BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF049P17

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP10072.1|  unnamed protein product                                283   6e-91   Coffea canephora [robusta coffee]
ref|XP_004234840.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    281   4e-90   Solanum lycopersicum
ref|XP_003535857.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    281   4e-90   Glycine max [soybeans]
ref|XP_003518108.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    280   1e-89   Glycine max [soybeans]
ref|XP_006421451.1|  hypothetical protein CICLE_v10005148mg             276   1e-89   
ref|XP_006349549.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    280   2e-89   Solanum tuberosum [potatoes]
ref|XP_009618579.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    279   4e-89   Nicotiana tomentosiformis
gb|AGB05602.1|  sn-glycerol-3-phosphate acyltransferase                 278   6e-89   Camellia oleifera [abura-tsubaki]
ref|XP_006421453.1|  hypothetical protein CICLE_v10005148mg             278   9e-89   Citrus clementina [clementine]
ref|XP_007145631.1|  hypothetical protein PHAVU_007G255300g             278   1e-88   Phaseolus vulgaris [French bean]
ref|XP_004513649.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    277   3e-88   Cicer arietinum [garbanzo]
gb|KEH41602.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase-li...    276   8e-88   Medicago truncatula
ref|XP_009767064.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    276   9e-88   Nicotiana sylvestris
ref|XP_006493900.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    275   1e-87   Citrus sinensis [apfelsine]
ref|XP_010088401.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    276   3e-86   
ref|XP_002308046.1|  acyl-CoA:1-acylglycerol-3-phosphate acyltran...    271   4e-86   Populus trichocarpa [western balsam poplar]
ref|XP_002323308.2|  hypothetical protein POPTR_0016s05340g             273   5e-86   Populus trichocarpa [western balsam poplar]
ref|XP_011020321.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    271   5e-86   Populus euphratica
ref|XP_011033303.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    270   1e-85   Populus euphratica
ref|XP_004307568.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    270   2e-85   Fragaria vesca subsp. vesca
gb|ABU50327.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase          269   3e-85   Helianthus annuus
ref|XP_006402859.1|  hypothetical protein EUTSA_v10006028mg             266   4e-84   Eutrema salsugineum [saltwater cress]
gb|ABN09946.1|  lysophosphatidyl acyltransferase                        266   6e-84   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
ref|XP_009116469.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    266   7e-84   Brassica rapa
gb|ADC97478.1|  lysophosphatidic acid acyltransferase                   265   8e-84   Brassica napus [oilseed rape]
sp|Q6IWY1.1|LPAT2_BRAOL  RecName: Full=1-acyl-sn-glycerol-3-phosp...    265   8e-84   Brassica oleracea
gb|ADC97479.1|  lysophosphatidic acid acyltransferase                   265   9e-84   Brassica napus [oilseed rape]
ref|XP_010554846.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    265   1e-83   Tarenaya hassleriana [spider flower]
emb|CDY33810.1|  BnaCnng07280D                                          265   1e-83   Brassica napus [oilseed rape]
ref|XP_009104068.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    265   1e-83   Brassica rapa
ref|XP_010524157.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    265   2e-83   Tarenaya hassleriana [spider flower]
sp|Q9XFW4.1|LPAT2_BRANA  RecName: Full=1-acyl-sn-glycerol-3-phosp...    264   2e-83   Brassica napus [oilseed rape]
gb|ABM92334.2|  1-acylglycerol-3-phosphate acyltransferase              264   3e-83   Brassica juncea [brown mustard]
gb|AAM61033.1|  1-acylcerol-3-phosphate acyltransferase-like protein    264   3e-83   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567052.1|  lysophosphatidyl acyltransferase 2                    264   3e-83   Arabidopsis thaliana [mouse-ear cress]
gb|AGO14580.1|  A-class lysophosphatidate acyltransferase 2 isofo...    263   4e-83   Echium pitardii
ref|XP_002876428.1|  hypothetical protein ARALYDRAFT_907235             263   5e-83   Arabidopsis lyrata subsp. lyrata
gb|ABP93351.1|  lysophosphatidyl acyltransferase 2                      263   5e-83   Helianthus annuus
gb|AGO14579.1|  A-class lysophosphatidate acyltransferase 2 isofo...    262   2e-82   Echium pitardii
ref|XP_010516385.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    261   4e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010504698.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    261   4e-82   Camelina sativa [gold-of-pleasure]
ref|XP_008392182.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    261   5e-82   
emb|CDX67700.1|  BnaA07g17400D                                          260   7e-82   
ref|XP_010257310.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    260   1e-81   Nelumbo nucifera [Indian lotus]
emb|CDX88957.1|  BnaA04g02290D                                          259   2e-81   
ref|XP_009334964.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    259   2e-81   Pyrus x bretschneideri [bai li]
ref|XP_009345032.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    259   2e-81   Pyrus x bretschneideri [bai li]
gb|KFK35010.1|  hypothetical protein AALP_AA5G222500                    259   3e-81   Arabis alpina [alpine rockcress]
ref|XP_009139024.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    257   1e-80   Brassica rapa
ref|XP_011078878.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    257   1e-80   Sesamum indicum [beniseed]
gb|KCW90239.1|  hypothetical protein EUGRSUZ_A02397                     254   1e-80   Eucalyptus grandis [rose gum]
ref|XP_009387255.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    256   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011075205.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    256   3e-80   Sesamum indicum [beniseed]
ref|XP_007162250.1|  hypothetical protein PHAVU_001G136600g             256   3e-80   Phaseolus vulgaris [French bean]
ref|XP_003554183.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    255   6e-80   Glycine max [soybeans]
ref|XP_010312077.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    253   6e-80   
gb|KCW90238.1|  hypothetical protein EUGRSUZ_A02397                     254   6e-80   Eucalyptus grandis [rose gum]
ref|NP_001280186.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    255   6e-80   Prunus mume [ume]
emb|CAA88620.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase (...    254   9e-80   Limnanthes douglasii
ref|XP_010057561.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    254   2e-79   Eucalyptus grandis [rose gum]
gb|EYU20729.1|  hypothetical protein MIMGU_mgv1a008164mg                254   2e-79   Erythranthe guttata [common monkey flower]
gb|KJB36056.1|  hypothetical protein B456_006G138600                    252   2e-79   Gossypium raimondii
ref|XP_007202144.1|  hypothetical protein PRUPE_ppa007002mg             254   3e-79   Prunus persica
ref|XP_004249199.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    253   3e-79   Solanum lycopersicum
gb|KJB16435.1|  hypothetical protein B456_002G230000                    250   3e-79   Gossypium raimondii
ref|XP_006351222.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    253   4e-79   Solanum tuberosum [potatoes]
gb|KDP37345.1|  hypothetical protein JCGZ_06799                         253   4e-79   Jatropha curcas
gb|AEZ56251.1|  plastid 1-acylglycerol-phosphate acyltransferase        253   4e-79   Jatropha curcas
gb|KJB16434.1|  hypothetical protein B456_002G230000                    250   5e-79   Gossypium raimondii
emb|CAN83214.1|  hypothetical protein VITISV_038716                     253   6e-79   Vitis vinifera
ref|XP_002283340.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    253   6e-79   Vitis vinifera
ref|XP_008443106.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    252   1e-78   Cucumis melo [Oriental melon]
ref|XP_004136588.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    252   1e-78   Cucumis sativus [cucumbers]
gb|KJB36055.1|  hypothetical protein B456_006G138600                    252   1e-78   Gossypium raimondii
ref|XP_004165747.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    252   2e-78   
gb|ACV73676.1|  lysophosphatidic acid acyltransferase 2                 251   2e-78   Tropaeolum majus
gb|AFK40266.1|  unknown                                                 251   2e-78   Medicago truncatula
gb|KJB16432.1|  hypothetical protein B456_002G230000                    250   2e-78   Gossypium raimondii
ref|XP_003625176.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase     251   2e-78   Medicago truncatula
ref|XP_003521190.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    251   2e-78   Glycine max [soybeans]
ref|XP_004493527.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    251   3e-78   Cicer arietinum [garbanzo]
ref|XP_006293344.1|  hypothetical protein CARUB_v100174200mg            250   4e-78   
gb|KJB16430.1|  hypothetical protein B456_002G230000                    250   4e-78   Gossypium raimondii
gb|KJB16433.1|  hypothetical protein B456_002G230000                    249   2e-77   Gossypium raimondii
ref|NP_001148618.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    248   3e-77   Zea mays [maize]
ref|XP_010265751.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    248   3e-77   Nelumbo nucifera [Indian lotus]
ref|XP_009414749.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    248   3e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN28103.1|  unknown                                                 248   3e-77   Zea mays [maize]
gb|KHG04120.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase 2        248   5e-77   Gossypium arboreum [tree cotton]
ref|XP_002451179.1|  hypothetical protein SORBIDRAFT_05g025420          247   7e-77   Sorghum bicolor [broomcorn]
gb|KDO57199.1|  hypothetical protein CISIN_1g0379582mg                  239   8e-77   Citrus sinensis [apfelsine]
ref|NP_001105919.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    247   1e-76   Zea mays [maize]
ref|XP_009387254.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    247   1e-76   
ref|XP_004979811.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    246   1e-76   Setaria italica
gb|KCW90236.1|  hypothetical protein EUGRSUZ_A02397                     247   2e-76   Eucalyptus grandis [rose gum]
gb|AHC70248.1|  lysophosphatidic acid acyltransferase                   246   2e-76   Sterculia foetida
ref|XP_008227141.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    246   2e-76   Prunus mume [ume]
ref|XP_011006209.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    244   4e-76   Populus euphratica
ref|XP_011006208.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    245   6e-76   Populus euphratica
ref|XP_011006207.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    244   9e-76   Populus euphratica
dbj|BAJ84894.1|  predicted protein                                      243   3e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003547001.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    242   9e-75   Glycine max [soybeans]
ref|XP_002298406.2|  acyl-CoA:1-acylglycerol-3-phosphate acyltran...    242   9e-75   Populus trichocarpa [western balsam poplar]
gb|KHN33345.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase 3        242   1e-74   Glycine soja [wild soybean]
ref|XP_010672763.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    241   4e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003575968.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    240   4e-74   Brachypodium distachyon [annual false brome]
ref|XP_007028850.1|  Lysophosphatidyl acyltransferase 2                 241   5e-74   
ref|XP_006852430.1|  hypothetical protein AMTR_s00021p00084240          239   9e-74   Amborella trichopoda
ref|XP_004486964.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    239   1e-73   
ref|XP_004486963.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    239   1e-73   Cicer arietinum [garbanzo]
ref|XP_007150370.1|  hypothetical protein PHAVU_005G147900g             238   3e-73   Phaseolus vulgaris [French bean]
ref|XP_008813484.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    236   4e-73   Phoenix dactylifera
ref|XP_010673624.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    237   6e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006304715.1|  hypothetical protein CARUB_v10012002mg             236   1e-72   Capsella rubella
ref|XP_002894307.1|  hypothetical protein ARALYDRAFT_474240             236   1e-72   
ref|XP_008801931.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    235   2e-72   
ref|XP_008813483.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    236   2e-72   Phoenix dactylifera
gb|KFK35863.1|  hypothetical protein AALP_AA4G046700                    236   2e-72   Arabis alpina [alpine rockcress]
ref|XP_003597431.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase     235   3e-72   
ref|NP_175537.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase 3      235   5e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003636648.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase     236   5e-72   
ref|XP_010479592.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    234   6e-72   Camelina sativa [gold-of-pleasure]
ref|XP_008801930.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    234   8e-72   Phoenix dactylifera
gb|ADE75797.1|  unknown                                                 234   1e-71   Picea sitchensis
ref|XP_002526730.1|  lysophosphatidic acid acyltransferase, putative    234   1e-71   
ref|XP_010906759.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    233   2e-71   Elaeis guineensis
gb|EPS68644.1|  lysophosphatidic acid acyltransferase                   233   2e-71   Genlisea aurea
ref|XP_010461958.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    233   4e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010909860.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    232   6e-71   
ref|XP_010500700.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    231   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_002513487.1|  lysophosphatidic acid acyltransferase, putative    231   2e-70   Ricinus communis
emb|CDP18472.1|  unnamed protein product                                230   3e-70   Coffea canephora [robusta coffee]
ref|XP_010031802.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    230   4e-70   Eucalyptus grandis [rose gum]
ref|XP_006597258.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    232   4e-70   Glycine max [soybeans]
ref|XP_009395596.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    229   6e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004503603.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    229   7e-70   Cicer arietinum [garbanzo]
ref|XP_002894308.1|  hypothetical protein ARALYDRAFT_892094             232   1e-69   
ref|XP_006663068.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    227   5e-69   Oryza brachyantha
ref|XP_010237505.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    225   6e-69   Brachypodium distachyon [annual false brome]
gb|ABA94922.2|  1-acyl-sn-glycerol-3-phosphate acyltransferase PL...    225   2e-68   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68515.1|  hypothetical protein OsI_36790                          225   3e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_003577308.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    225   3e-68   Brachypodium distachyon [annual false brome]
gb|EEE52425.1|  hypothetical protein OsJ_34550                          225   7e-68   Oryza sativa Japonica Group [Japonica rice]
emb|CDY65469.1|  BnaA08g29540D                                          223   1e-67   Brassica napus [oilseed rape]
ref|XP_007214575.1|  hypothetical protein PRUPE_ppa019921mg             222   3e-67   
ref|XP_009375057.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    221   2e-66   
emb|CDY03631.1|  BnaC03g68900D                                          220   2e-66   
ref|XP_006393066.1|  hypothetical protein EUTSA_v10011593mg             219   3e-66   
ref|XP_010545584.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    219   4e-66   
ref|XP_007015031.1|  Lysophosphatidyl acyltransferase 3                 218   1e-65   
ref|XP_004139036.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    218   1e-65   Cucumis sativus [cucumbers]
ref|XP_011080283.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    218   2e-65   Sesamum indicum [beniseed]
ref|XP_006361745.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    216   6e-65   Solanum tuberosum [potatoes]
ref|XP_010102333.1|  Xanthine dehydrogenase                             228   1e-64   
ref|XP_006446109.1|  hypothetical protein CICLE_v10015539mg             216   2e-64   Citrus clementina [clementine]
ref|XP_008450418.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    215   2e-64   Cucumis melo [Oriental melon]
ref|XP_006470598.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    216   3e-64   Citrus sinensis [apfelsine]
emb|CDY35563.1|  BnaC05g27180D                                          214   4e-64   Brassica napus [oilseed rape]
ref|XP_009144912.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    214   7e-64   Brassica rapa
ref|XP_002268451.2|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    214   9e-64   Vitis vinifera
emb|CBI21663.3|  unnamed protein product                                213   2e-63   Vitis vinifera
ref|XP_002443267.1|  hypothetical protein SORBIDRAFT_08g016610          211   6e-63   Sorghum bicolor [broomcorn]
ref|XP_004250948.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    211   6e-63   
ref|XP_007212911.1|  hypothetical protein PRUPE_ppa022232mg             211   6e-63   Prunus persica
ref|XP_009615949.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    211   7e-63   Nicotiana tomentosiformis
ref|XP_008377433.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    209   4e-62   Malus domestica [apple tree]
gb|EYU46266.1|  hypothetical protein MIMGU_mgv1a026523mg                208   7e-62   Erythranthe guttata [common monkey flower]
ref|XP_009773917.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    208   8e-62   Nicotiana sylvestris
ref|XP_010673625.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    202   7e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006470599.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    203   1e-59   Citrus sinensis [apfelsine]
emb|CDY52093.1|  BnaC04g55420D                                          201   8e-58   Brassica napus [oilseed rape]
ref|XP_001764965.1|  predicted protein                                  195   2e-56   
ref|XP_006421452.1|  hypothetical protein CICLE_v10005148mg             194   2e-56   
ref|XP_007015028.1|  Lysophosphatidyl acyltransferase 2, putative...    194   2e-56   
ref|XP_008227143.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    194   3e-56   Prunus mume [ume]
ref|XP_002986838.1|  hypothetical protein SELMODRAFT_124776             193   5e-56   Selaginella moellendorffii
ref|XP_002969275.1|  hypothetical protein SELMODRAFT_146320             189   1e-54   
ref|XP_006493899.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    191   1e-54   
ref|XP_008363711.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    182   4e-54   
ref|XP_002513486.1|  1-acylglycerol-3-phosphate acyltransferase, ...    185   5e-53   Ricinus communis
ref|XP_004486965.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    184   2e-52   
ref|XP_001754626.1|  predicted protein                                  186   6e-52   
gb|EMT23643.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1     184   8e-52   
gb|AAF20003.1|AF213937_1  1-acyl-sn-glycerol-3-phosphate acyltran...    175   1e-49   Prunus dulcis [sweet almond]
ref|XP_007015027.1|  Lysophosphatidyl acyltransferase 2, putative...    176   1e-49   
gb|KJB16431.1|  hypothetical protein B456_002G230000                    172   7e-49   Gossypium raimondii
gb|EMS63864.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1     174   7e-49   Triticum urartu
ref|XP_002314068.2|  hypothetical protein POPTR_0009s05930g             175   1e-48   
gb|ACU18782.1|  unknown                                                 171   2e-48   Glycine max [soybeans]
gb|AFW60270.1|  hypothetical protein ZEAMMB73_783506                    171   3e-48   
ref|XP_011025521.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    173   3e-48   Populus euphratica
ref|XP_011025520.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    173   3e-48   Populus euphratica
tpg|DAA42326.1|  TPA: hypothetical protein ZEAMMB73_334173              171   4e-48   
ref|NP_001068336.2|  Os11g0637800                                       164   4e-48   
ref|XP_010672762.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    174   9e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU39879.1|  hypothetical protein MIMGU_mgv1a010933mg                169   2e-47   Erythranthe guttata [common monkey flower]
gb|KCW51192.1|  hypothetical protein EUGRSUZ_J00779                     164   3e-45   Eucalyptus grandis [rose gum]
gb|KHG13155.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase 2 ...    161   3e-44   Gossypium arboreum [tree cotton]
gb|AAP80656.1|AF479037_1  1-acy1-glycerol-3-phosphate acyltransfe...    155   8e-43   Triticum aestivum [Canadian hard winter wheat]
gb|KDO61278.1|  hypothetical protein CISIN_1g016254mg                   155   3e-42   Citrus sinensis [apfelsine]
ref|XP_006446108.1|  hypothetical protein CICLE_v10015539mg             155   3e-42   
ref|XP_008363635.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    152   3e-40   
ref|XP_008337106.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    138   2e-37   
ref|XP_002590323.1|  hypothetical protein BRAFLDRAFT_121375             143   4e-37   Branchiostoma floridae
ref|XP_007015029.1|  Lysophosphatidyl acyltransferase 2, putative...    141   1e-36   
ref|XP_003419084.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    137   8e-35   Loxodonta africana [African bush elephant]
ref|XP_004364540.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase     137   2e-34   Capsaspora owczarzaki ATCC 30864
ref|XP_004602547.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    135   4e-34   Sorex araneus [Eurasian shrew]
ref|XP_001944534.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    135   5e-34   Acyrthosiphon pisum
emb|CAX11992.1|  1-acylglycerol-3-phosphate O-acyltransferase 3         131   7e-34   Danio rerio [leopard danio]
ref|XP_001745510.1|  hypothetical protein                               134   1e-33   Monosiga brevicollis MX1
ref|XP_005427279.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    134   2e-33   
ref|XP_005037280.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    134   2e-33   Ficedula albicollis
ref|XP_005037288.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    134   2e-33   
ref|XP_007251394.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    134   2e-33   Astyanax mexicanus [blind cave fish]
ref|NP_001279132.1|  1-acylglycerol-3-phosphate O-acyltransferase 3     134   2e-33   Callorhinchus milii [Australian ghost shark]
gb|AFM88716.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ga...    134   2e-33   Callorhinchus milii [Australian ghost shark]
ref|XP_009071880.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    131   2e-33   Acanthisitta chloris
ref|XP_006109547.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   2e-33   
ref|XP_010127144.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   2e-33   Chlamydotis macqueenii
ref|XP_008327138.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    133   3e-33   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008939552.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   3e-33   Merops nubicus
