sp|Q40345.1|IDHP_MEDSA RecName: Full=Isocitrate dehydrogenase [NADP], chloroplastic; 
Short=IDH; AltName: Full=IDP; AltName: Full=NADP(+)-specific 
ICDH; AltName: Full=Oxalosuccinate decarboxylase; Flags: Precursor, 
partial [Medicago sativa]
 gb|AAA32656.1| isocitrate dehydrogenase precursor [Medicago sativa]
Length=433

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 117/155 (75%), Gaps = 7/155 (5%)
 Frame = +3

Query  168  PNASIRCFASTASGTAPVETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIK  347
            PN S   F    + T       KI+V NPIVEMDGDEMTR+IW  IK+KLIFP +ELDIK
Sbjct  4    PNLSFSAFFPIITFTTATMGFQKIKVANPIVEMDGDEMTRIIWKYIKDKLIFPFVELDIK  63

Query  348  YYDLGILNRDATDDKVTIESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIR  527
            Y+DLG+  RD T+DKVT+ESAEATLKYNVAIKCATITPDE RVKEFGLKSMW+SPNGTIR
Sbjct  64   YFDLGLPYRDETNDKVTVESAEATLKYNVAIKCATITPDEARVKEFGLKSMWRSPNGTIR  123

Query  528  NILNGTVFREPILCKIFQEL-------FLVGRNPF  611
            NILNGTVFREPI+CK    L         +GR+ F
Sbjct  124  NILNGTVFREPIICKNIPRLIPGWTKPICIGRHAF  158



>gb|KJB81472.1| hypothetical protein B456_013G147100 [Gossypium raimondii]
Length=329

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTR+IW  IKEKLIFP LELDIKY+DLG+ NRDAT+D+VTI SAE
Sbjct  6    KIKVMNPIVEMDGDEMTRIIWKSIKEKLIFPFLELDIKYFDLGLHNRDATNDEVTIASAE  65

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK
Sbjct  66   ATLKYNVAIKCATITPDEGRVKEFNLKKMWKSPNGTIRNILNGTVFREPIICK  118



>ref|XP_003595878.1| Isocitrate dehydrogenase [Medicago truncatula]
 gb|AES66129.1| NADP-dependent isocitrate dehydrogenase [Medicago truncatula]
 gb|AFK36970.1| unknown [Medicago truncatula]
Length=416

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 111/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KIRV NPIVEMDGDEMTRVIW MIK+KLIFP LELDIKY+DLG+ +RDAT+D+VT+ES E
Sbjct  5    KIRVDNPIVEMDGDEMTRVIWRMIKDKLIFPFLELDIKYFDLGLPHRDATNDRVTVESGE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEGRVKEFNLKQMWKSPNGTIRNILNGTVFREPIICKNIPRLVS  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_007031322.1| Isocitrate dehydrogenase (NADP) isoform 2 [Theobroma cacao]
 gb|EOY02248.1| Isocitrate dehydrogenase (NADP) isoform 2 [Theobroma cacao]
Length=325

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLIFP LELDIKY+DLG+  RDATDDKVT+ESA
Sbjct  4    EKIKVVNPIVEMDGDEMTRVIWKSIKDKLIFPFLELDIKYFDLGLPYRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFNLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_009624622.1| PREDICTED: isocitrate dehydrogenase [NADP] [Nicotiana tomentosiformis]
Length=415

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 113/136 (83%), Gaps = 7/136 (5%)
 Frame = +3

Query  225  TKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIE  404
            T DKI+V+NPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+DLG+ +RDATDDKVT+E
Sbjct  2    TFDKIKVENPIVEMDGDEMTRVIWKSIKDKLICPFLELDIKYFDLGLPHRDATDDKVTVE  61

Query  405  SAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQE  584
            SAEAT KYNVAIKCATITPDE RVKEF LKSMW+SPNGTIRNILNGTVFREPI+CK    
Sbjct  62   SAEATQKYNVAIKCATITPDEARVKEFNLKSMWRSPNGTIRNILNGTVFREPIMCKNIPR  121

Query  585  L-------FLVGRNPF  611
            L         +GR+ F
Sbjct  122  LVPGWTKPICIGRHAF  137



>ref|XP_007022795.1| Isocitrate dehydrogenase (NADP) isoform 1 [Theobroma cacao]
 gb|EOY14320.1| Isocitrate dehydrogenase (NADP) isoform 1 [Theobroma cacao]
Length=416

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IKEKLI+P LELDIKY+DLG+ NRD+TDDKVTIES +
Sbjct  5    KIKVMNPIVEMDGDEMTRVIWKSIKEKLIYPFLELDIKYFDLGVHNRDSTDDKVTIESTQ  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEGRVKEFNLKKMWKSPNGTIRNILNGTVFREPIICKNIPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  SWTKPICIGRHAF  137



>ref|XP_002270617.1| PREDICTED: isocitrate dehydrogenase [NADP] [Vitis vinifera]
 emb|CAN72808.1| hypothetical protein VITISV_010484 [Vitis vinifera]
 emb|CBI27352.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DKI+V NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLG+ +RDATDDKVT+ESA
Sbjct  4    DKIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFLELDIKYFDLGLPHRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE R+KEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEGRMKEFDLKQMWKSPNGTIRNILNGTVFREPIICKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PSWTKPICIGRHAF  137



>gb|KDO46543.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
Length=413

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLG+ NRDATDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFLELDIKYFDLGLPNRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFVLKQMWKSPNGTIRNILNGTVFREPIICK  117



>gb|AAB39248.1| NADP-isocitrate dehydrogenase [Eucalyptus globulus]
Length=416

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V+NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVENPIVEMDGDEMTRVFWKSIKDKLIFPFLELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE R+KEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARMKEFTLKQMWKSPNGTIRNILNGTVFREPIMCKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWSKPICIGRHAF  137



>gb|KJB43196.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
Length=304

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P +ELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLILPFVELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFDLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_006432387.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 ref|XP_006432388.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 gb|ESR45627.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 gb|ESR45628.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 gb|KDO46548.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
Length=414

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLG+ NRDATDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFLELDIKYFDLGLPNRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFVLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_006494575.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Citrus 
sinensis]
 ref|XP_006494576.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Citrus 
sinensis]
Length=414

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLG+ NRDATDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFLELDIKYFDLGLPNRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFVLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>gb|KDO46544.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
Length=412

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLG+ NRDATDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFLELDIKYFDLGLPNRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFVLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_010915646.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X3 [Elaeis 
guineensis]
Length=349

 Score =   206 bits (524),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK+KLIFP L+L+IKY+DLG+ NRDAT+DKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVIWKSIKDKLIFPFLDLNIKYFDLGLPNRDATNDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDETR+KEF LKSMW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDETRMKEFNLKSMWRSPNGTIRNILNGTVFREPIICKNVPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_009785664.1| PREDICTED: isocitrate dehydrogenase [NADP] [Nicotiana sylvestris]
Length=415

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DKI+V+NPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+DLG+ +RDATDDKVT+ESA
Sbjct  4    DKIKVENPIVEMDGDEMTRVIWKSIKDKLICPFLELDIKYFDLGLPHRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EAT KYNVAIKCATITPDE RVKEF LKSMW+SPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATQKYNVAIKCATITPDEARVKEFNLKSMWRSPNGTIRNILNGTVFREPIMCKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_006432389.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 ref|XP_006432390.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 ref|XP_006432391.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 gb|ESR45629.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 gb|ESR45630.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 gb|ESR45631.1| hypothetical protein CICLE_v10001314mg [Citrus clementina]
 gb|KDO46545.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
 gb|KDO46546.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
 gb|KDO46547.1| hypothetical protein CISIN_1g015012mg [Citrus sinensis]
Length=414

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLG+ NRDATDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFLELDIKYFDLGLPNRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFVLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>gb|AAD51361.1|AF176669_1 NADP-isocitrate dehydrogenase [Citrus limon]
Length=414

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLG+ NRDATDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFLELDIKYFDLGLPNRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFVLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_001778590.1| predicted protein [Physcomitrella patens]
 gb|EDQ56620.1| predicted protein [Physcomitrella patens]
Length=417

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V+NPIVEMDGDEMTR+IW MIKEKLI P++++++KYYDLGILNRDAT+D+VT ESA
Sbjct  4    EKIKVENPIVEMDGDEMTRIIWQMIKEKLILPYVDVELKYYDLGILNRDATNDRVTHESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            EATLKYNVA+KCATITPDE RVKEFGLK MW+SPNGTIRN+L+GTVFREPILCK
Sbjct  64   EATLKYNVAVKCATITPDEGRVKEFGLKQMWRSPNGTIRNVLDGTVFREPILCK  117



>ref|XP_004293807.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Fragaria vesca 
subsp. vesca]
Length=417

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 113/138 (82%), Gaps = 7/138 (5%)
 Frame = +3

Query  219  VETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVT  398
            +E  DKI+V NPIVEMDGDEMTR+ W  IK+KLI P LELDIKY+DLG+ NRDATDD+VT
Sbjct  1    MEAFDKIKVTNPIVEMDGDEMTRIFWKSIKDKLILPFLELDIKYFDLGLPNRDATDDRVT  60

Query  399  IESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIF  578
            IESAEATLKYNVAIKCATITPDETRVKEF LK MW+SPNGTIRNILNGTVFREPI+C+  
Sbjct  61   IESAEATLKYNVAIKCATITPDETRVKEFNLKQMWRSPNGTIRNILNGTVFREPIICRNV  120

Query  579  QEL-------FLVGRNPF  611
              L         +GR+ F
Sbjct  121  PRLVPGWTKPICIGRHAF  138



>ref|XP_009409414.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like [Musa 
acuminata subsp. malaccensis]
Length=414

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK+KLIFP L+LDIKY+DLG+ NRDATDD+VTIESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVIWRSIKDKLIFPFLDLDIKYFDLGLPNRDATDDRVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVA+KCATITPDE RVKEF LK+MWKSPNGTIRNILNGTVFREPI+C+    L  
Sbjct  65   ATLKYNVAVKCATITPDEGRVKEFNLKAMWKSPNGTIRNILNGTVFREPIICRNIPRLVS  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>gb|KJB43201.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
Length=345

 Score =   206 bits (523),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P +ELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLILPFVELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFDLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|KJB43195.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
Length=324

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P +ELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLILPFVELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFDLKQMWKSPNGTIRNILNGTVFREPIICK  117



>ref|XP_011014465.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Populus 
euphratica]
Length=428

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DKI+V NPIVEMDGDEMTRVIW  IK+KLI P L+LDIKY+DLG+ NRDATDD++T+ESA
Sbjct  16   DKIKVTNPIVEMDGDEMTRVIWKSIKDKLILPFLDLDIKYFDLGLPNRDATDDRITVESA  75

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK+MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  76   EATLKYNVAIKCATITPDEGRVKEFNLKNMWKSPNGTIRNILNGTVFREPIICKNIPRLV  135

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  136  SGWTKPICIGRHAF  149



>gb|KJB81473.1| hypothetical protein B456_013G147100 [Gossypium raimondii]
Length=376

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTR+IW  IKEKLIFP LELDIKY+DLG+ NRDAT+D+VTI SAE
Sbjct  6    KIKVMNPIVEMDGDEMTRIIWKSIKEKLIFPFLELDIKYFDLGLHNRDATNDEVTIASAE  65

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  66   ATLKYNVAIKCATITPDEGRVKEFNLKKMWKSPNGTIRNILNGTVFREPIICKNVPRLVP  125

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  126  SWTKPICIGRHAF  138



>dbj|BAE48792.1| NADP-isocitrate dehydrogenase [Codonopsis lanceolata]
Length=416

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTR+ W  IK+KLIFP LELDIKY+DLG+ +RDATDDKVT+ESA
Sbjct  4    EKIKVANPIVEMDGDEMTRIFWQSIKDKLIFPFLELDIKYFDLGLPHRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE R+KEF LKSMWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARMKEFTLKSMWKSPNGTIRNILNGTVFREPIICKNIPRLI  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_009631360.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Nicotiana 
tomentosiformis]
Length=478