ref|XP_005489059.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    133   3e-33   Zonotrichia albicollis
ref|XP_009087839.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    133   4e-33   Serinus canaria [canary]
ref|XP_006922611.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    133   4e-33   
gb|KDR11829.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    133   4e-33   Zootermopsis nevadensis
ref|XP_008275417.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    132   4e-33   Stegastes partitus
ref|XP_006608633.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    132   5e-33   
gb|ADO27983.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    132   6e-33   Ictalurus furcatus
ref|XP_001621942.1|  predicted protein                                  132   6e-33   Nematostella vectensis
ref|XP_008498571.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    132   6e-33   
ref|XP_006724095.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   6e-33   
ref|XP_011374681.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    131   6e-33   Pteropus vampyrus
gb|KFP28149.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    130   7e-33   Colius striatus
ref|XP_010206239.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   8e-33   Colius striatus
ref|XP_004384856.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    132   8e-33   Trichechus manatus latirostris
gb|ACY30369.1|  1-acylglycerol-3-phosphate O-acyltransferase 3          132   9e-33   Salmo salar
ref|XP_002189743.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    132   9e-33   
ref|XP_008631063.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    132   1e-32   
ref|XP_010884320.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    132   1e-32   
ref|XP_006608632.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    132   1e-32   Apis dorsata [rock honeybee]
ref|XP_009996223.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    132   1e-32   Chaetura pelagica
ref|XP_006639021.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    131   1e-32   Lepisosteus oculatus
ref|XP_010739293.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    131   1e-32   
ref|XP_003689806.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    132   1e-32   Apis florea [dwarf honeybee]
ref|XP_007557237.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    131   1e-32   Poecilia formosa
ref|NP_998590.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    131   1e-32   Danio rerio [leopard danio]
ref|XP_003434035.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    131   1e-32   
ref|XP_006799219.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    131   1e-32   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005501703.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    131   1e-32   
ref|NP_001087659.1|  1-acylglycerol-3-phosphate O-acyltransferase 3     131   1e-32   Xenopus laevis [clawed frog]
ref|XP_003962129.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    131   2e-32   Takifugu rubripes [tiger puffer]
ref|XP_010366228.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   2e-32   
ref|NP_001187438.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    131   2e-32   Ictalurus punctatus
ref|XP_004575514.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    131   2e-32   
ref|XP_010722493.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    131   2e-32   Meleagris gallopavo [common turkey]
gb|KDP22082.1|  hypothetical protein JCGZ_25913                         131   2e-32   Jatropha curcas
ref|XP_009639322.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    131   2e-32   Egretta garzetta
ref|XP_005919380.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    131   2e-32   Haplochromis burtoni
emb|CDQ81241.1|  unnamed protein product                                130   2e-32   Oncorhynchus mykiss
ref|XP_009472604.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    131   2e-32   Nipponia nippon
ref|XP_009489719.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    131   2e-32   Pelecanus crispus
ref|XP_005745742.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   2e-32   Pundamilia nyererei
ref|XP_416756.2|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate acylt...    130   2e-32   Gallus gallus [bantam]
ref|XP_003445368.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   2e-32   Oreochromis niloticus
ref|XP_007426401.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   2e-32   Python bivittatus
gb|EFX74227.1|  hypothetical protein DAPPUDRAFT_200081                  130   3e-32   Daphnia pulex
ref|XP_001849976.1|  1-acylglycerol-3-phosphate acyltransferase         130   3e-32   Culex quinquefasciatus
ref|XP_010865629.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   3e-32   Esox lucius
ref|XP_005312682.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   3e-32   Chrysemys picta bellii
ref|XP_010159792.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   3e-32   Eurypyga helias
ref|XP_001607215.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   3e-32   
gb|ETE66236.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    130   4e-32   Ophiophagus hannah
gb|ELV10335.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    129   4e-32   Tupaia chinensis
gb|KFV99739.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    129   4e-32   Eurypyga helias
ref|XP_008401471.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   4e-32   Poecilia reticulata
ref|XP_008931200.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   4e-32   
ref|XP_009985430.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   4e-32   Tauraco erythrolophus
ref|XP_003798130.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   4e-32   Otolemur garnettii
ref|NP_001011265.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    130   4e-32   
ref|XP_008985009.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   4e-32   
ref|XP_009930927.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   5e-32   
ref|XP_009677833.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   5e-32   
ref|XP_009904113.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   5e-32   
ref|XP_009877719.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   5e-32   
ref|XP_010011299.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   5e-32   
ref|XP_005012527.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   5e-32   
ref|XP_005234551.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   5e-32   
ref|XP_010073966.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   5e-32   
ref|XP_005151770.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   5e-32   
ref|XP_003277406.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   5e-32   
ref|XP_007967793.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    130   5e-32   
ref|NP_001008119.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    129   5e-32   
ref|NP_064517.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    129   5e-32   
gb|AAQ89067.1|  AGPAT3                                                  129   5e-32   
ref|XP_010217044.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   6e-32   
ref|XP_003823897.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   6e-32   
gb|KFZ60093.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    129   6e-32   
ref|NP_001127407.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    129   6e-32   
ref|XP_001146797.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   6e-32   
ref|XP_010366226.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   6e-32   
ref|XP_010082881.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   6e-32   
ref|NP_001134736.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    126   6e-32   
ref|XP_005807727.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   7e-32   
ref|XP_011471961.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   7e-32   
ref|XP_006638831.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   8e-32   
ref|XP_005548628.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   8e-32   
ref|XP_004996737.1|  hypothetical protein PTSG_02252                    129   9e-32   
ref|NP_001080456.1|  1-acylglycerol-3-phosphate O-acyltransferase 3     129   9e-32   
dbj|BAG62268.1|  unnamed protein product                                129   9e-32   
ref|XP_006894008.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   9e-32   
ref|XP_004654569.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   9e-32   
ref|XP_007064498.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   9e-32   
ref|XP_006876849.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   9e-32   
ref|XP_007493273.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   1e-31   
ref|XP_004931957.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   1e-31   
ref|XP_004931956.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   1e-31   
ref|XP_010163464.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   1e-31   
ref|XP_006262808.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   1e-31   
gb|KFQ87757.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    125   1e-31   
ref|XP_006137946.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    128   1e-31   
ref|XP_008320056.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    128   2e-31   
ref|XP_006169505.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    128   2e-31   
gb|AGG54998.1|  acyltransferase AGPAT6                                  128   2e-31   
ref|XP_005261216.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    129   2e-31   
ref|XP_970017.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate acylt...    128   2e-31   
ref|XP_005992834.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    128   2e-31   
ref|XP_008825609.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    128   2e-31   
ref|XP_006099969.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    128   2e-31   
gb|EFX76865.1|  hypothetical protein DAPPUDRAFT_188541                  128   2e-31   
ref|XP_011311483.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    128   2e-31   
gb|AAI58874.1|  Agpat3 protein                                          127   2e-31   
ref|XP_007546255.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    128   2e-31   
ref|NP_001099848.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    128   2e-31   
ref|XP_009305745.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   3e-31   
ref|XP_003763398.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    128   3e-31   
ref|NP_443747.2|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    128   3e-31   
gb|AAH52382.1|  1-acylglycerol-3-phosphate O-acyltransferase 3          128   3e-31   
gb|EDL31741.1|  1-acylglycerol-3-phosphate O-acyltransferase 3, i...    128   3e-31   
dbj|BAE34826.1|  unnamed protein product                                127   3e-31   
ref|XP_008428104.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   3e-31   
ref|XP_004696957.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   3e-31   
ref|XP_003991408.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   3e-31   
ref|XP_005360340.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   3e-31   
ref|XP_007945444.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   4e-31   
ref|XP_004410719.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   4e-31   
ref|XP_006877339.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    123   4e-31   
ref|XP_003927614.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   4e-31   
ref|XP_006746103.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   4e-31   
ref|XP_010964818.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   4e-31   
gb|ACN11432.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    127   5e-31   
ref|XP_008143886.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   5e-31   
ref|XP_004429705.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   5e-31   
ref|XP_008708403.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   5e-31   
gb|KFP76689.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    124   5e-31   
ref|XP_009868947.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   5e-31   
ref|XP_010781417.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   5e-31   
ref|XP_007639541.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   5e-31   
gb|ENN81517.1|  hypothetical protein YQE_02046                          127   5e-31   
gb|ELK03565.1|  Trafficking protein particle complex subunit 10         131   6e-31   
emb|CDQ68415.1|  unnamed protein product                                127   6e-31   
ref|XP_006088912.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   6e-31   
ref|XP_002925922.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   6e-31   
ref|XP_006759048.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   6e-31   
gb|AGG55014.1|  acyltransferase AGPAT6                                  127   6e-31   
ref|XP_004631856.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   6e-31   
ref|XP_006989510.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   6e-31   
ref|XP_005807690.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    127   7e-31   
ref|XP_010138461.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   7e-31   
ref|XP_010155362.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    123   7e-31   
ref|XP_008105662.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   7e-31   
ref|XP_006175309.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   7e-31   
ref|XP_011439266.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   7e-31   
ref|XP_005375932.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   8e-31   
ref|XP_007538264.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   8e-31   
ref|XP_001654527.1|  AAEL010399-PA                                      125   9e-31   
ref|XP_009057171.1|  hypothetical protein LOTGIDRAFT_121393             126   9e-31   
ref|XP_004762311.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   9e-31   
ref|XP_005880486.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   1e-30   
ref|XP_006275864.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   1e-30   
ref|XP_005900476.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    122   1e-30   
ref|XP_005070749.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   1e-30   
ref|XP_011199230.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   1e-30   
ref|XP_001491027.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   1e-30   
ref|XP_006010829.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   1e-30   
ref|XP_007231300.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   1e-30   
ref|XP_006021965.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   1e-30   
gb|KFV88186.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    126   1e-30   
ref|XP_009686661.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    126   1e-30   
ref|NP_001137172.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    125   1e-30   
ref|XP_006038517.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   2e-30   
gb|AIN34698.1|  fatty alcohol acetyltransferase                         125   2e-30   
gb|EFZ17110.1|  hypothetical protein SINV_05410                         121   2e-30   
ref|XP_009893833.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   2e-30   
ref|XP_005443156.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    125   2e-30   
ref|XP_007231299.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   2e-30   
ref|XP_008545546.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   2e-30   
emb|CAA90019.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase         124   2e-30   
ref|XP_010866423.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   2e-30   
ref|XP_004480140.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    126   2e-30   
ref|XP_008055094.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    125   2e-30   
ref|NP_998157.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    125   2e-30   
ref|XP_010582782.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   2e-30   
gb|EFN64501.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    125   2e-30   
ref|XP_009083431.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   2e-30   
ref|NP_001133610.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    125   2e-30   
ref|XP_009319030.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   2e-30   
ref|XP_006060833.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   2e-30   
ref|XP_003441050.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   2e-30   
ref|XP_003463996.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   2e-30   
ref|XP_009980716.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   2e-30   
ref|XP_005907644.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   2e-30   
ref|XP_009806874.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    125   2e-30   
gb|KFP74586.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    125   2e-30   
ref|XP_008923849.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   3e-30   
ref|XP_010833202.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   3e-30   
ref|XP_011498819.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   3e-30   
ref|XP_003705225.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   3e-30   
ref|XP_010218895.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   3e-30   
emb|CDQ89987.1|  unnamed protein product                                125   3e-30   
gb|KFV14158.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    125   3e-30   
ref|XP_011261943.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   3e-30   
emb|CAB41190.1|  1-acylcerol-3-phosphate acyltransferase-like pro...    124   3e-30   
ref|XP_005230336.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   3e-30   
gb|EOB03997.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    125   3e-30   
gb|KFZ68512.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    125   3e-30   
ref|XP_005737162.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   3e-30   
ref|XP_004556061.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   3e-30   
ref|XP_007887797.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    125   3e-30   
ref|XP_005474100.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   3e-30   
ref|XP_005915527.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   3e-30   
ref|XP_005323500.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   3e-30   
ref|XP_011482879.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   3e-30   
gb|EPY88109.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ga...    125   3e-30   
ref|XP_005836674.1|  hypothetical protein GUITHDRAFT_67735              122   3e-30   
ref|XP_008488411.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   3e-30   
ref|XP_005015963.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   3e-30   
gb|KFW82364.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    124   3e-30   
ref|XP_009288284.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    125   4e-30   
ref|XP_005956861.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
gb|EZA54711.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    125   4e-30   
ref|XP_009938658.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
gb|KFQ91658.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    124   4e-30   
ref|XP_004003424.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
ref|XP_005737161.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
ref|XP_004556063.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
ref|XP_009469458.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
ref|XP_005915529.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
emb|CDQ82780.1|  unnamed protein product                                125   4e-30   
ref|XP_005675712.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
gb|KFR15276.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    125   4e-30   
ref|XP_011143319.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
ref|XP_004556060.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
ref|XP_005526983.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
ref|XP_009998295.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
ref|XP_002030766.1|  GM24405                                            124   4e-30   
ref|XP_004935617.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
gb|EHB08231.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    124   4e-30   
ref|XP_005915528.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
ref|XP_004556062.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   4e-30   
ref|XP_005305778.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   5e-30   
ref|XP_005737160.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   5e-30   
ref|XP_308646.4|  AGAP007113-PA                                         124   5e-30   
ref|XP_010634754.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   5e-30   
gb|KFW74159.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    124   5e-30   
ref|XP_010998221.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    124   5e-30   
ref|XP_008162212.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   5e-30   
ref|XP_419616.2|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate acylt...    124   5e-30   
ref|XP_010634747.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   6e-30   
ref|XP_011482877.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   6e-30   
ref|XP_005973237.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    122   6e-30   
emb|CAG09457.1|  unnamed protein product                                124   6e-30   
ref|XP_008058314.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   6e-30   
ref|XP_001371532.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   7e-30   
ref|NP_080920.2|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    124   7e-30   
gb|EAW47583.1|  1-acylglycerol-3-phosphate O-acyltransferase 4 (l...    120   8e-30   
gb|KFO53964.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    124   8e-30   
ref|NP_001033135.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    124   8e-30   
gb|EDL02075.1|  1-acylglycerol-3-phosphate O-acyltransferase 1 (l...    124   8e-30   
ref|XP_010020892.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   8e-30   
ref|XP_007665415.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    123   8e-30   
ref|XP_004892857.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    124   8e-30   
ref|XP_005111448.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   9e-30   
ref|XP_004842553.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   9e-30   
ref|XP_010389961.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   9e-30   
ref|XP_011161524.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   9e-30   
ref|XP_008641548.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   9e-30   
ref|XP_005416320.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    123   1e-29   
ref|XP_008943761.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    123   1e-29   
gb|ETN67995.1|  1-acylglycerol-3-phosphate acyltransferase              124   1e-29   
ref|XP_003204124.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    123   1e-29   
ref|XP_011338106.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   1e-29   
ref|XP_008565934.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    124   1e-29   
ref|XP_006800842.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    123   1e-29   
ref|XP_001664249.1|  AAEL014026-PA                                      123   1e-29   
ref|XP_005486548.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    123   1e-29   
ref|XP_003964149.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    123   1e-29   
ref|NP_648888.1|  CG4729, isoform A                                     123   1e-29   
ref|XP_009089786.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    123   1e-29   
ref|XP_002085135.1|  GD12474                                            123   1e-29   



>emb|CDP10072.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   283 bits (725),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL QAI FVLIRPLSK+TYRRINRV AELLWLEL+W+V WWAGVK++
Sbjct  11   PLGVLFFLSGLVINLFQAIFFVLIRPLSKSTYRRINRVLAELLWLELVWIVDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET KLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW
Sbjct  71   LYTDSETFKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE+TL SGL++LRDYPLPFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDESTLKSGLERLRDYPLPFWLALFV  171



>ref|XP_004234840.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Solanum 
lycopersicum]
 ref|XP_010317926.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Solanum 
lycopersicum]
 ref|XP_010317927.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Solanum 
lycopersicum]
Length=375

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA CFVL+RP+SK+TYRRINR+ AELLWLEL+W+V WWAGVK+K
Sbjct  11   PLGVLFFISGLVINLIQATCFVLVRPISKSTYRRINRIVAELLWLELVWIVDWWAGVKIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +Y DPET  LMGKEHALVI+NH+SDIDWLVGW+LAQRSGCLGS+LAVMKKSSKLLPVIGW
Sbjct  71   VYADPETFNLMGKEHALVIANHRSDIDWLVGWILAQRSGCLGSSLAVMKKSSKLLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SGLQ+L DYPLPFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDERTLKSGLQRLSDYPLPFWLALFV  171



>ref|XP_003535857.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Glycine max]
 gb|KHN22374.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=383

 Score =   281 bits (720),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQAIC+V++RP+SKN YRR+NRV AELLWLEL+W++ WWAGVKV+
Sbjct  8    PLGLLFFASGLIVNLIQAICYVVVRPVSKNLYRRMNRVVAELLWLELVWIIDWWAGVKVQ  67

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TDPET + MGKEHALVISNH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  68   VFTDPETFRSMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  127

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SGLQQLRD+PLPFWLALFV
Sbjct  128  SMWFSEYLFLERSWAKDERTLKSGLQQLRDFPLPFWLALFV  168



>ref|XP_003518108.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Glycine max]
 gb|KHN05957.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=384

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQAIC+V++RP+SKN YRR+NRV AELLWLEL+W++ WWAGVKV+
Sbjct  8    PLGLLFFASGLIVNLIQAICYVVVRPVSKNLYRRMNRVVAELLWLELVWIIDWWAGVKVQ  67

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TDPET   MGKEHALVISNH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  68   VFTDPETFHSMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  127

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SGLQQLRD+PLPFWLALFV
Sbjct  128  SMWFSEYLFLERSWAKDERTLKSGLQQLRDFPLPFWLALFV  168



>ref|XP_006421451.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
 gb|ESR34691.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
Length=282

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+CFV IRPLSKNTYRRINR  AELLWLEL+W+V WWAGVK+K
Sbjct  11   PLGLLFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            L+ D ET +LMGKEHALV+SNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   LFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+LRDYP PFWLALFV
Sbjct  131  SMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFV  171



>ref|XP_006349549.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Solanum tuberosum]
Length=388

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA C+VL+RP+SK+TYRRINR+ AELLWLEL+W+V WWAGVK+K
Sbjct  11   PLGVLFFISGLVINLIQATCYVLVRPISKSTYRRINRIVAELLWLELVWIVDWWAGVKIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +Y DPET  LMGKEHALVI+NH+SDIDWLVGW+LAQRSGCLGS+LAVMKKSSKLLPVIGW
Sbjct  71   VYADPETFNLMGKEHALVIANHRSDIDWLVGWILAQRSGCLGSSLAVMKKSSKLLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SGLQ+L DYPLPFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDERTLKSGLQRLSDYPLPFWLALFV  171



>ref|XP_009618579.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Nicotiana 
tomentosiformis]
Length=387

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA CFVLIRP+SK+TYRR+NR+FAELLWLEL+W+V WWAGVK+K
Sbjct  11   PLGVLFFISGLVINLIQATCFVLIRPISKSTYRRLNRIFAELLWLELVWIVDWWAGVKIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +Y DP+   LMGKEHALVI+NH+SDIDWLVGW+LAQRSGCLGS+LAVMKKSSKLLPVIGW
Sbjct  71   VYADPKEFNLMGKEHALVIANHRSDIDWLVGWILAQRSGCLGSSLAVMKKSSKLLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SGLQ+L DYPLPFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDERTLKSGLQRLSDYPLPFWLALFV  171



>gb|AGB05602.1| sn-glycerol-3-phosphate acyltransferase [Camellia oleifera]
Length=386

 Score =   278 bits (712),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 145/157 (92%), Gaps = 1/157 (1%)
 Frame = +2

Query  161  LFYL-GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTD  337
            LF+L GL  NLIQAICFVL+RPLSKNTYR+INRV AELLWLEL+W+V WWAGVK+KL+TD
Sbjct  15   LFFLSGLVVNLIQAICFVLVRPLSKNTYRKINRVVAELLWLELVWIVDWWAGVKIKLFTD  74

Query  338  PETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWF  517
             ET +LMGKEHALV+SNHKSDIDWLVGWVLAQR+GCLGS LAVMKKSSK LP IGWSMWF
Sbjct  75   SETFRLMGKEHALVVSNHKSDIDWLVGWVLAQRAGCLGSALAVMKKSSKFLPAIGWSMWF  134

Query  518  SEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SEYLFLERSWAKDE TL SGLQ+L+D+PLPFWLALFV
Sbjct  135  SEYLFLERSWAKDEITLKSGLQRLKDFPLPFWLALFV  171



>ref|XP_006421453.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
 gb|ESR34693.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
Length=387

 Score =   278 bits (711),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+CFV IRPLSKNTYRRINR  AELLWLEL+W+V WWAGVK+K
Sbjct  11   PLGLLFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            L+ D ET +LMGKEHALV+SNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   LFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+LRDYP PFWLALFV
Sbjct  131  SMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFV  171



>ref|XP_007145631.1| hypothetical protein PHAVU_007G255300g [Phaseolus vulgaris]
 gb|ESW17625.1| hypothetical protein PHAVU_007G255300g [Phaseolus vulgaris]
Length=383

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+C+V +RP+SKN YRR+NRV AELLWLEL+W++ WWAGVKV+
Sbjct  8    PLGLLFFSSGLIVNLIQALCYVFVRPVSKNLYRRMNRVVAELLWLELVWIIDWWAGVKVQ  67

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD ET + MGKEHALVISNH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  68   VFTDSETFRSMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  127

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE+TL SGLQQLRD+PLPFWLALFV
Sbjct  128  SMWFSEYLFLERSWAKDESTLKSGLQQLRDFPLPFWLALFV  168



>ref|XP_004513649.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cicer arietinum]
Length=386

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+    F  GL  NLIQAIC+V++RP+SKN +RRINR+ AELLWLEL+W++ WWAGV+++
Sbjct  11   PLSILFFASGLIVNLIQAICYVIVRPVSKNLHRRINRLVAELLWLELVWIIDWWAGVQIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TDPET +LMGKEHALVISNHKSDIDWLVGW+LA+RSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   VFTDPETFRLMGKEHALVISNHKSDIDWLVGWILAERSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQQLRD+PLPFWLALFV
Sbjct  131  SMWFSEYLFLERNWAKDESTLKSGLQQLRDFPLPFWLALFV  171



>gb|KEH41602.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase-like protein [Medicago 
truncatula]
Length=386

 Score =   276 bits (705),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  N+IQA CFV++RP SKN YRRINR+ AELLWLEL+W+  WWAGVK++
Sbjct  11   PLGILFFASGLIVNIIQATCFVILRPFSKNLYRRINRMVAELLWLELVWIFDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            L+TDPET + MG EHALVISNH+SDIDWLVGW+LAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   LFTDPETFRFMGTEHALVISNHRSDIDWLVGWILAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE TL SGLQQLRD+PLPFWLALFV
Sbjct  131  SMWFSEYLFLERNWAKDERTLKSGLQQLRDFPLPFWLALFV  171



>ref|XP_009767064.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Nicotiana sylvestris]
Length=387

 Score =   276 bits (705),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA CFVL+RP+SK+TYRR+NR+ AELLWLEL+W+V WWAGVK+K
Sbjct  11   PLGVLFFISGLVINLIQATCFVLVRPISKSTYRRLNRIVAELLWLELVWIVDWWAGVKIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +Y DP+   LMGKEHALVI+NH+SDIDWLVGW+LAQRSGCLGS+LAVMKKSSKLLPVIGW
Sbjct  71   VYMDPKEFNLMGKEHALVIANHRSDIDWLVGWILAQRSGCLGSSLAVMKKSSKLLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SGLQ+L DYPLPFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDERTLKSGLQRLSDYPLPFWLALFV  171



>ref|XP_006493900.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Citrus sinensis]
Length=386

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+CFV IRPLSKNTYRRINR  AELLWLEL+W+V WWAGVK+K
Sbjct  11   PLGLLFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            L+ D ET +LMGKEHALV+SNHKSDIDWLVGWVL+QRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   LFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLSQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+W KDE+TL SGLQ+LRDYP PFWLALFV
Sbjct  131  SMWFSEYLFLERNWVKDESTLKSGLQRLRDYPQPFWLALFV  171