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW +IK+KLIFP +ELDIKY+DLG+ +RDATDDKVTIESAE
Sbjct  68   KIKVANPIVEMDGDEMTRVIWKLIKDKLIFPFVELDIKYFDLGLPHRDATDDKVTIESAE  127

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            ATLKYNVAIKCATITPDE R+KEF LK MWKSPNGTIRNILNGTVFREPILCK
Sbjct  128  ATLKYNVAIKCATITPDEGRMKEFNLKHMWKSPNGTIRNILNGTVFREPILCK  180



>ref|XP_009631361.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Nicotiana 
tomentosiformis]
Length=476

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW +IK+KLIFP +ELDIKY+DLG+ +RDATDDKVTIESAE
Sbjct  68   KIKVANPIVEMDGDEMTRVIWKLIKDKLIFPFVELDIKYFDLGLPHRDATDDKVTIESAE  127

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            ATLKYNVAIKCATITPDE R+KEF LK MWKSPNGTIRNILNGTVFREPILCK
Sbjct  128  ATLKYNVAIKCATITPDEGRMKEFNLKHMWKSPNGTIRNILNGTVFREPILCK  180



>ref|XP_001778805.1| predicted protein [Physcomitrella patens]
 gb|EDQ56391.1| predicted protein [Physcomitrella patens]
Length=411

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 112/133 (84%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI V NPIVEMDGDEMTR+IW MIK+KLIFP L+LD+KY+DLGI +RDATDD+VTIESAE
Sbjct  5    KIHVANPIVEMDGDEMTRIIWKMIKDKLIFPFLDLDLKYFDLGIEHRDATDDRVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            AT KYNVA+KCATITPDE RVKE+ LKSMW+SPNGTIRNILNGTVFREPILCK   +L  
Sbjct  65   ATKKYNVAVKCATITPDEARVKEYNLKSMWRSPNGTIRNILNGTVFREPILCKNIPKLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTSPICIGRHAF  137



>gb|AAS49171.1| NADP-dependent isocitrate dehydrogenase [Pisum sativum]
 gb|AAU44341.1| NADP-dependent isocitrate dehydrogenase I [Pisum sativum]
Length=412

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V +PIVEMDGDEMTRVIW  IK+KLIFP LELDIKY+DLG+ +RD TDDKVT+ESAE
Sbjct  5    KIKVASPIVEMDGDEMTRVIWKSIKDKLIFPFLELDIKYFDLGLPHRDQTDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RV+EFGLKSMW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVEEFGLKSMWRSPNGTIRNILNGTVFREPIICKNVPRLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>gb|EMT15199.1| putative Isocitrate dehydrogenase (NADP), chloroplastic [Aegilops 
tauschii]
Length=409

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IK+KLIFP L+LDIKY+DLG+L+RDATDDKVT+E+A
Sbjct  4    EKIKVANPIVEMDGDEMTRVFWQSIKDKLIFPFLDLDIKYFDLGVLHRDATDDKVTVEAA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MW+SPNGTIRNI+NGTVFREPI+CK   +L 
Sbjct  64   EATLKYNVAIKCATITPDEDRVKEFNLKQMWRSPNGTIRNIINGTVFREPIICKNVPKLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>dbj|BAJ85136.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=409

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IK+KLIFP L+LDIKY+DLG+L+RDATDDKVT+E+A
Sbjct  4    EKIKVANPIVEMDGDEMTRVFWQSIKDKLIFPFLDLDIKYFDLGVLHRDATDDKVTVEAA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MW+SPNGTIRNI+NGTVFREPI+CK   +L 
Sbjct  64   EATLKYNVAIKCATITPDEDRVKEFNLKQMWRSPNGTIRNIINGTVFREPIICKNVPKLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_008225974.1| PREDICTED: isocitrate dehydrogenase [NADP] [Prunus mume]
Length=417

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 115/138 (83%), Gaps = 7/138 (5%)
 Frame = +3

Query  219  VETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVT  398
            +E+ +KI+V NP+VEMDGDEMTR+ W  IK+KLIFP LELDIKY+DLG+ NRDAT+DKVT
Sbjct  1    MESFNKIKVTNPVVEMDGDEMTRIFWKSIKDKLIFPFLELDIKYFDLGLPNRDATNDKVT  60

Query  399  IESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIF  578
            IESAEATLKYNVAIKCATITPDETRVKEF LK MW+SPNGTIRNILNGTVFREPI+C+  
Sbjct  61   IESAEATLKYNVAIKCATITPDETRVKEFNLKQMWRSPNGTIRNILNGTVFREPIICRNV  120

Query  579  QEL-------FLVGRNPF  611
              L         +GR+ F
Sbjct  121  PRLVPGWTKPICIGRHAF  138



>ref|XP_008783873.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Phoenix dactylifera]
Length=416

 Score =   207 bits (527),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 113/133 (85%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK+KLIFP L+L+IKY+DLG+ NRDAT+DKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVIWKSIKDKLIFPFLDLNIKYFDLGLPNRDATNDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDETR+KEF LKSMWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDETRMKEFNLKSMWKSPNGTIRNILNGTVFREPIICKNVPRLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_007211789.1| hypothetical protein PRUPE_ppa006334mg [Prunus persica]
 gb|EMJ12988.1| hypothetical protein PRUPE_ppa006334mg [Prunus persica]
Length=417

 Score =   207 bits (527),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 115/138 (83%), Gaps = 7/138 (5%)
 Frame = +3

Query  219  VETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVT  398
            +E+ +KI+V NP+VEMDGDEMTR+ W  IK+KLIFP LELDIKY+DLG+ NRDAT+DKVT
Sbjct  1    MESFNKIKVTNPVVEMDGDEMTRIFWKSIKDKLIFPFLELDIKYFDLGLPNRDATNDKVT  60

Query  399  IESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIF  578
            IESAEATLKYNVAIKCATITPDETRVKEF LK MW+SPNGTIRNILNGTVFREPI+C+  
Sbjct  61   IESAEATLKYNVAIKCATITPDETRVKEFNLKQMWRSPNGTIRNILNGTVFREPIICRNV  120