>ref|XP_010088401.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Morus notabilis]
 gb|EXB35416.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Morus notabilis]
Length=528

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            NLIQAICFVLIRPLSK+TYRRINRV AELLWLEL+W+V WWAGVK++LYTD +T  LMGK
Sbjct  164  NLIQAICFVLIRPLSKSTYRRINRVVAELLWLELVWVVDWWAGVKIQLYTDSDTFHLMGK  223

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVISNH+SDIDWLVGW++AQRSGCLGSTLAVMKKSSK LPVIGWSMWFSEYLFLERS
Sbjct  224  EHALVISNHRSDIDWLVGWIVAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERS  283

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE+TL SG+Q+L+DYPLPFWLALFV
Sbjct  284  WAKDESTLKSGIQRLKDYPLPFWLALFV  311



>ref|XP_002308046.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
 gb|EEE91569.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
Length=385

 Score =   271 bits (693),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  N+IQAICFV IRPLSK+TYR+INR  AELLWLEL+W+  WWAGV++K
Sbjct  11   PLGVLFFCSGLIVNIIQAICFVFIRPLSKSTYRKINRQLAELLWLELVWIFDWWAGVQIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD ETV+LMGKEHALVI NH+SDIDWLVGWVLAQRSGCLGS +AVMKKSSK LPVIGW
Sbjct  71   VFTDKETVRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSAVAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SGLQ+L+D+P PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTLKSGLQRLKDFPRPFWLALFV  171



>ref|XP_002323308.2| hypothetical protein POPTR_0016s05340g [Populus trichocarpa]
 gb|EEF05069.2| hypothetical protein POPTR_0016s05340g [Populus trichocarpa]
Length=435

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQAICFV IRPLSK+TYR+INR  AELLWLEL+W+  WWAGV++K
Sbjct  59   PLGVFFFCSGLIVNLIQAICFVFIRPLSKSTYRKINRQLAELLWLELVWIFDWWAGVQIK  118

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TDPET +LMGKEHAL+I NHKSDIDWLVGWVLAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  119  VFTDPETFRLMGKEHALLICNHKSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGW  178

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE TL SGLQ+L+D+P PFWLALFV
Sbjct  179  SMWFSEYLFLERNWAKDENTLKSGLQRLKDFPRPFWLALFV  219



>ref|XP_011020321.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Populus 
euphratica]
Length=379

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  N+IQAICFV IRPLSK+TYR+INR  AELLWLEL+W+  WWAGV++K
Sbjct  11   PLGVLFFCSGLIVNIIQAICFVFIRPLSKSTYRKINRQLAELLWLELVWIFDWWAGVQIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD ETV+LMGKEHALVI NH+SDIDWLVGWVLAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  71   VFTDKETVRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE TL SGLQ+L+D+P PFWLALFV
Sbjct  131  SMWFSEYLFLERNWAKDENTLKSGLQRLKDFPRPFWLALFV  171



>ref|XP_011033303.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Populus euphratica]
Length=386

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  G   NLIQAICFV IRPLSK+TYR+INR  AELLWLEL+W+  WWAGV++K
Sbjct  10   PLGVFFFCSGFIVNLIQAICFVFIRPLSKSTYRKINRQLAELLWLELVWIFDWWAGVQIK  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TDPET +LMGKEHALV+ NH+SDIDWLVGWVLAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  70   VFTDPETFRLMGKEHALVMCNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE TL SGLQ+L+D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWAKDENTLKSGLQRLKDFPRPFWLALFV  170



>ref|XP_004307568.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Fragaria 
vesca subsp. vesca]
Length=386

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            NL+QAICF+ IRP+SKN +RRINRV AELLWLEL+W+V WWAGVKVK+YTDPET  LMGK
Sbjct  24   NLLQAICFIFIRPVSKNVHRRINRVVAELLWLELVWIVDWWAGVKVKVYTDPETFHLMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVI NHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGWSMWFSEYLFLERS
Sbjct  84   EHALVICNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE+T+ +G+Q+L+D+P PFWLALFV
Sbjct  144  WAKDESTIKTGIQRLKDFPRPFWLALFV  171



>gb|ABU50327.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Helianthus annuus]
Length=382

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQAI FV +RP SK+ +RRINR  AELLWLEL+W+V WWAGVKV 
Sbjct  11   PIGVLFFVSGLIVNLIQAIIFVTVRPFSKSLFRRINRQVAELLWLELVWIVDWWAGVKVN  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET+K+MGKEHALVI+NHKSDIDWL+GWV AQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   LYTDAETLKMMGKEHALVIANHKSDIDWLIGWVFAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE+TL SGL++L+DYP PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDESTLKSGLRRLKDYPQPFWLALFV  171



>ref|XP_006402859.1| hypothetical protein EUTSA_v10006028mg [Eutrema salsugineum]
 gb|ESQ44312.1| hypothetical protein EUTSA_v10006028mg [Eutrema salsugineum]
Length=389

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QAIC+VLIRPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGLLFFISGLAVNLVQAICYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFV  170



>gb|ABN09946.1| lysophosphatidyl acyltransferase [Crambe hispanica subsp. abyssinica]
 gb|ABN09947.1| lysophosphatidyl acyltransferase [Crambe hispanica subsp. abyssinica]
Length=390

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QAIC+VLIRPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGILFFISGLVVNLLQAICYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWAKDESTLQSGLQRLNDFPRPFWLALFV  170



>ref|XP_009116469.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Brassica 
rapa]
Length=390

 Score =   266 bits (679),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QAIC+VLIRPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGILFFISGLVVNLLQAICYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFV  170



>gb|ADC97478.1| lysophosphatidic acid acyltransferase [Brassica napus]
 gb|ADC97480.1| lysophosphatidic acid acyltransferase [Brassica napus]
 emb|CDY06085.1| BnaA09g36950D [Brassica napus]
 emb|CDX72008.1| BnaC08g28660D [Brassica napus]
Length=390

 Score =   265 bits (678),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QAIC+VLIRPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGILFFISGLVVNLLQAICYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFV  170



>sp|Q6IWY1.1|LPAT2_BRAOL RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
2; AltName: Full=Lysophosphatidyl acyltransferase 2 [Brassica 
oleracea]
 gb|AAT36638.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase [Brassica 
oleracea]
Length=391

 Score =   265 bits (678),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QA+C+VLIRPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  11   PLGILFFISGLVVNLLQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  71   VFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  131  SMWFSEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFV  171



>gb|ADC97479.1| lysophosphatidic acid acyltransferase [Brassica napus]
Length=391

 Score =   265 bits (678),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QA+C+VLIRPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  11   PLGILFFISGLVVNLLQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  71   VFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  131  SMWFSEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFV  171



>ref|XP_010554846.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Tarenaya 
hassleriana]
Length=387

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QA+C+VL+RPLSKNTYR+INRV AE LWLEL+W++ WWAGVK++
Sbjct  10   PLGVLFFVSGLAVNLVQAVCYVLVRPLSKNTYRKINRVVAETLWLELVWIIDWWAGVKIR  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD ET   MG+EHALVI NH+SDIDWLVGWVLAQR+GCLGS LAVMKKSSKLLPVIGW
Sbjct  70   VFTDRETFHQMGREHALVICNHRSDIDWLVGWVLAQRAGCLGSALAVMKKSSKLLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE TL SGLQ+L D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWAKDENTLKSGLQRLYDFPQPFWLALFV  170



>emb|CDY33810.1| BnaCnng07280D [Brassica napus]
Length=391

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QA+C+VLIRPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  11   PLGILFFISGLVVNLLQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  71   VFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  131  SMWFSEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFV  171



>ref|XP_009104068.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Brassica 
rapa]
Length=390

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QA+C+VL+RPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGILFFISGLVVNLLQAVCYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  70   VFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFV  170



>ref|XP_010524157.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Tarenaya 
hassleriana]
 ref|XP_010524167.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Tarenaya 
hassleriana]
Length=382

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QA+C+VL+RPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGVLFFVSGLAVNLVQAVCYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD ET   MGKEHALVI NH+SDIDWLVGW+LAQRSGCLGS+LAVMKKSSK LPVIGW
Sbjct  70   VFTDRETFNQMGKEHALVICNHRSDIDWLVGWMLAQRSGCLGSSLAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE TL  GLQ+L+D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWAKDENTLKLGLQRLKDFPQPFWLALFV  170



>sp|Q9XFW4.1|LPAT2_BRANA RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
2; AltName: Full=Lysophosphatidyl acyltransferase 2 [Brassica 
napus]
 emb|CAB09138.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase [Brassica 
napus]
Length=390

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QA+C+VL+RP+SKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGILFFISGLVVNLLQAVCYVLVRPMSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  70   VFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWAKDESTLQSGLQRLNDFPRPFWLALFV  170



>gb|ABM92334.2| 1-acylglycerol-3-phosphate acyltransferase [Brassica juncea]
Length=390

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QA+C+VL+RP+SKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGILFFISGLVVNLLQAVCYVLVRPMSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  70   VFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWAKDESTLQSGLQRLNDFPRPFWLALFV  170



>gb|AAM61033.1| 1-acylcerol-3-phosphate acyltransferase-like protein [Arabidopsis 
thaliana]
Length=389

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL QA+C+VLIRPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGLLFFISGLAVNLFQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWAKDESTLKSGLQRLSDFPRPFWLALFV  170



>ref|NP_567052.1| lysophosphatidyl acyltransferase 2 [Arabidopsis thaliana]
 sp|Q8LG50.2|LPAT2_ARATH RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
2; AltName: Full=Lysophosphatidyl acyltransferase 2 [Arabidopsis 
thaliana]
 gb|ABG48392.1| At3g57650 [Arabidopsis thaliana]
 gb|AEE79683.1| lysophosphatidyl acyltransferase 2 [Arabidopsis thaliana]
Length=389

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL QA+C+VLIRPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGLLFFISGLAVNLFQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWAKDESTLKSGLQRLSDFPRPFWLALFV  170



>gb|AGO14580.1| A-class lysophosphatidate acyltransferase 2 isoform 2 [Echium 
pitardii]
Length=387

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GLF NLIQA+ FV++RP SKNTYRRINR  AELLWLEL+W++ WWAGVK++
Sbjct  11   PLGVLFFISGLFVNLIQAVFFVIVRPFSKNTYRRINRWVAELLWLELVWIIDWWAGVKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET++ MGKEHAL+I NH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   VFADAETLRSMGKEHALLICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SGLQ+L+D+P PFW+ALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTLKSGLQRLKDFPQPFWVALFV  171



>ref|XP_002876428.1| hypothetical protein ARALYDRAFT_907235 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52687.1| hypothetical protein ARALYDRAFT_907235 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL QA+C+VLIRPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGLLFFISGLVVNLFQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D +T   MGKEHALV+ NH+SDIDWLVGWVLAQRSGCLGS LAVMKKSSK LPVIGW
Sbjct  70   VFADNDTFNRMGKEHALVVCNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWAKDESTLKSGLQRLSDFPRPFWLALFV  170



>gb|ABP93351.1| lysophosphatidyl acyltransferase 2 [Helianthus annuus]
Length=385

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL   L+QA+ FV IRP SK+ +RRINR  AELLWLEL+W+V WW+GVKV 
Sbjct  12   PIGVLFFVSGLIVTLLQALIFVTIRPFSKSLFRRINRQVAELLWLELVWIVDWWSGVKVN  71

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTDPET+ +MGKEHALVI+NH+SDIDWL+GWV AQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  72   LYTDPETLNMMGKEHALVIANHRSDIDWLIGWVFAQRSGCLGSTLAVMKKSSKFLPVIGW  131

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER WAKDE+TL +GLQ+L+DYP PFWLALFV
Sbjct  132  SMWFSEYLFLERRWAKDESTLKAGLQRLKDYPQPFWLALFV  172



>gb|AGO14579.1| A-class lysophosphatidate acyltransferase 2 isoform 1 [Echium 
pitardii]
Length=387

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GLF NLIQA+ FV++RP SKNTYRRINR  AELLWLEL+W++ WWAGVK++
Sbjct  11   PLGVLFFISGLFVNLIQAVFFVIVRPFSKNTYRRINRWVAELLWLELVWIIDWWAGVKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET++ MG EHAL+I NH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   VFADAETLRSMGNEHALLICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SGLQ+L+D+P PFW+ALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTLKSGLQRLKDFPQPFWVALFV  171



>ref|XP_010516385.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
 ref|XP_010516386.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
 ref|XP_010516388.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
 ref|XP_010427647.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
Length=389

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+C+VLIRPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGLLFFISGLVVNLIQALCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGWVLAQRSG LGS LAVMKKSSK LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWVLAQRSGSLGSALAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+W+KDE+TL SGLQ+L D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWSKDESTLKSGLQRLSDFPRPFWLALFV  170



>ref|XP_010504698.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Camelina 
sativa]
Length=389

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+C+VLIRPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGLLFFISGLVVNLIQALCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGWVLAQRSG LGS LAVMKKSSK LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWVLAQRSGSLGSALAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+W+KDE+TL SGLQ+L D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWSKDESTLKSGLQRLSDFPRPFWLALFV  170



>ref|XP_008392182.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Malus 
domestica]
Length=386

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQAICF+LIRPLSKNTYR+INRV AELLWLEL+WL+ WWAGVK++
Sbjct  11   PLGLLFFVSGLVVNLIQAICFILIRPLSKNTYRKINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +YTDPET +LMGKEHALVI NH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   VYTDPETFRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL  GLQ+L+DYP PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTLKLGLQRLKDYPQPFWLALFV  171



>emb|CDX67700.1| BnaA07g17400D [Brassica napus]
Length=391

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QA+C+VL+RPLSKNTYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGILFFISGLVVNLLQAVCYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLA-QRSGCLGSTLAVMKKSSKLLPVIG  502
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LA QRSGCLGS LAVMKKSSK LPVIG
Sbjct  70   VFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQQRSGCLGSALAVMKKSSKFLPVIG  129

Query  503  WSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WSMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  130  WSMWFSEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFV  171



>ref|XP_010257310.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Nelumbo nucifera]
Length=387

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N+IQA+CF+L+RP+SKN YR+INRV +ELLW+EL+WL+ WWAGVKV+LYTD ET KLMGK
Sbjct  24   NIIQAVCFILVRPVSKNMYRKINRVVSELLWVELVWLIDWWAGVKVQLYTDSETFKLMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHAL+I NH+SDIDWLVGWVLAQ SGCLGSTLAVMKKSSK LPVIGWSMWFSEY+FLERS
Sbjct  84   EHALLICNHRSDIDWLVGWVLAQHSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYVFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL +GL++L+D+P PFWLALFV
Sbjct  144  WAKDENTLKAGLKRLKDFPRPFWLALFV  171



>emb|CDX88957.1| BnaA04g02290D [Brassica napus]
Length=384

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QAIC+VL+RPLSKNTYR+INRV AE LWLEL+W+V WWAGVK+K
Sbjct  10   PLGLLFFISGLLMNLLQAICYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIK  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSGCLGS LAV K S+K LPVIGW
Sbjct  70   VFADNETFSRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVTKNSNKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSE+LFLER+WAKDE+T+ SGLQ+L+D+P PFWLALFV
Sbjct  130  SMWFSEFLFLERNWAKDESTIKSGLQRLKDFPQPFWLALFV  170



>ref|XP_009334964.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
 ref|XP_009334965.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
 ref|XP_009340151.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
Length=386

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQAICF+LIRPLSKNTYRRINRV AELLWLEL+WL+ WWAGVK++
Sbjct  11   PLGLLFFVSGLVINLIQAICFILIRPLSKNTYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +YTDPET  LMGKEHALV+ NH+SDIDWLVGWVLAQRSGCLGS LAVMKKSSKLLPVIGW
Sbjct  71   VYTDPETFHLMGKEHALVMCNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKLLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE+TL  GLQ+L+DYP PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDESTLKLGLQRLKDYPQPFWLALFV  171



>ref|XP_009345032.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
Length=386

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQ ICF+L+RPLSKNTYRRINRV AELLWLEL+WL+ WWAGVK++
Sbjct  11   PLGLLFFVSGLVVNLIQGICFILVRPLSKNTYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +YTDPET +LMGKEHALVI NH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   VYTDPETFRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL  GLQ+L+DYP PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTLKLGLQRLKDYPQPFWLALFV  171



>gb|KFK35010.1| hypothetical protein AALP_AA5G222500 [Arabis alpina]
Length=389

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QA+C+VLIRPLSK+TYR+INRV AE LWLEL+W+V WWAGVK++
Sbjct  10   PLGLLFFISGLVVNLVQALCYVLIRPLSKSTYRKINRVVAETLWLELVWIVDWWAGVKIQ  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSG LGS LAVMKKSSK LPVIGW
Sbjct  70   VFADNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGSLGSALAVMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  130  SMWFSEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFV  170



>ref|XP_009139024.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Brassica rapa]
Length=385

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+QAIC+VL+RPLSKNTYR+INRV AE LWLEL+W+V WWAGVK+K
Sbjct  10   PLGLLFFISGLLMNLLQAICYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIK  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D ET+  MGKEHALV+ N +SDIDWLVGW+LAQRSGCLGS LAV KKS+K LPVIGW
Sbjct  70   VFADDETLSRMGKEHALVVCNLRSDIDWLVGWILAQRSGCLGSALAVTKKSNKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSE+LFLER+WAKDE+T+ SGLQ+L+D+P PFWLALFV
Sbjct  130  SMWFSEFLFLERNWAKDESTIKSGLQRLKDFPQPFWLALFV  170



>ref|XP_011078878.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Sesamum indicum]
 ref|XP_011078879.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Sesamum indicum]
Length=386

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQAIC+VLIRPLSKNTYRRINR  AELLWLEL+WLV WWAGVK++
Sbjct  11   PLGVLFFMSGLVVNLIQAICYVLIRPLSKNTYRRINREVAELLWLELVWLVDWWAGVKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +YTD ET KLMGKEHALVI NH+SDIDWLVGW+LAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   IYTDAETFKLMGKEHALVICNHRSDIDWLVGWILAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL +GLQ+LRD+P PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTLKTGLQRLRDFPRPFWLALFV  171



>gb|KCW90239.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=291

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  161  LFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDP  340
             F  GL  NL+QA+CFVL+RPLSKNTYRRINRV AELLWLELIWLV WWAGVK++++TD 
Sbjct  16   FFISGLVVNLVQAVCFVLVRPLSKNTYRRINRVVAELLWLELIWLVDWWAGVKIQVFTDR  75

Query  341  ETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFS  520
            ET  LMGKEHALVISNH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPV+GWSMWFS
Sbjct  76   ETFHLMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVLGWSMWFS  135

Query  521  EYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            EYLFLERSWAKDE+TL SGL +L+DYPLPFWLALFV
Sbjct  136  EYLFLERSWAKDESTLKSGLLRLKDYPLPFWLALFV  171



>ref|XP_009387255.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=374

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            NL+QAI F+ IRP SK+ YRRINRV AELLWL++IWLV WWAGVKV+L+ D +T  LMGK
Sbjct  24   NLVQAIFFITIRPFSKSLYRRINRVVAELLWLQVIWLVDWWAGVKVQLFADSKTYALMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVISNHKSDIDWLVGW+L+QRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALVISNHKSDIDWLVGWILSQRSGCLGSTLAVMKKSSKFLPVIGWSMWFTEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            W KDE+TL SGLQQL+D+P PFWLALFV
Sbjct  144  WTKDESTLKSGLQQLKDFPRPFWLALFV  171



>ref|XP_011075205.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Sesamum 
indicum]
Length=381

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  N IQA+CF+LIRPLSK TYRRINR  A LLWL L+WL+ WWAGVK++
Sbjct  11   PLGVLFFVSGLVINFIQAVCFLLIRPLSKKTYRRINREVAGLLWLGLVWLIDWWAGVKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET KLMGKEHALVI NHKSDIDWLVGWVLA+RSGCLGSTLAVMKKSS+ LPVIGW
Sbjct  71   LYTDSETFKLMGKEHALVICNHKSDIDWLVGWVLAERSGCLGSTLAVMKKSSRFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE+TL SGLQ+LRD+P PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDESTLKSGLQRLRDFPRPFWLALFV  171



>ref|XP_007162250.1| hypothetical protein PHAVU_001G136600g [Phaseolus vulgaris]
 gb|ESW34244.1| hypothetical protein PHAVU_001G136600g [Phaseolus vulgaris]
Length=387

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQAIC+V++RP+SKN YRRINRV AELLWLEL+WL+ WWAGVK++
Sbjct  11   PLGLLFFASGLLVNLIQAICYVVLRPVSKNLYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD ET +LMGKEHALV+SNH+SDIDWLVGWV AQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   IFTDHETFRLMGKEHALVMSNHRSDIDWLVGWVSAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE+TL SG+QQL DYPLPFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDESTLRSGIQQLSDYPLPFWLALFV  171



>ref|XP_003554183.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Glycine max]
 gb|KHN26342.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=387

 Score =   255 bits (652),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQAIC+V++RP+SKN YRRINRV AELLWLEL+WL+ WWAGVKV+
Sbjct  11   PLGLLFFASGLLVNLIQAICYVVVRPVSKNLYRRINRVVAELLWLELVWLIDWWAGVKVQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD ET  LMGKEHALVISNH+SDIDWLVGWV AQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   IFTDHETFHLMGKEHALVISNHRSDIDWLVGWVSAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE+TL SG+QQL D+PLPFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDESTLKSGIQQLSDFPLPFWLALFV  171



>ref|XP_010312077.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Solanum lycopersicum]
Length=330

 Score =   253 bits (647),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GLF NLIQA CFVLIRP SKN YRRINR+FAELLWLEL+WLV W AGV++K
Sbjct  11   PMGIIFFISGLFINLIQAACFVLIRPFSKNIYRRINRIFAELLWLELVWLVDWRAGVEIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY DPET +LMGKEHAL+I+NH+SDIDWLVGWVLAQRS CLGS LAVMKKSSK LPV+GW
Sbjct  71   LYMDPETFRLMGKEHALLIANHRSDIDWLVGWVLAQRSSCLGSALAVMKKSSKFLPVLGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE T+ SGLQ+LRDYP PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTIKSGLQRLRDYPQPFWLALFV  171



>gb|KCW90238.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=356

 Score =   254 bits (650),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  161  LFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDP  340
             F  GL  NL+QA+CFVL+RPLSKNTYRRINRV AELLWLELIWLV WWAGVK++++TD 
Sbjct  16   FFISGLVVNLVQAVCFVLVRPLSKNTYRRINRVVAELLWLELIWLVDWWAGVKIQVFTDR  75

Query  341  ETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFS  520
            ET  LMGKEHALVISNH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPV+GWSMWFS
Sbjct  76   ETFHLMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVLGWSMWFS  135

Query  521  EYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            EYLFLERSWAKDE+TL SGL +L+DYPLPFWLALFV
Sbjct  136  EYLFLERSWAKDESTLKSGLLRLKDYPLPFWLALFV  171



>ref|NP_001280186.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Prunus mume]
 dbj|BAE48660.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Prunus mume]
Length=386

 Score =   255 bits (652),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQAICF+LIRP+SKN YRRINRV AELLWLEL+WL+ WWAGVK++
Sbjct  11   PLGLLFFISGLVVNLIQAICFILIRPVSKNLYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +YTD ET  LMGKEHALVISNH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   VYTDHETFNLMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SG+Q+L+D+P PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDEGTLKSGVQRLKDFPQPFWLALFV  171



>emb|CAA88620.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase (putative) [Limnanthes 
douglasii]
Length=377

 Score =   254 bits (650),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+    F  GL  N IQA+ +VL+RP+SK+TYRRIN + AELLWLEL+W++ WWAGVKV+
Sbjct  11   PISLLFFMSGLVVNFIQAVFYVLVRPISKDTYRRINTLVAELLWLELVWVIDWWAGVKVQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD E+ +LMGKEHAL+I NH+SDIDWL+GWVLAQR GCL S++AVMKKSSK LPVIGW
Sbjct  71   LYTDTESFRLMGKEHALLICNHRSDIDWLIGWVLAQRCGCLSSSIAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE TL SGLQ+L D+P PFWLALFV
Sbjct  131  SMWFSEYLFLERNWAKDENTLKSGLQRLNDFPKPFWLALFV  171



>ref|XP_010057561.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW90237.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=387

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  161  LFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDP  340
             F  GL  NL+QA+CFVL+RPLSKNTYRRINRV AELLWLELIWLV WWAGVK++++TD 
Sbjct  16   FFISGLVVNLVQAVCFVLVRPLSKNTYRRINRVVAELLWLELIWLVDWWAGVKIQVFTDR  75

Query  341  ETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFS  520
            ET  LMGKEHALVISNH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPV+GWSMWFS
Sbjct  76   ETFHLMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVLGWSMWFS  135

Query  521  EYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            EYLFLERSWAKDE+TL SGL +L+DYPLPFWLALFV
Sbjct  136  EYLFLERSWAKDESTLKSGLLRLKDYPLPFWLALFV  171



>gb|EYU20729.1| hypothetical protein MIMGU_mgv1a008164mg [Erythranthe guttata]
Length=383

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+C+VLIRP+SKNTYRRINR  AELLWLEL+WL+ WWAGVK++
Sbjct  11   PLGVLFFVSGLVVNLIQAVCYVLIRPVSKNTYRRINRQVAELLWLELVWLIDWWAGVKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D ET KLMGKEHALVI NHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW
Sbjct  71   LYADSETFKLMGKEHALVICNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SM FSEYLFLERSWAKDE+TL SGLQ+L D+P PFWLALFV
Sbjct  131  SMCFSEYLFLERSWAKDESTLKSGLQRLSDFPRPFWLALFV  171



>gb|KJB36056.1| hypothetical protein B456_006G138600 [Gossypium raimondii]
Length=314

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+CFVLIRPLSKNTYR+INRV AELLWL+L+WLV WWAGVK++
Sbjct  11   PLGLLFFISGLAVNLIQAVCFVLIRPLSKNTYRKINRVLAELLWLQLVWLVDWWAGVKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D E+  LMGKEHALVI NH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   VFADHESFNLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL +G+Q+L+D+P PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTLKAGIQRLKDFPRPFWLALFV  171



>ref|XP_007202144.1| hypothetical protein PRUPE_ppa007002mg [Prunus persica]
 gb|EMJ03343.1| hypothetical protein PRUPE_ppa007002mg [Prunus persica]
Length=386

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQAICF+LIRP+SKN YRRINRV AELLWLEL+WL+ WWAGVK++
Sbjct  11   PLGLLFFISGLVVNLIQAICFILIRPVSKNLYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +YTD ET  LMGKEHALVISNH+SDIDWLVGWVLAQRSGCLGS+LAVMKKSSK LPVIGW
Sbjct  71   VYTDHETFNLMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSSLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SG+Q+L+D+P PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDEGTLKSGVQRLKDFPQPFWLALFV  171



>ref|XP_004249199.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X1 [Solanum lycopersicum]
Length=382

 Score =   253 bits (647),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GLF NLIQA CFVLIRP SKN YRRINR+FAELLWLEL+WLV W AGV++K
Sbjct  11   PMGIIFFISGLFINLIQAACFVLIRPFSKNIYRRINRIFAELLWLELVWLVDWRAGVEIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY DPET +LMGKEHAL+I+NH+SDIDWLVGWVLAQRS CLGS LAVMKKSSK LPV+GW
Sbjct  71   LYMDPETFRLMGKEHALLIANHRSDIDWLVGWVLAQRSSCLGSALAVMKKSSKFLPVLGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE T+ SGLQ+LRDYP PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTIKSGLQRLRDYPQPFWLALFV  171



>gb|KJB16435.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=273

 Score =   250 bits (638),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GLF NLIQA+CFVLIRPLSK TYR+INRV AELLWL+L+WLV WWAGVK+ 
Sbjct  11   PLGILFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDWWAGVKIN  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D E+  LMGKEHAL++ NH+SDIDWLVGWVLAQRSGCLGS++AVMKKSSK LPVIGW
Sbjct  71   VFADNESFSLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE T+ +GLQ+LRDYP PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTIKAGLQRLRDYPQPFWLALFV  171



>ref|XP_006351222.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Solanum tuberosum]
Length=382

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GLF NLIQA CFVLIRP SKN YRRINR+FAELLWLEL+WLV W AGV++K
Sbjct  11   PMGIVFFISGLFINLIQAACFVLIRPFSKNIYRRINRIFAELLWLELVWLVDWRAGVEIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY DPET +LMGKEHAL+I+NH+SDIDWLVGWVLAQRSGCLGS LAVMKKSSK LPV+GW
Sbjct  71   LYMDPETFRLMGKEHALLIANHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVLGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE T+ SGLQ LRDYP PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTIKSGLQWLRDYPQPFWLALFV  171



>gb|KDP37345.1| hypothetical protein JCGZ_06799 [Jatropha curcas]
Length=385

 Score =   253 bits (647),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  G   NLIQAICFV+IRPLSKNTYR+INR  AELLWLEL+WLV WWAG++++
Sbjct  11   PLGVLFFLSGFVVNLIQAICFVVIRPLSKNTYRKINRAVAELLWLELVWLVDWWAGIQIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET +LMGKEHALVI NH+SDIDWLVGWVLAQRSGCLGS LAVMKKSSKLLPVIGW
Sbjct  71   LYTDQETFRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKLLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE+TL SGLQ+L+D+P PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDESTLKSGLQRLKDFPRPFWLALFV  171



>gb|AEZ56251.1| plastid 1-acylglycerol-phosphate acyltransferase [Jatropha curcas]
Length=385