Query  579  QEL-------FLVGRNPF  611
              L         +GR+ F
Sbjct  121  PRLVPGWTKPICIGRHAF  138



>gb|ACJ11744.1| Isocitrate dehydrogenase [Gossypium hirsutum]
Length=411

 Score =   207 bits (526),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P +ELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLILPFVELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK   +L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFDLKQMWKSPNGTIRNILNGTVFREPIICKNVPQLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|KDP35739.1| hypothetical protein JCGZ_10511 [Jatropha curcas]
Length=414

 Score =   207 bits (526),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IK+KLIFP +ELDIKY+DLG+ +RDATDDKVT+ESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFVELDIKYFDLGLPHRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFNLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_004490788.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
[Cicer arietinum]
Length=412

 Score =   207 bits (526),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 109/133 (82%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+DLG+  RD TDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYFDLGLPYRDETDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFGLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>gb|KJB43199.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
Length=390

 Score =   206 bits (524),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P +ELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLILPFVELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFDLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_006352387.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Solanum tuberosum]
Length=415

 Score =   207 bits (526),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 111/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW +IK+KLI P LELDIKY+DLG+ +RDATDDKVTIESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVIWKLIKDKLILPFLELDIKYFDLGLPHRDATDDKVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE R++EF LK MWKSPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARMEEFNLKHMWKSPNGTIRNILNGTVFREPILCKNIPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWSKPICIGRHAF  137



>ref|XP_004250238.2| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Solanum 
lycopersicum]
Length=415

 Score =   207 bits (526),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW +IK+KLI P LELDIKY+DLG+ +RDATDDKVTIESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVIWKLIKDKLILPFLELDIKYFDLGLPHRDATDDKVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE R+ EF LK MWKSPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARMNEFNLKHMWKSPNGTIRNILNGTVFREPILCKNIPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  SWSKPICIGRHAF  137



>emb|CDM82394.1| unnamed protein product [Triticum aestivum]
Length=414

 Score =   207 bits (526),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            DKI+V NPIVEMDGDEMTR+IW  IK+KLIFP L+LDIKY+DLG+ NRDAT DKVTIESA
Sbjct  4    DKIQVANPIVEMDGDEMTRIIWKWIKDKLIFPFLDLDIKYFDLGLPNRDATGDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCAT+TPDE RVKEF LK+MW+SPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATVTPDEGRVKEFNLKAMWRSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_010915645.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Elaeis 
guineensis]
Length=415

 Score =   207 bits (526),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK+KLIFP L+L+IKY+DLG+ NRDAT+DKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVIWKSIKDKLIFPFLDLNIKYFDLGLPNRDATNDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDETR+KEF LKSMW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDETRMKEFNLKSMWRSPNGTIRNILNGTVFREPIICKNVPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>gb|AFL48182.1| isocitrate dehydrogenase [Capsicum annuum]
Length=415

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI VQNPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+DLG+ +RD TDDKVT+ESAE
Sbjct  5    KINVQNPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYFDLGLPHRDLTDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LKSMW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFKLKSMWRSPNGTIRNILNGTVFREPIMCKNIPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_010915644.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Elaeis 
guineensis]
Length=416

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK+KLIFP L+L+IKY+DLG+ NRDAT+DKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVIWKSIKDKLIFPFLDLNIKYFDLGLPNRDATNDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDETR+KEF LKSMW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDETRMKEFNLKSMWRSPNGTIRNILNGTVFREPIICKNVPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_007031321.1| Cytosolic NADP+-dependent isocitrate dehydrogenase isoform 1 
[Theobroma cacao]
 gb|EOY02247.1| Cytosolic NADP+-dependent isocitrate dehydrogenase isoform 1 
[Theobroma cacao]
Length=461

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLIFP LELDIKY+DLG+  RDATDDKVT+ESA
Sbjct  51   EKIKVVNPIVEMDGDEMTRVIWKSIKDKLIFPFLELDIKYFDLGLPYRDATDDKVTVESA  110

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  111  EATLKYNVAIKCATITPDEARVKEFNLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  170

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  171  PGWTKPICIGRHAF  184



>gb|AEZ00844.1| putative isocitrate dehydrogenase protein, partial [Elaeis guineensis]
Length=408

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW  IK+KLIFP L+L+IKY+DLG+ NRDAT+DKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVIWKSIKDKLIFPFLDLNIKYFDLGLPNRDATNDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDETR+KEF LKSMW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDETRMKEFNLKSMWRSPNGTIRNILNGTVFREPIICKNVPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>gb|KJB43200.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
Length=386

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P +ELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLILPFVELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFDLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_002891883.1| hypothetical protein ARALYDRAFT_474695 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68142.1| hypothetical protein ARALYDRAFT_474695 [Arabidopsis lyrata subsp. 
lyrata]
Length=415

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NP+VEMDGDEMTRVIW  IK+KLIFP LELDIKY+DLG+ NRD TDDKVTIESA
Sbjct  4    EKIKVINPVVEMDGDEMTRVIWKFIKDKLIFPFLELDIKYFDLGLPNRDLTDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            EATLKY+VAIKCATITPDE RVKEFGLK MW+SPNGTIRNILNGTVFREPI+C+
Sbjct  64   EATLKYHVAIKCATITPDEARVKEFGLKKMWRSPNGTIRNILNGTVFREPIICR  117



>gb|AGV54671.1| NADPH-specific isocitrate dehydrogenase [Phaseolus vulgaris]
Length=412

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
             KI V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKYYDLG+  RD TDDKVT +SA
Sbjct  4    QKINVANPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYYDLGLPYRDETDDKVTTDSA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            EATLKYNVAIKCATITPDE RVKEFGLK MWKSPNGTIRNILNGTVFREPILCK
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFGLKQMWKSPNGTIRNILNGTVFREPILCK  117