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  G   NLIQAICFV+IRPLSKNTYR+INR  AELLWLEL+WLV WWAG++++
Sbjct  11   PLGVLFFLSGFVVNLIQAICFVVIRPLSKNTYRKINRAVAELLWLELVWLVDWWAGIQIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET +LMGKEHALVI NH+SDIDWLVGWVLAQRSGCLGS LAVMKKSSKLLPVIGW
Sbjct  71   LYTDQETFRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKLLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE+TL SGLQ+L+D+P PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDESTLKSGLQRLKDFPRPFWLALFV  171



>gb|KJB16434.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=286

 Score =   250 bits (638),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GLF NLIQA+CFVLIRPLSK TYR+INRV AELLWL+L+WLV WWAGVK+ 
Sbjct  11   PLGILFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDWWAGVKIN  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D E+  LMGKEHAL++ NH+SDIDWLVGWVLAQRSGCLGS++AVMKKSSK LPVIGW
Sbjct  71   VFADNESFSLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE T+ +GLQ+LRDYP PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTIKAGLQRLRDYPQPFWLALFV  171



>emb|CAN83214.1| hypothetical protein VITISV_038716 [Vitis vinifera]
Length=390

 Score =   253 bits (646),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  NLIQA+CF+L+RPLSK+TYRRINRV AELLWLEL+WL+ WWAGVK++
Sbjct  11   PLGLLFLTSGLVVNLIQAVCFILVRPLSKSTYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTDPET +LMGKEHAL+ISNH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   LYTDPETFRLMGKEHALLISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+ + SGL +L+DYP PFWLALFV
Sbjct  131  SMWFSEYLFLERNWAKDESIIKSGLLRLKDYPQPFWLALFV  171



>ref|XP_002283340.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Vitis 
vinifera]
 emb|CBI29878.3| unnamed protein product [Vitis vinifera]
Length=387

 Score =   253 bits (646),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  NLIQA+CF+L+RPLSK+TYRRINRV AELLWLEL+WL+ WWAGVK++
Sbjct  11   PLGLLFLTSGLVVNLIQAVCFILVRPLSKSTYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTDPET +LMGKEHAL+ISNH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   LYTDPETFRLMGKEHALLISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+ + SGL +L+DYP PFWLALFV
Sbjct  131  SMWFSEYLFLERNWAKDESIIKSGLLRLKDYPQPFWLALFV  171



>ref|XP_008443106.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Cucumis 
melo]
Length=388

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F+ GL  NLIQAIC+V IRP++KN YRRINR  AELLWLEL+WL+ WWAGV++K
Sbjct  11   PLGVLFFFSGLVVNLIQAICYVFIRPITKNGYRRINRFVAELLWLELVWLIDWWAGVQIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD ET+KLMGKEHALV+SNH+SDIDWLVGW+LAQRSGCLGSTLAVMKKSSK LPV+GW
Sbjct  71   VFTDRETLKLMGKEHALVVSNHRSDIDWLVGWILAQRSGCLGSTLAVMKKSSKFLPVLGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SGL +L+DYPLPFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDEITLKSGLLRLKDYPLPFWLALFV  171



>ref|XP_004136588.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis sativus]
 gb|KGN59338.1| hypothetical protein Csa_3G812100 [Cucumis sativus]
Length=388

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F+ GL  NLIQAIC+VL+RP++KN YRR+NR  AELLWLEL+WL+ WWAGV++K
Sbjct  11   PLGVLFFFSGLVVNLIQAICYVLVRPITKNGYRRMNRFVAELLWLELVWLIDWWAGVQIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD ET+KLMGKEHALV+SNH+SDIDWLVGW+LAQRSGCLGSTLAVMKKSSK LPV+GW
Sbjct  71   VFTDRETLKLMGKEHALVVSNHRSDIDWLVGWILAQRSGCLGSTLAVMKKSSKFLPVLGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SGL +L+DYPLPFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDEITLKSGLLRLKDYPLPFWLALFV  171



>gb|KJB36055.1| hypothetical protein B456_006G138600 [Gossypium raimondii]
Length=387

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+CFVLIRPLSKNTYR+INRV AELLWL+L+WLV WWAGVK++
Sbjct  11   PLGLLFFISGLAVNLIQAVCFVLIRPLSKNTYRKINRVLAELLWLQLVWLVDWWAGVKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D E+  LMGKEHALVI NH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   VFADHESFNLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL +G+Q+L+D+P PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTLKAGIQRLKDFPRPFWLALFV  171



>ref|XP_004165747.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis sativus]
Length=388

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F+ GL  NLIQAIC+V +RP++KN YRRINR  AELLWLEL+WL+ WWAGV++K
Sbjct  11   PLGVLFFFSGLVVNLIQAICYVFVRPITKNGYRRINRFVAELLWLELVWLIDWWAGVQIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD ET+KLMGKEHALV+SNH+SDIDWLVGW+LAQRSGCLGSTLAVMKKSSK LPV+GW
Sbjct  71   VFTDRETLKLMGKEHALVVSNHRSDIDWLVGWILAQRSGCLGSTLAVMKKSSKFLPVLGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SGL +L+DYPLPFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDEITLKSGLLRLKDYPLPFWLALFV  171



>gb|ACV73676.1| lysophosphatidic acid acyltransferase 2 [Tropaeolum majus]
Length=380

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F+ GL  NLIQAI +VL+RPLSK+TYRRINRV AELLWLEL+WL+ WWAGVK+K
Sbjct  11   PLGLLFFFSGLVVNLIQAIFYVLVRPLSKSTYRRINRVVAELLWLELVWLIDWWAGVKIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            L+TD ET+  MGKEHALVI NH+SDIDWLVGWVLAQRSGCLGS+LAVMKKSSK LPVIGW
Sbjct  71   LFTDRETLHQMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSSLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE+TL SGLQ+L DYP PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDESTLKSGLQRLNDYPQPFWLALFV  171



>gb|AFK40266.1| unknown [Medicago truncatula]
Length=387

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  N  QAIC+VL+RPLSKN YRRINRV AELLWLEL+WL+ WWAGVKV+
Sbjct  11   PLGLLFFASGLIVNFFQAICYVLVRPLSKNLYRRINRVVAELLWLELVWLIDWWAGVKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +YTD ET +LMGKEHALVI NH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   IYTDRETSRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SG+++L D+PLPFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTLKSGIRRLNDFPLPFWLALFV  171



>gb|KJB16432.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=350

 Score =   250 bits (639),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GLF NLIQA+CFVLIRPLSK TYR+INRV AELLWL+L+WLV WWAGVK+ 
Sbjct  11   PLGILFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDWWAGVKIN  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D E+  LMGKEHAL++ NH+SDIDWLVGWVLAQRSGCLGS++AVMKKSSK LPVIGW
Sbjct  71   VFADNESFSLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE T+ +GLQ+LRDYP PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTIKAGLQRLRDYPQPFWLALFV  171



>ref|XP_003625176.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Medicago truncatula]
 gb|AES81394.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase-like protein [Medicago 
truncatula]
Length=387

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  N  QAIC+VL+RPLSKN YRRINRV AELLWLEL+WL+ WWAGVKV+
Sbjct  11   PLGLLFFASGLIVNFFQAICYVLVRPLSKNLYRRINRVVAELLWLELVWLIDWWAGVKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +YTD ET +LMGKEHALVI NH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   IYTDRETSRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SG+++L D+PLPFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTLKSGIRRLNDFPLPFWLALFV  171



>ref|XP_003521190.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 isoform 
1 [Glycine max]
 gb|KHN07393.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=377

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQAIC+V++RP+SK+ YRRINRV AELLWLEL+WL+ WWAGVKV+
Sbjct  11   PLGLLFFASGLLVNLIQAICYVVVRPVSKSLYRRINRVVAELLWLELVWLIDWWAGVKVQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD ET +LMGKEHALVISNH+SDIDWLVGWV AQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   IFTDHETFRLMGKEHALVISNHRSDIDWLVGWVSAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE+TL SG+Q+L D+PLPFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDESTLKSGIQRLSDFPLPFWLALFV  171



>ref|XP_004493527.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cicer arietinum]
Length=387

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA C+VL+RPLSKN YRRINRV AELLWLEL+WL+ WWAGVK++
Sbjct  11   PLGLLFFVSGLIVNLIQATCYVLVRPLSKNLYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD ET +LMGKEHALVISNH+SDIDWLVGWVLAQRSG LGSTLAVMKKSSK LPVIGW
Sbjct  71   IFTDRETFRLMGKEHALVISNHRSDIDWLVGWVLAQRSGSLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE TL SG+Q+L D+PLPFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTLKSGIQRLSDFPLPFWLALFV  171



>ref|XP_006293344.1| hypothetical protein CARUB_v100174200mg, partial [Capsella rubella]
 gb|EOA26242.1| hypothetical protein CARUB_v100174200mg, partial [Capsella rubella]
Length=363

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  197  AICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGKEHAL  376
            A+C+VLIRPLSKNTYR++NRV AE LWLEL+W+V WWAGVK++++ D ET   MGKEHAL
Sbjct  1    AVCYVLIRPLSKNTYRKLNRVVAETLWLELVWIVDWWAGVKIQVFADNETFNRMGKEHAL  60

Query  377  VISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERSWAKD  556
            V+ NH+SDIDWLVGWVLAQRSGCLGS LAVMKKSSK LPVIGWSMWFSEYLFLER+WAKD
Sbjct  61   VVCNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKD  120

Query  557  ETTLXSGLQQLRDYPLPFWLALFV  628
            E+TL SGLQ+L D+P PFWLALFV
Sbjct  121  ESTLKSGLQRLSDFPRPFWLALFV  144



>gb|KJB16430.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=381

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GLF NLIQA+CFVLIRPLSK TYR+INRV AELLWL+L+WLV WWAGVK+ 
Sbjct  11   PLGILFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDWWAGVKIN  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D E+  LMGKEHAL++ NH+SDIDWLVGWVLAQRSGCLGS++AVMKKSSK LPVIGW
Sbjct  71   VFADNESFSLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE T+ +GLQ+LRDYP PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTIKAGLQRLRDYPQPFWLALFV  171



>gb|KJB16433.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=381

 Score =   249 bits (635),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GLF NLIQA+CFVLIRPLSK TYR+INRV AELLWL+L+WLV WWAGVK+ 
Sbjct  11   PLGILFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDWWAGVKIN  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D E+  LMG EHAL++ NH+SDIDWLVGWVLAQRSGCLGS++AVMKKSSK LPVIGW
Sbjct  71   VFADNESFSLMGNEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE T+ +GLQ+LRDYP PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTIKAGLQRLRDYPQPFWLALFV  171



>ref|NP_001148618.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 gb|ACG32258.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
Length=374

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N IQAI FV IRP SK+ YRRINR  AELLWL+L+W+V WWAGVKV+L+ D ET + MGK
Sbjct  24   NTIQAILFVTIRPFSKSLYRRINRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVISNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GLQ+L+D+P PFWLALFV
Sbjct  144  WAKDEKTLKWGLQRLKDFPRPFWLALFV  171



>ref|XP_010265751.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Nelumbo nucifera]
Length=387

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G    + G+  N+IQA+CF+L+RPLSKN YRRINRV AELLWLEL+WL+ WWAGVKV+
Sbjct  11   PLGVLFLFSGIVVNIIQAVCFILVRPLSKNMYRRINRVVAELLWLELVWLIDWWAGVKVQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET + MGKEHAL+ISNH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   LYTDSETFQSMGKEHALLISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEY+FLERSWAKDE+TL +GL +L+D+P PFWLALFV
Sbjct  131  SMWFSEYVFLERSWAKDESTLKAGLGRLKDFPRPFWLALFV  171



>ref|XP_009414749.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Musa acuminata subsp. malaccensis]
Length=374

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            NLIQA  ++ IRP SK+ +RRINRV AELLWL+LIWLV WWAGVKV+LY D +T +LMGK
Sbjct  24   NLIQATIYITIRPFSKSLFRRINRVVAELLWLQLIWLVDWWAGVKVQLYADSKTYELMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVI NHKSDIDWLVGW+L+QRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALVICNHKSDIDWLVGWILSQRSGCLGSTLAVMKKSSKFLPVIGWSMWFTEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE  L  GLQ L+D+P PFWLALFV
Sbjct  144  WAKDENILTLGLQHLKDFPRPFWLALFV  171



>gb|ACN28103.1| unknown [Zea mays]
 gb|AFW60269.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
Length=374

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N IQAI FV IRP SK+ YRRINR  AELLWL+L+W+V WWAGVKV+L+ D ET + MGK
Sbjct  24   NTIQAILFVTIRPFSKSLYRRINRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVISNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GLQ+L+D+P PFWLALFV
Sbjct  144  WAKDEKTLKWGLQRLKDFPRPFWLALFV  171



>gb|KHG04120.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Gossypium arboreum]
Length=381

 Score =   248 bits (632),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+CFVLIRPLSK TYR+INRV AELLWL+L+WLV WWAGVK+ 
Sbjct  11   PLGILFFISGLVVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDWWAGVKIN  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D E+  LMGKEHAL++ NH+SDIDWLVGWVLAQRSGCLGS++AVMKKSSK LPVIGW
Sbjct  71   VFADNESFNLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE T+ +GLQ+LRDYP PFWLALFV
Sbjct  131  SMWFSEYLFLERSWAKDENTIKAGLQRLRDYPQPFWLALFV  171



>ref|XP_002451179.1| hypothetical protein SORBIDRAFT_05g025420 [Sorghum bicolor]
 gb|EES10167.1| hypothetical protein SORBIDRAFT_05g025420 [Sorghum bicolor]
Length=374

 Score =   247 bits (631),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N IQAI FV IRP SK+ YRR+NR  AELLWL+L+W+V WWAGVKV+L+ D ET + MGK
Sbjct  24   NTIQAILFVTIRPFSKSFYRRVNRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHAL+ISNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALIISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GLQ+L+D+P PFWLALFV
Sbjct  144  WAKDEKTLKWGLQRLKDFPRPFWLALFV  171



>gb|KDO57199.1| hypothetical protein CISIN_1g0379582mg, partial [Citrus sinensis]
Length=152

 Score =   239 bits (611),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+CFV IRPLSKNTYRRINR  AELLWLEL+W+V WWAGVK+K
Sbjct  11   PLGLLFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            L+ D ET +LMGKEHALV+SNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGW
Sbjct  71   LFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTL  568
            SMWFSEYLFLER+WAKDE+TL
Sbjct  131  SMWFSEYLFLERNWAKDESTL  151



>ref|NP_001105919.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 sp|Q41745.1|LPAT_MAIZE RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
PLS1; AltName: Full=Phospholipid synthesis protein 1 [Zea mays]
 emb|CAA82638.1| 1-acyl-glycerol-3-phosphate acyltransferase (putative) [Zea mays]
 gb|ACG37259.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 gb|ACG40468.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 gb|ACR38397.1| unknown [Zea mays]
 tpg|DAA42327.1| TPA: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea 
mays]
Length=374

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N IQA+ FV IRP SK+ YRRINR  AELLWL+L+W+V WWAGVKV+L+ D ET + MGK
Sbjct  24   NAIQAVLFVTIRPFSKSFYRRINRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHAL+ISNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALIISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GLQ+L+D+P PFWLALFV
Sbjct  144  WAKDEKTLKWGLQRLKDFPRPFWLALFV  171



>ref|XP_009387254.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=389

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 134/163 (82%), Gaps = 15/163 (9%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVK---------------  319
            NL+QAI F+ IRP SK+ YRRINRV AELLWL++IWLV WWAGVK               
Sbjct  24   NLVQAIFFITIRPFSKSLYRRINRVVAELLWLQVIWLVDWWAGVKKMRSLRERQLAYEIE  83

Query  320  VKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVI  499
            V+L+ D +T  LMGKEHALVISNHKSDIDWLVGW+L+QRSGCLGSTLAVMKKSSK LPVI
Sbjct  84   VQLFADSKTYALMGKEHALVISNHKSDIDWLVGWILSQRSGCLGSTLAVMKKSSKFLPVI  143

Query  500  GWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            GWSMWF+EYLFLERSW KDE+TL SGLQQL+D+P PFWLALFV
Sbjct  144  GWSMWFTEYLFLERSWTKDESTLKSGLQQLKDFPRPFWLALFV  186



>ref|XP_004979811.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Setaria italica]
Length=374

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N IQAI FV IRP SK+ YRRINR  AELLWL+L+W+V WWAGVKV+L+ D ET + MGK
Sbjct  24   NTIQAILFVTIRPFSKSFYRRINRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHAL+ISNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALIISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GLQ+L D+P PFWLALFV
Sbjct  144  WAKDEKTLKWGLQRLNDFPRPFWLALFV  171



>gb|KCW90236.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=395

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 143/164 (87%), Gaps = 8/164 (5%)
 Frame = +2

Query  161  LFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDP  340
             F  GL  NL+QA+CFVL+RPLSKNTYRRINRV AELLWLELIWLV WWAGVK++++TD 
Sbjct  16   FFISGLVVNLVQAVCFVLVRPLSKNTYRRINRVVAELLWLELIWLVDWWAGVKIQVFTDR  75

Query  341  ETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLP--------V  496
            ET  LMGKEHALVISNH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LP        V
Sbjct  76   ETFHLMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPDLDFPCLQV  135

Query  497  IGWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            +GWSMWFSEYLFLERSWAKDE+TL SGL +L+DYPLPFWLALFV
Sbjct  136  LGWSMWFSEYLFLERSWAKDESTLKSGLLRLKDYPLPFWLALFV  179



>gb|AHC70248.1| lysophosphatidic acid acyltransferase [Sterculia foetida]
Length=387

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+CFVLIRPLSK TYR+IN+V AELLWLELIWLV WWAGVK+K
Sbjct  11   PLGLLFFISGLVVNLIQAVCFVLIRPLSKKTYRKINKVVAELLWLELIWLVDWWAGVKIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++ D E+  LMGKEHALV++NH+SDIDWLVGWVLAQRSGCLGS++AVMKKSSK LPVIGW
Sbjct  71   VFADHESFNLMGKEHALVVANHRSDIDWLVGWVLAQRSGCLGSSVAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL +GLQ+L+D+P PFWLALFV
Sbjct  131  SMWFSEYLFLERNWAKDESTLKAGLQRLKDFPQPFWLALFV  171



>ref|XP_008227141.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Prunus mume]
Length=380

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  NL+Q + F+L+RP+SK  YR+IN+V AELLWLE IWL+ WWAG+KV+
Sbjct  11   PIGVLFILSGLIVNLMQVVSFILLRPISKKLYRKINKVVAELLWLEPIWLIDWWAGIKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D +T +LMGKEHALVI NH+SDIDWLVGW++AQRSGCLGS LA+MKK  K LPVIGW
Sbjct  71   LYVDSDTFQLMGKEHALVICNHRSDIDWLVGWLIAQRSGCLGSALAIMKKEVKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEY FLER W KDE TL SG QQL D+P+PFWLALFV
Sbjct  131  SMWFSEYFFLERRWTKDEITLKSGFQQLEDFPMPFWLALFV  171



>ref|XP_011006209.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 isoform 
X3 [Populus euphratica]
Length=340

 Score =   244 bits (623),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            PVG      GL  NLIQA+ F+L+RPLSK+ +RRIN++ AELLWLELI LV WWA +K++
Sbjct  11   PVGIIFILSGLIVNLIQAVLFILVRPLSKSLHRRINKIVAELLWLELIVLVDWWANLKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +Y D ET +L+GKEHALVISNHKSD+DWLVGW+LAQRSGCLGS LAVMKK +K+LP+IGW
Sbjct  71   VYADDETFELLGKEHALVISNHKSDLDWLVGWILAQRSGCLGSALAVMKKEAKVLPIIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS+Y+FLERSW KDE TL SG + L D+P+PFWLALFV
Sbjct  131  SMWFSDYVFLERSWGKDERTLQSGFEWLEDFPMPFWLALFV  171



>ref|XP_011006208.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 isoform 
X2 [Populus euphratica]
Length=382

 Score =   245 bits (625),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            PVG      GL  NLIQA+ F+L+RPLSK+ +RRIN++ AELLWLELI LV WWA +K++
Sbjct  11   PVGIIFILSGLIVNLIQAVLFILVRPLSKSLHRRINKIVAELLWLELIVLVDWWANLKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +Y D ET +L+GKEHALVISNHKSD+DWLVGW+LAQRSGCLGS LAVMKK +K+LPVIGW
Sbjct  71   VYADDETFELLGKEHALVISNHKSDLDWLVGWILAQRSGCLGSALAVMKKEAKVLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS+Y+FLERSW KDE TL SG + L D+P+PFWLALFV
Sbjct  131  SMWFSDYVFLERSWGKDERTLQSGFEWLEDFPMPFWLALFV  171



>ref|XP_011006207.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 isoform 
X1 [Populus euphratica]
Length=382

 Score =   244 bits (624),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            PVG      GL  NLIQA+ F+L+RPLSK+ +RRIN++ AELLWLELI LV WWA +K++
Sbjct  11   PVGIIFILSGLIVNLIQAVLFILVRPLSKSLHRRINKIVAELLWLELIVLVDWWANLKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +Y D ET +L+GKEHALVISNHKSD+DWLVGW+LAQRSGCLGS LAVMKK +K+LP+IGW
Sbjct  71   VYADDETFELLGKEHALVISNHKSDLDWLVGWILAQRSGCLGSALAVMKKEAKVLPIIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS+Y+FLERSW KDE TL SG + L D+P+PFWLALFV
Sbjct  131  SMWFSDYVFLERSWGKDERTLQSGFEWLEDFPMPFWLALFV  171



>dbj|BAJ84894.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N +QA+ F+ IRP SK  YR+IN   AELLWL+LIWLV WWAGVKV++Y DPET K+MGK
Sbjct  24   NTVQAVLFLTIRPFSKRLYRQINVFLAELLWLQLIWLVDWWAGVKVQVYADPETWKVMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHAL+ISNH+SDIDWLVGW+LAQRSGCLGS +A+MKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALLISNHRSDIDWLVGWILAQRSGCLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL SGLQ+L+D+P  FWLALFV
Sbjct  144  WAKDEKTLKSGLQRLKDFPRSFWLALFV  171



>ref|XP_003547001.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X1 [Glycine max]
Length=381

 Score =   242 bits (617),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  N+IQA+ FVL+RPLSKN Y RIN++  E LWLELIWL+ WWAG+K++
Sbjct  11   PLGILFILSGLIVNIIQAVFFVLLRPLSKNCYSRINKLLTESLWLELIWLIDWWAGIKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET++LMGKE+ALVI NH+SDIDWL+GWVLAQRSGCLGST+A+MKK  K LPV+GW
Sbjct  71   LYTDSETLQLMGKENALVICNHRSDIDWLIGWVLAQRSGCLGSTVAIMKKEVKFLPVLGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWF+EY+FLER WAKDET+L SG + L   P PFWLALFV
Sbjct  131  SMWFAEYIFLERDWAKDETSLKSGFRHLEHMPFPFWLALFV  171



>ref|XP_002298406.2| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
 gb|EEE83211.2| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
Length=382

 Score =   242 bits (617),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            PVG      GL  NLIQA+ F+L+RP+SK+ +RRIN++ AELLWLELI LV WWA +K++
Sbjct  11   PVGIIFILSGLIVNLIQAVLFILVRPVSKSLHRRINKIVAELLWLELIVLVDWWANLKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +Y D ET +L+GKEHALVISNH SD+DWLVGW+LAQRSGCLGS LAVMKK +K+LP+IGW
Sbjct  71   VYADDETFELLGKEHALVISNHNSDLDWLVGWILAQRSGCLGSALAVMKKEAKVLPIIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS+Y+FLERSW KDE  L SG ++L D+P+PFWLALFV
Sbjct  131  SMWFSDYVFLERSWGKDERILQSGFERLADFPMPFWLALFV  171



>gb|KHN33345.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Glycine soja]
Length=381

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  N+IQA+ FVL+RPLSKN Y RIN++  E LWLELIWL+ WWAG+K++
Sbjct  11   PLGILFILSGLIVNIIQAVFFVLLRPLSKNCYSRINKLLTESLWLELIWLIDWWAGIKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET++LMGKE+ALVI NH+SDIDWL+GWVLAQRSGCLGST+A+MKK  K LPV+GW
Sbjct  71   LYTDSETLQLMGKENALVICNHRSDIDWLIGWVLAQRSGCLGSTVAIMKKEVKFLPVLGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWF+EY+FLER WAKDET+L SG + L   P PFWLALFV
Sbjct  131  SMWFAEYIFLERDWAKDETSLKSGFRHLEHMPFPFWLALFV  171



>ref|XP_010672763.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=391

 Score =   241 bits (614),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N++QA CFVL+RPLSK+TYRRINR+ AELLWLEL+WLV WWA V+VK++TDPET + MGK
Sbjct  24   NVLQATCFVLVRPLSKSTYRRINRLVAELLWLELVWLVDWWARVQVKVFTDPETFRQMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALV+ NHKSDIDWLVGWVLAQR+GCLGSTLAVMKKSSK+LPVIGWSMWFSEYLFLERS
Sbjct  84   EHALVVCNHKSDIDWLVGWVLAQRAGCLGSTLAVMKKSSKMLPVIGWSMWFSEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE+T+  GL++L+DYPLPFWLALFV
Sbjct  144  WAKDESTIKLGLERLKDYPLPFWLALFV  171



>ref|XP_003575968.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Brachypodium distachyon]
Length=374

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N IQA+ F+LIRP SK  YR+IN   AELLWL+LIWLV WWAGVKV+L+ D ET + MGK
Sbjct  24   NAIQAVLFLLIRPFSKRLYRQINVFVAELLWLQLIWLVDWWAGVKVQLHADQETYESMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHAL+ISNH+SDIDWLVGW+LAQRSGCLGS +A+MKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALLISNHRSDIDWLVGWILAQRSGCLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL SGLQ+L+D+P  FWLALFV
Sbjct  144  WAKDEKTLKSGLQRLKDFPRSFWLALFV  171



>ref|XP_007028850.1| Lysophosphatidyl acyltransferase 2 [Theobroma cacao]
 gb|EOY09352.1| Lysophosphatidyl acyltransferase 2 [Theobroma cacao]
Length=401

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 143/175 (82%), Gaps = 14/175 (8%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+CFVLIRPLSKNTYR+INRV AELLWLEL+WLV WWAGVK+K
Sbjct  11   PLGLLFFISGLVVNLIQALCFVLIRPLSKNTYRKINRVVAELLWLELVWLVDWWAGVKIK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLP----  493
            ++ DPE+  LMGKEHALV++NH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSK LP    
Sbjct  71   VFMDPESFNLMGKEHALVVANHRSDIDWLVGWLLAQRSGCLGSALAVMKKSSKFLPVYVV  130

Query  494  ----------VIGWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
                      VIGWSMWFSEYLFLERSWAKDE TL +GLQ+L+D+P PFWLA FV
Sbjct  131  VICLKFQLSIVIGWSMWFSEYLFLERSWAKDENTLKAGLQRLKDFPRPFWLAFFV  185



>ref|XP_006852430.1| hypothetical protein AMTR_s00021p00084240 [Amborella trichopoda]
 gb|ERN13897.1| hypothetical protein AMTR_s00021p00084240 [Amborella trichopoda]
Length=387

 Score =   239 bits (611),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            NLIQ +C+V+ RPLSKN YRRINRV AELLWLEL+WL+ WW GVKV+LY D ET + MGK
Sbjct  24   NLIQIVCYVIFRPLSKNLYRRINRVVAELLWLELVWLIDWWGGVKVQLYADSETFRHMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVISNH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGWSMWFSEYLFLERS
Sbjct  84   EHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL +GLQ+L+D+P PFWLALFV
Sbjct  144  WAKDENTLKAGLQRLKDFPRPFWLALFV  171



>ref|XP_004486964.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X2 [Cicer arietinum]
Length=377

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            PVG      GL  N++QAI FVL+RP+S+  YRRIN+V  E LWLELIWLV WWAGVKV+
Sbjct  11   PVGTLFILSGLIVNVLQAIIFVLVRPISRYCYRRINKVLTESLWLELIWLVDWWAGVKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D ET +LMGKE+AL+I NH+SDIDWL+GWVLAQR+GCLG+T+A+MKK  K LPVIGW
Sbjct  71   LYADSETFQLMGKENALLICNHRSDIDWLIGWVLAQRTGCLGNTIAIMKKEVKYLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWF+E+LFLER+WAKDE  L SG +QL   P+PFW+ALFV
Sbjct  131  SMWFAEFLFLERNWAKDEAALKSGFKQLEHKPVPFWMALFV  171



>ref|XP_004486963.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X1 [Cicer arietinum]
Length=390

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            PVG      GL  N++QAI FVL+RP+S+  YRRIN+V  E LWLELIWLV WWAGVKV+
Sbjct  11   PVGTLFILSGLIVNVLQAIIFVLVRPISRYCYRRINKVLTESLWLELIWLVDWWAGVKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D ET +LMGKE+AL+I NH+SDIDWL+GWVLAQR+GCLG+T+A+MKK  K LPVIGW
Sbjct  71   LYADSETFQLMGKENALLICNHRSDIDWLIGWVLAQRTGCLGNTIAIMKKEVKYLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWF+E+LFLER+WAKDE  L SG +QL   P+PFW+ALFV
Sbjct  131  SMWFAEFLFLERNWAKDEAALKSGFKQLEHKPVPFWMALFV  171