>dbj|BAJ90352.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=409

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 113/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            ++I+V NPIVEMDGDEMTRV W  IK+KLIFP L+LDIKY+DLG+L+RDATDDKVT+E+A
Sbjct  4    ERIKVANPIVEMDGDEMTRVFWQSIKDKLIFPFLDLDIKYFDLGVLHRDATDDKVTVEAA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MW+SPNGTIRNI+NGTVFREPI+CK   +L 
Sbjct  64   EATLKYNVAIKCATITPDEDRVKEFNLKQMWRSPNGTIRNIINGTVFREPIICKNVPKLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>dbj|BAG84436.1| NADP-dependent isocitrate dehydrogenase [Passiflora edulis]
Length=414

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IK+KLIFP +ELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFVELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RV+EF LK MW+SPNGTIRNILNGTVFREPILCK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVEEFSLKQMWRSPNGTIRNILNGTVFREPILCKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_007217240.1| hypothetical protein PRUPE_ppa006356mg [Prunus persica]
 ref|XP_007217241.1| hypothetical protein PRUPE_ppa006356mg [Prunus persica]
 ref|XP_007217242.1| hypothetical protein PRUPE_ppa006356mg [Prunus persica]
 gb|EMJ18439.1| hypothetical protein PRUPE_ppa006356mg [Prunus persica]
 gb|EMJ18440.1| hypothetical protein PRUPE_ppa006356mg [Prunus persica]
 gb|EMJ18441.1| hypothetical protein PRUPE_ppa006356mg [Prunus persica]
Length=415

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLI P LELDIKY+DLG+ +RDATDDKVT+ESAE
Sbjct  9    KIKVANPIVEMDGDEMTRVFWKSIKDKLILPFLELDIKYFDLGLPHRDATDDKVTVESAE  68

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LKSMW+SPNGTIRNILNGTVFREPILCK    L  
Sbjct  69   ATLKYNVAIKCATITPDEGRVKEFNLKSMWRSPNGTIRNILNGTVFREPILCKNIPRLIP  128

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  129  GWTKPICIGRHAF  141



>ref|XP_004228607.1| PREDICTED: isocitrate dehydrogenase [NADP] [Solanum lycopersicum]
Length=415

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI VQNPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+DLG+ +RDATDDKVTIESAE
Sbjct  5    KIIVQNPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYFDLGLPHRDATDDKVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            AT KYNVAIKCATITPDE RVKEF LKSMW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATQKYNVAIKCATITPDEARVKEFNLKSMWRSPNGTIRNILNGTVFREPIMCKNIPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_010693737.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Beta vulgaris 
subsp. vulgaris]
Length=416

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 111/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IKEKLI+P LELDIKY+DLG+ NRDAT+DKVTIESAE
Sbjct  5    KIKVSNPIVEMDGDEMTRVFWKSIKEKLIYPFLELDIKYFDLGLPNRDATNDKVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MW+SPNGTIRNILNGTVFREPI+C+   +L  
Sbjct  65   ATLKYNVAIKCATITPDEGRVKEFNLKQMWRSPNGTIRNILNGTVFREPIICRNVPKLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_004488601.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
[Cicer arietinum]
Length=416

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI V NPIVEMDGDEMTRVIW MIK+KLI P LELDIKY+DLG+ +RDATDD+VTIESAE
Sbjct  5    KISVANPIVEMDGDEMTRVIWRMIKDKLILPFLELDIKYFDLGLPHRDATDDRVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+C+    L  
Sbjct  65   ATLKYNVAIKCATITPDEGRVKEFNLKQMWKSPNGTIRNILNGTVFREPIICRNIPRLVS  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>gb|KJB81468.1| hypothetical protein B456_013G147100 [Gossypium raimondii]
 gb|KJB81469.1| hypothetical protein B456_013G147100 [Gossypium raimondii]
Length=417

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTR+IW  IKEKLIFP LELDIKY+DLG+ NRDAT+D+VTI SAE
Sbjct  6    KIKVMNPIVEMDGDEMTRIIWKSIKEKLIFPFLELDIKYFDLGLHNRDATNDEVTIASAE  65

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  66   ATLKYNVAIKCATITPDEGRVKEFNLKKMWKSPNGTIRNILNGTVFREPIICKNVPRLVP  125

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  126  SWTKPICIGRHAF  138



>gb|KJB43203.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
Length=409

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P +ELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLILPFVELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFDLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|KJB43194.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
 gb|KJB43197.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
Length=411

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P +ELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLILPFVELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFDLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|AAL11503.1|AF367443_1 NADP-dependent isocitrate dehydrogenase [Prunus persica]
Length=414

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLI P LELDIKY+DLG+ +RDATDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWKSIKDKLILPFLELDIKYFDLGLPHRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LKSMW+SPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEGRVKEFNLKSMWRSPNGTIRNILNGTVFREPILCKNIPRLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_008227912.1| PREDICTED: isocitrate dehydrogenase [NADP] [Prunus mume]
Length=411

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLI P LELDIKY+DLG+ +RDATDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWKSIKDKLILPFLELDIKYFDLGLPHRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LKSMW+SPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEGRVKEFNLKSMWRSPNGTIRNILNGTVFREPILCKNIPRLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|NP_175836.1| isocitrate dehydrogenase [Arabidopsis thaliana]
 sp|Q9SLK0.1|ICDHX_ARATH RecName: Full=Peroxisomal isocitrate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAD25614.1|AC005287_16 NADP specific isocitrate dehydrogenase [Arabidopsis thaliana]
 gb|AAK06592.1|AF316501_1 NADP-specific isocitrate dehydrogenase [Arabidopsis thaliana]
 gb|ABG25072.1| At1g54340 [Arabidopsis thaliana]
 gb|AEE33082.1| isocitrate dehydrogenase [Arabidopsis thaliana]
Length=416

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NP+VEMDGDEMTRVIW  IK+KLIFP LELDIKY+DLG+ NRD TDDKVTIE+A
Sbjct  4    EKIKVINPVVEMDGDEMTRVIWKFIKDKLIFPFLELDIKYFDLGLPNRDFTDDKVTIETA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RV+EFGLK MW+SPNGTIRNILNGTVFREPI+C+    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVREFGLKKMWRSPNGTIRNILNGTVFREPIICRNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_008349103.1| PREDICTED: LOW QUALITY PROTEIN: isocitrate dehydrogenase [NADP]-like 
[Malus domestica]
Length=396

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 113/138 (82%), Gaps = 7/138 (5%)
 Frame = +3

Query  219  VETKDKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVT  398
            +E  DKI+V NPIVEMDGDEMTRV  T IK+KLIFP LELDIKY+DLGILNRDAT+D+VT
Sbjct  1    MEAFDKIKVTNPIVEMDGDEMTRVFSTWIKDKLIFPFLELDIKYFDLGILNRDATNDRVT  60

Query  399  IESAEATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIF  578
            +ESAEATLKYNVAIKCATITPDETRVKEF LK MW+SP GTIRNILNGTVFREPI C+  
Sbjct  61   VESAEATLKYNVAIKCATITPDETRVKEFNLKQMWRSPXGTIRNILNGTVFREPIXCRNV  120

Query  579  QEL-------FLVGRNPF  611
              L         +GR+ F
Sbjct  121  PRLVPGWTMPICIGRHAF  138



>ref|XP_007141953.1| hypothetical protein PHAVU_008G239900g [Phaseolus vulgaris]
 gb|ESW13947.1| hypothetical protein PHAVU_008G239900g [Phaseolus vulgaris]
Length=410

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 107/133 (80%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKYYDLG+  RD TDDKVT +SAE
Sbjct  5    KINVANPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYYDLGLPYRDETDDKVTTDSAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLK MWKSPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFGLKQMWKSPNGTIRNILNGTVFREPILCKNIPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKAICIGRHAF  137



>ref|XP_007149133.1| hypothetical protein PHAVU_005G043900g [Phaseolus vulgaris]
 gb|ESW21127.1| hypothetical protein PHAVU_005G043900g [Phaseolus vulgaris]
Length=416

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 111/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KIRV NPIVEMDGDEMTRVIW MIK+KLI P+LEL+IKY+DLG+ +RDAT D+VTIESAE
Sbjct  5    KIRVDNPIVEMDGDEMTRVIWKMIKDKLILPYLELNIKYFDLGLPHRDATADRVTIESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDETRVKEF L  MW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDETRVKEFNLNQMWRSPNGTIRNILNGTVFREPIICKNIPRLVS  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_009104137.1| PREDICTED: peroxisomal isocitrate dehydrogenase [NADP] [Brassica 
rapa]
Length=416

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P+LELDIKY+DLG+ NRD+TDDKVT +SA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKFIKDKLILPYLELDIKYFDLGLPNRDSTDDKVTTQSA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            EATLKYNVAIKCATITPDETRV+EFGLK +W+SPNGTIRNILNGTVFREPI+C+
Sbjct  64   EATLKYNVAIKCATITPDETRVREFGLKKIWRSPNGTIRNILNGTVFREPIICR  117



>gb|KJB43202.1| hypothetical protein B456_007G188300 [Gossypium raimondii]
Length=413

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P +ELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLILPFVELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFDLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_007141952.1| hypothetical protein PHAVU_008G239900g [Phaseolus vulgaris]
 gb|ESW13946.1| hypothetical protein PHAVU_008G239900g [Phaseolus vulgaris]
Length=412

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 107/133 (80%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKYYDLG+  RD TDDKVT +SAE
Sbjct  5    KINVANPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYYDLGLPYRDETDDKVTTDSAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLK MWKSPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFGLKQMWKSPNGTIRNILNGTVFREPILCKNIPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKAICIGRHAF  137



>gb|AGV54452.1| NADPH-specific isocitrate dehydrogenase [Phaseolus vulgaris]
Length=412

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 107/133 (80%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKYYDLG+  RD TDDKVT +SAE
Sbjct  5    KINVANPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYYDLGLPYRDETDDKVTTDSAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLK MWKSPNGTIRNILNGTVFREPILCK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFGLKQMWKSPNGTIRNILNGTVFREPILCKNIPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKAICIGRHAF  137



>ref|XP_004961158.1| PREDICTED: isocitrate dehydrogenase [NADP], chloroplastic-like 
[Setaria italica]
Length=415

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NP+VEMDGDEMTR+ W  IK+KLIFP L+LDIKY+DLG+ +RDATDDKVT+E+A
Sbjct  4    NKIKVANPVVEMDGDEMTRIFWKSIKDKLIFPFLDLDIKYFDLGLPHRDATDDKVTVEAA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK+MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFSLKAMWKSPNGTIRNILNGTVFREPIICKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|KHF98695.1| Isocitrate dehydrogenase [NADP] [Gossypium arboreum]
Length=411

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P +ELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLILPFVELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFDLKQMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|ACN32072.1| unknown [Zea mays]
 gb|ACN34275.1| unknown [Zea mays]
 gb|AFW79265.1| hypothetical protein ZEAMMB73_761630 [Zea mays]
Length=415

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NP+VEMDGDEMTRV W  IK+KLIFP ++LDIKY+DLG+ +RDATDDKVT+E+A
Sbjct  4    NKIKVSNPVVEMDGDEMTRVFWKSIKDKLIFPFVDLDIKYFDLGLPHRDATDDKVTVEAA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RV EFGLK+MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVNEFGLKAMWKSPNGTIRNILNGTVFREPIICKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_009780820.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Nicotiana 
sylvestris]
Length=479

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW +IK+KLIFP +ELDIKY+DLG+ +RDATDDKVT+ESAE
Sbjct  71   KIKVVNPIVEMDGDEMTRVIWKLIKDKLIFPFVELDIKYFDLGLPHRDATDDKVTVESAE  130

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            ATLKYNVAIKCATITPDE R+KEF LK MWKSPNGTIRNILNGTVFREPILCK
Sbjct  131  ATLKYNVAIKCATITPDEGRMKEFNLKHMWKSPNGTIRNILNGTVFREPILCK  183



>ref|NP_001140324.1| isocitrate dehydrogenase2 [Zea mays]
 gb|ACF83590.1| unknown [Zea mays]
Length=415

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRV W  IK+KLIFP ++LDIKY+DLG+ +RDATDDKVT+E+A
Sbjct  4    NKIKVTNPIVEMDGDEMTRVFWKSIKDKLIFPFVDLDIKYFDLGLPHRDATDDKVTVEAA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RV EFGLK+MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVNEFGLKAMWKSPNGTIRNILNGTVFREPIICKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_009780819.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Nicotiana 
sylvestris]
Length=481

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW +IK+KLIFP +ELDIKY+DLG+ +RDATDDKVT+ESAE
Sbjct  71   KIKVVNPIVEMDGDEMTRVIWKLIKDKLIFPFVELDIKYFDLGLPHRDATDDKVTVESAE  130

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            ATLKYNVAIKCATITPDE R+KEF LK MWKSPNGTIRNILNGTVFREPILCK
Sbjct  131  ATLKYNVAIKCATITPDEGRMKEFNLKHMWKSPNGTIRNILNGTVFREPILCK  183



>ref|NP_001056381.1| Os05g0573200 [Oryza sativa Japonica Group]
 gb|AAD37810.1|AF155334_1 NADP-specific isocitrate dehydrogenase [Oryza sativa]
 gb|AAU44104.1| isocitrate dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF18295.1| Os05g0573200 [Oryza sativa Japonica Group]
 gb|EEE64768.1| hypothetical protein OsJ_19624 [Oryza sativa Japonica Group]
Length=412

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 109/133 (82%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRV W  IK+KLIFP LELDIKY+DLG+  RD TDDKVT+E+AE
Sbjct  5    KIKVANPIVEMDGDEMTRVFWKSIKDKLIFPFLELDIKYFDLGLPYRDQTDDKVTVEAAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LKSMWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFSLKSMWKSPNGTIRNILNGTVFREPIICKNIPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_002305928.1| isocitrate dehydrogenase family protein [Populus trichocarpa]
 gb|EEE86439.1| isocitrate dehydrogenase family protein [Populus trichocarpa]
Length=414

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 110/134 (82%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTR+ W  IK+KLIFP +ELDIKY+DLG+ +RDATDDKVT+ESA
Sbjct  4    EKIKVANPIVEMDGDEMTRIFWQSIKDKLIFPFVELDIKYFDLGLPHRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EA LKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EAALKYNVAIKCATITPDEARVKEFNLKQMWKSPNGTIRNILNGTVFREPIICKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_010062317.1| PREDICTED: isocitrate dehydrogenase [NADP] [Eucalyptus grandis]
 dbj|BAI50641.1| NADP-dependent isocitrate dehydrogenase [Eucalyptus grandis x 
Eucalyptus urophylla]
 gb|KCW69442.1| hypothetical protein EUGRSUZ_F02901 [Eucalyptus grandis]
Length=416

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V+NPIVEMDGDEMTRV W  IK+KLI P LELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVENPIVEMDGDEMTRVFWKSIKDKLILPFLELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE R+KEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARMKEFTLKQMWKSPNGTIRNILNGTVFREPIMCKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWSKPICIGRHAF  137



>ref|XP_011086317.1| PREDICTED: isocitrate dehydrogenase [NADP] isoform X1 [Sesamum 
indicum]
Length=416

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IKEKLI P LELDIKY+DLG+ +RDAT+DKVT+ESA
Sbjct  4    EKIKVDNPIVEMDGDEMTRVIWKSIKEKLILPFLELDIKYFDLGLPHRDATNDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF L+ MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEARVKEFNLRHMWKSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_003616186.1| Isocitrate dehydrogenase [Medicago truncatula]
 gb|AES99144.1| NADP-dependent isocitrate dehydrogenase [Medicago truncatula]
Length=412

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 110/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTR+IW  IK+KLI P +ELDIKY+DLG+  RD TDDKVT+ESAE
Sbjct  5    KIKVANPIVEMDGDEMTRIIWKYIKDKLILPFVELDIKYFDLGLPYRDETDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEFGLKSMW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEARVKEFGLKSMWRSPNGTIRNILNGTVFREPIICKNIPRLIP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>gb|KFK35526.1| hypothetical protein AALP_AA4G002200 [Arabis alpina]
Length=416

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLIFP +ELDIKY+DLG+ NRDATDDKVT +SA
Sbjct  4    EKIKVVNPIVEMDGDEMTRVIWKFIKDKLIFPFVELDIKYFDLGLPNRDATDDKVTTDSA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCK  572
            +ATLKYNVAIKCATITPDE RV+EFGLK MW+SPNGTIRNILNGTVFREPI+CK
Sbjct  64   QATLKYNVAIKCATITPDEDRVREFGLKKMWRSPNGTIRNILNGTVFREPIICK  117



>dbj|BAJ89315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=414

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 112/134 (84%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTR+IW  IK+KLIFP L+LDIKY+DLG+ NRDAT DKVTIESA
Sbjct  4    EKIQVANPIVEMDGDEMTRIIWKWIKDKLIFPFLDLDIKYFDLGLPNRDATGDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCAT+TPDE RVKEF LK+MW+SPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATVTPDEGRVKEFNLKAMWRSPNGTIRNILNGTVFREPIICKNVPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|NP_001042583.1| Os01g0248400 [Oryza sativa Japonica Group]
 gb|AAD38292.1|AC007789_18 NADP-dependent isocitrate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAD81495.1| putative NADP-dependent isocitrate dehydrogenase [Oryza sativa 
Japonica Group]
 dbj|BAF04497.1| Os01g0248400 [Oryza sativa Japonica Group]
 dbj|BAG93136.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 110/134 (82%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI V NP+VEMDGDEMTRVIW  IK+KLIFP L+LDIKYYDLG+ NRDAT DKVTIESA
Sbjct  4    EKIVVANPVVEMDGDEMTRVIWKWIKDKLIFPFLDLDIKYYDLGLPNRDATGDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EATLKYNVAIKCATITPDE RVKEF L +MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EATLKYNVAIKCATITPDEGRVKEFNLSAMWKSPNGTIRNILNGTVFREPIICKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWIKPICIGRHAF  137



>ref|XP_006422322.1| hypothetical protein CICLE_v10005058mg [Citrus clementina]
 ref|XP_006493724.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X1 [Citrus 
sinensis]
 ref|XP_006493725.1| PREDICTED: isocitrate dehydrogenase [NADP]-like isoform X2 [Citrus 
sinensis]
 gb|ESR35562.1| hypothetical protein CICLE_v10005058mg [Citrus clementina]
Length=416

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 111/133 (83%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTRVIW +IK+KLI P LELDIKY+DLG+ NRDATDD+VTI+SA+
Sbjct  5    KIKVANPIVEMDGDEMTRVIWKLIKDKLINPFLELDIKYFDLGLPNRDATDDQVTIQSAQ  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATLKYNVAIKCATITPDEVRVKEFNLKRMWKSPNGTIRNILNGTVFREPIICKNIPRLVS  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>ref|XP_011005927.1| PREDICTED: isocitrate dehydrogenase [NADP] [Populus euphratica]
 ref|XP_011005928.1| PREDICTED: isocitrate dehydrogenase [NADP] [Populus euphratica]
 ref|XP_011005930.1| PREDICTED: isocitrate dehydrogenase [NADP] [Populus euphratica]
Length=414

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 110/134 (82%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTR+ W  IK+KLIFP +ELDIKY+DLG+ +RDATDDKVT+ESA
Sbjct  4    EKIKVANPIVEMDGDEMTRIFWQSIKDKLIFPFVELDIKYFDLGLPHRDATDDKVTVESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EA LKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L 
Sbjct  64   EAALKYNVAIKCATITPDEDRVKEFNLKQMWKSPNGTIRNILNGTVFREPIICKNIPRLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>gb|KHG15210.1| Isocitrate dehydrogenase [NADP] [Gossypium arboreum]
Length=417

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 109/133 (82%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI+V NPIVEMDGDEMTR+IW  IKEKLIFP LELDIKY+DLG+ NRDAT+D+VTI S E
Sbjct  6    KIKVMNPIVEMDGDEMTRIIWKSIKEKLIFPFLELDIKYFDLGLHNRDATNDEVTIASGE  65

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            ATLKYNVAIKCATITPDE RVKEF LK MWKSPNGTIRNILNGTVFREPI+CK    L  
Sbjct  66   ATLKYNVAIKCATITPDEGRVKEFNLKEMWKSPNGTIRNILNGTVFREPIICKNVPRLVP  125

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  126  SWTKPICIGRHAF  138



>ref|XP_010470469.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like isoform 
X5 [Camelina sativa]
Length=412

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLITPFLELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EAT KYNVAIKCATITPDE RV EFGLK MW+SPNGTIRNILNGTVFREPI+CK   +L 
Sbjct  64   EATKKYNVAIKCATITPDEGRVTEFGLKQMWRSPNGTIRNILNGTVFREPIMCKNVPKLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_010415139.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP] [Camelina 
sativa]
Length=412

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLITPFLELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EAT KYNVAIKCATITPDE RV EFGLK MW+SPNGTIRNILNGTVFREPI+CK   +L 
Sbjct  64   EATKKYNVAIKCATITPDEGRVTEFGLKQMWRSPNGTIRNILNGTVFREPIMCKNVPKLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_010511516.1| PREDICTED: cytosolic isocitrate dehydrogenase [NADP]-like [Camelina 
sativa]
Length=412

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 111/134 (83%), Gaps = 7/134 (5%)
 Frame = +3

Query  231  DKIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESA  410
            +KI+V NPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+DLG+ +RDATDDKVTIESA
Sbjct  4    EKIKVANPIVEMDGDEMTRVIWKSIKDKLITPFLELDIKYFDLGLPHRDATDDKVTIESA  63

Query  411  EATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL-  587
            EAT KYNVAIKCATITPDE RV EFGLK MW+SPNGTIRNILNGTVFREPI+CK   +L 
Sbjct  64   EATKKYNVAIKCATITPDEGRVTEFGLKQMWRSPNGTIRNILNGTVFREPIMCKNVPKLV  123

Query  588  ------FLVGRNPF  611
                    +GR+ F
Sbjct  124  PGWTKPICIGRHAF  137



>ref|XP_006354121.1| PREDICTED: isocitrate dehydrogenase [NADP]-like [Solanum tuberosum]
Length=415

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 109/133 (82%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI VQNPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+DLG+ +RDATDDKVT+ESAE
Sbjct  5    KITVQNPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYFDLGLPHRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            AT KYNVAIKCATITPDE RV EF LKSMW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATQKYNVAIKCATITPDEARVTEFNLKSMWRSPNGTIRNILNGTVFREPIMCKNIPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



>sp|P50217.1|IDHC_SOLTU RecName: Full=Isocitrate dehydrogenase [NADP]; Short=IDH; AltName: 
Full=IDP; AltName: Full=NADP(+)-specific ICDH; AltName: 
Full=Oxalosuccinate decarboxylase [Solanum tuberosum]
 prf||2111437A isocitrate dehydrogenase
Length=416

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 109/133 (82%), Gaps = 7/133 (5%)
 Frame = +3

Query  234  KIRVQNPIVEMDGDEMTRVIWTMIKEKLIFPHLELDIKYYDLGILNRDATDDKVTIESAE  413
            KI VQNPIVEMDGDEMTRVIW  IK+KLI P LELDIKY+ LG+ +RDATDDKVT+ESAE
Sbjct  5    KITVQNPIVEMDGDEMTRVIWKSIKDKLILPFLELDIKYFSLGLPHRDATDDKVTVESAE  64

Query  414  ATLKYNVAIKCATITPDETRVKEFGLKSMWKSPNGTIRNILNGTVFREPILCKIFQEL--  587
            AT KYNVAIKCATITPDE RVKEF LKSMW+SPNGTIRNILNGTVFREPI+CK    L  
Sbjct  65   ATQKYNVAIKCATITPDEARVKEFNLKSMWRSPNGTIRNILNGTVFREPIMCKNIPRLVP  124

Query  588  -----FLVGRNPF  611
                   +GR+ F
Sbjct  125  GWTKPICIGRHAF  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250