>ref|XP_007150370.1| hypothetical protein PHAVU_005G147900g [Phaseolus vulgaris]
 gb|ESW22364.1| hypothetical protein PHAVU_005G147900g [Phaseolus vulgaris]
Length=379

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  N+IQAI F+L+RP+SKN YRR+N++  E LWL+LIWL+ WWAG+K++
Sbjct  10   PIGILFILSGLIVNIIQAIFFLLLRPISKNCYRRVNKLLTESLWLQLIWLIDWWAGIKIE  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            L+TD ET +LMGKE+ALVI NH+SDIDWL+GWVLAQRSGCLGST+A+MKK  K LPV+GW
Sbjct  70   LHTDSETFQLMGKENALVICNHRSDIDWLIGWVLAQRSGCLGSTVAIMKKEIKFLPVLGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWF+EY+FLER+W KDET+L S  + L   PLPFWLALFV
Sbjct  130  SMWFAEYIFLERNWKKDETSLKSNFKHLEHMPLPFWLALFV  170



>ref|XP_008813484.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X2 [Phoenix dactylifera]
Length=343

 Score =   236 bits (603),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            NLIQA CFV+IRP SKN YR+INRV AELLWL+L+WLV WWAGVKV LY D ET K +GK
Sbjct  24   NLIQATCFVMIRPFSKNLYRKINRVVAELLWLQLVWLVDWWAGVKVHLYADSETYKSLGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVI NH+SDIDWLVGW+LAQRSGCLGST+AVMKKSSK LPVIGWSMWF+EYLFLER+
Sbjct  84   EHALVICNHRSDIDWLVGWILAQRSGCLGSTIAVMKKSSKFLPVIGWSMWFAEYLFLERN  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GLQ+ RD+P PFWLALFV
Sbjct  144  WAKDENTLKLGLQRFRDFPRPFWLALFV  171



>ref|XP_010673624.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=383

 Score =   237 bits (605),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            PVG      GL  NLIQAI +VL+RPLSKN +RR N+V AELLWLE +WL  WWAGVKV+
Sbjct  11   PVGLLFLMSGLIINLIQAILYVLVRPLSKNMHRRFNKVVAELLWLETVWLFDWWAGVKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            L+TD ET  LMGKEHAL+I NH+SDIDWL+GWVLAQR+GCLG T+A+MK   K LPVIGW
Sbjct  71   LHTDSETFHLMGKEHALLICNHRSDIDWLIGWVLAQRAGCLGCTMAIMKDVLKYLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEY+F++R W  D++TL SG + L+D+P+PFWLALFV
Sbjct  131  SMWFSEYIFIKRRWDVDQSTLTSGCENLKDFPVPFWLALFV  171



>ref|XP_006304715.1| hypothetical protein CARUB_v10012002mg [Capsella rubella]
 gb|EOA37613.1| hypothetical protein CARUB_v10012002mg [Capsella rubella]
Length=376

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  140  YRPVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVK  319
            + PVG      GL  N+IQ   F+++RP S++ YRRIN+  AELLWL+LIWL +WWA +K
Sbjct  9    FIPVGVLFLVSGLIVNIIQLFFFIIVRPFSRSLYRRINKTIAELLWLQLIWLFHWWACIK  68

Query  320  VKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVI  499
            + LY D ET++ +GKEHALV+SNH+SDIDWL+GWV+AQR+GCLGS+LA+MKK +K LP+I
Sbjct  69   INLYADAETLEFIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPII  128

Query  500  GWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            GWSMWFS+Y+FLERSWAKDE TL +G ++L D+P+ FWLALFV
Sbjct  129  GWSMWFSDYIFLERSWAKDENTLEAGFKRLEDFPMTFWLALFV  171



>ref|XP_002894307.1| hypothetical protein ARALYDRAFT_474240 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70566.1| hypothetical protein ARALYDRAFT_474240 [Arabidopsis lyrata subsp. 
lyrata]
Length=376

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  137  CYRPVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGV  316
             + PVG      GL  N+IQ + F+++RP S++ YRRIN+  AELLWL+LIWL  WWA +
Sbjct  8    AFIPVGVLFLISGLIVNIIQLVFFIIVRPFSRSLYRRINKNVAELLWLQLIWLFDWWACI  67

Query  317  KVKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPV  496
            K+ LY D ET++L+GKEHALV+SNH+SDIDWL+GWV+AQR+GCLGS+LA+MKK +K LP+
Sbjct  68   KINLYADAETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPI  127

Query  497  IGWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            IGWSMWFS+Y+FLERSWAKDE TL +G ++L D+P+ FWLALFV
Sbjct  128  IGWSMWFSDYIFLERSWAKDENTLKAGFKRLEDFPMTFWLALFV  171



>ref|XP_008801931.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
isoform X2 [Phoenix dactylifera]
Length=343

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  NLIQA CFV+IRPLSKN YR+INRV AELLWL+L+WL+ WWAGVKV+
Sbjct  11   PIGLLFLLSGLVVNLIQATCFVMIRPLSKNLYRKINRVVAELLWLQLVWLLDWWAGVKVQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D ET   +GKEHALVI NH+SDIDWLVGW+LAQRSGCLGS +AVMKK+SK LPVIGW
Sbjct  71   LYADSETYASLGKEHALVICNHRSDIDWLVGWILAQRSGCLGSAIAVMKKTSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWF+EYLFLERSWAKDE TL  GLQ+ RD+P PFWLALFV
Sbjct  131  SMWFAEYLFLERSWAKDENTLKLGLQRFRDFPRPFWLALFV  171



>ref|XP_008813483.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Phoenix dactylifera]
Length=374

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            NLIQA CFV+IRP SKN YR+INRV AELLWL+L+WLV WWAGVKV LY D ET K +GK
Sbjct  24   NLIQATCFVMIRPFSKNLYRKINRVVAELLWLQLVWLVDWWAGVKVHLYADSETYKSLGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVI NH+SDIDWLVGW+LAQRSGCLGST+AVMKKSSK LPVIGWSMWF+EYLFLER+
Sbjct  84   EHALVICNHRSDIDWLVGWILAQRSGCLGSTIAVMKKSSKFLPVIGWSMWFAEYLFLERN  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GLQ+ RD+P PFWLALFV
Sbjct  144  WAKDENTLKLGLQRFRDFPRPFWLALFV  171



>gb|KFK35863.1| hypothetical protein AALP_AA4G046700 [Arabis alpina]
Length=376

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  140  YRPVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVK  319
            + PVG      GL  NLIQ + F+++RP S++ Y RIN+  AELLWL+LIWLV WWA +K
Sbjct  9    FVPVGVLFLVSGLIVNLIQLVFFIIVRPFSRSLYGRINKNVAELLWLQLIWLVDWWACIK  68

Query  320  VKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVI  499
            + LY D ET++LMGKEHALV+ NH+SDIDWL+GWV+AQRSGCLGSTLA+MKK +K LP+I
Sbjct  69   INLYADEETLELMGKEHALVLCNHRSDIDWLLGWVMAQRSGCLGSTLAIMKKEAKYLPII  128

Query  500  GWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            GWSMWFS+Y+FLER+WAKDE TL +G ++L D+P+ FWLALFV
Sbjct  129  GWSMWFSDYIFLERNWAKDENTLKAGFKRLEDFPMTFWLALFV  171



>ref|XP_003597431.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Medicago truncatula]
 gb|AES67682.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase-like protein [Medicago 
truncatula]
Length=376

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            PVG      GL  N+IQAI FV +RP+S+  YRRIN V  E LWLELIWL+ WWAGVKV+
Sbjct  11   PVGIIFILSGLIINVIQAIFFVFVRPISRYCYRRINNVLTESLWLELIWLIDWWAGVKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D ET +LMGKE+AL+I NH+SDIDWL+GWVLAQR+GCLGST+A+MKK  K LPVIGW
Sbjct  71   LYADSETFQLMGKENALLICNHRSDIDWLIGWVLAQRTGCLGSTIAIMKKEFKYLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWF+EYLFLER+WAKDE++L SG + L   P+PFW+ALFV
Sbjct  131  SMWFAEYLFLERNWAKDESSLKSGFKLLEHKPVPFWVALFV  171



>ref|NP_175537.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Arabidopsis 
thaliana]
 sp|Q9SYC8.1|LPAT3_ARATH RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
3; AltName: Full=Lysophosphatidyl acyltransferase 3 [Arabidopsis 
thaliana]
 gb|AAD30638.1|AC006085_11 Putative acyl-CoA:1-acylglycerol-3-phosphate acyltransferase 
[Arabidopsis thaliana]
 gb|AEE32642.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Arabidopsis 
thaliana]
Length=376

 Score =   235 bits (599),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  140  YRPVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVK  319
            + PVG      GL  N+IQ + F+++RP S++ YRRIN+  AELLWL+LIWL  WWA +K
Sbjct  9    FIPVGVLFLISGLIVNIIQLVFFIIVRPFSRSLYRRINKNVAELLWLQLIWLFDWWACIK  68

Query  320  VKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVI  499
            + LY D ET++L+GKEHALV+SNH+SDIDWL+GWV+AQR GCLGS+LA+MKK +K LP+I
Sbjct  69   INLYVDAETLELIGKEHALVLSNHRSDIDWLIGWVMAQRVGCLGSSLAIMKKEAKYLPII  128

Query  500  GWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            GWSMWFS+Y+FLERSWAKDE TL +G ++L D+P+ FWLALFV
Sbjct  129  GWSMWFSDYIFLERSWAKDENTLKAGFKRLEDFPMTFWLALFV  171



>ref|XP_003636648.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Medicago truncatula]
Length=438

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = +2

Query  167  YLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKV----KLYT  334
            +L  + + + AIC+VL+RPLSKN YRRINRV AELLWLEL+WL+ WWAGVKV    ++YT
Sbjct  47   FLSQYIHELHAICYVLVRPLSKNLYRRINRVVAELLWLELVWLIDWWAGVKVLKQVEIYT  106

Query  335  DPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMW  514
            D ET +LMGKEHALVI NH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSSK LPVIGWSMW
Sbjct  107  DRETSRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMW  166

Query  515  FSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            FSEYLFLERSWAKDE TL SG+++L D+PLPFWLALFV
Sbjct  167  FSEYLFLERSWAKDENTLKSGIRRLNDFPLPFWLALFV  204



>ref|XP_010479592.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Camelina sativa]
Length=376

 Score =   234 bits (598),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  140  YRPVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVK  319
            + PVG      GL  N+IQ + F+ +RP S++ YRRIN+  AELLWL+LIWL  WWA +K
Sbjct  9    FIPVGVLFLISGLIVNIIQLVFFITVRPFSRSLYRRINKTVAELLWLQLIWLFDWWACIK  68

Query  320  VKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVI  499
            + LY D ET++L+GKEHALV+SNH+SDIDWL+GWV+AQR+GCLGS+LA+MKK +K LP+I
Sbjct  69   INLYADAETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPII  128

Query  500  GWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            GWSMWFS+Y+FLERSWAKDE  L +G ++L D+P+ FWLALFV
Sbjct  129  GWSMWFSDYIFLERSWAKDENNLKAGFKRLEDFPMTFWLALFV  171



>ref|XP_008801930.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
isoform X1 [Phoenix dactylifera]
Length=374

 Score =   234 bits (597),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  NLIQA CFV+IRPLSKN YR+INRV AELLWL+L+WL+ WWAGVKV+
Sbjct  11   PIGLLFLLSGLVVNLIQATCFVMIRPLSKNLYRKINRVVAELLWLQLVWLLDWWAGVKVQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D ET   +GKEHALVI NH+SDIDWLVGW+LAQRSGCLGS +AVMKK+SK LPVIGW
Sbjct  71   LYADSETYASLGKEHALVICNHRSDIDWLVGWILAQRSGCLGSAIAVMKKTSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWF+EYLFLERSWAKDE TL  GLQ+ RD+P PFWLALFV
Sbjct  131  SMWFAEYLFLERSWAKDENTLKLGLQRFRDFPRPFWLALFV  171



>gb|ADE75797.1| unknown [Picea sitchensis]
Length=385

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  N IQA+C++++RP SKN YR  NRV AELLWLEL+WL  WWAGVK++
Sbjct  11   PMGALFLLSGLIVNCIQALCYIILRPFSKNLYRMANRVVAELLWLELVWLFDWWAGVKIR  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +Y DP  ++ MGKEHALVISNH+SD+DWLVGWVLAQRSGCLGS LAVMKKSSK LPV+GW
Sbjct  71   IYADPGILQHMGKEHALVISNHRSDVDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVMGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEY+FLER+WAKDETTL SGL++LRD+P PFWLALFV
Sbjct  131  SMWFSEYVFLERNWAKDETTLKSGLKKLRDFPRPFWLALFV  171



>ref|XP_002526730.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
 gb|ACC59198.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ricinus communis]
 gb|EEF35644.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
 gb|AFR42413.1| A-class lysophosphatidate acyltransferase-2 [Ricinus communis]
Length=395

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL QAICFVLIRP+SK++YR INR  AELLWLEL+WLV WWA +K++
Sbjct  11   PLGVLFFLSGLVVNLFQAICFVLIRPISKSSYRMINRALAELLWLELVWLVDWWAKIKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +YTD ET+ LMGKEHAL+++NH+SDIDWLVGW+LAQR+GCLGS LAVMKKSSK LPVIGW
Sbjct  71   VYTDRETLCLMGKEHALILANHRSDIDWLVGWMLAQRAGCLGSALAVMKKSSKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLERSWAKDE+TL SG+Q+L+D+P PFWL LFV
Sbjct  131  SMWFSEYLFLERSWAKDESTLKSGIQRLKDFPRPFWLGLFV  171



>ref|XP_010906759.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
[Elaeis guineensis]
Length=374

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            NLIQA CFV+IRPLSKN YRRINRV AELLWLEL+WL+ WWAGVKV+LY D ET   +GK
Sbjct  24   NLIQATCFVMIRPLSKNLYRRINRVVAELLWLELVWLLDWWAGVKVQLYADSETYASLGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVI NH+SDIDWLVGW+LAQRSGCLGST+AVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALVICNHRSDIDWLVGWILAQRSGCLGSTIAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE+TL  GLQ+ RD+P PFWLALFV
Sbjct  144  WAKDESTLKLGLQRFRDFPRPFWLALFV  171



>gb|EPS68644.1| lysophosphatidic acid acyltransferase, partial [Genlisea aurea]
Length=365

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+C++LIRP S+N YR IN+  AELLWLEL+WLV WWAGVK++
Sbjct  14   PLGVLFFISGLVVNLIQALCYLLIRPWSRNIYRIINKSVAELLWLELVWLVDWWAGVKIE  73

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +Y DPE+ K MGKEHALV+SNH+SDIDWLVGWVLAQRSGCLGSTLAVMKKSS  LPVIGW
Sbjct  74   VYADPESFKFMGKEHALVMSNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSMFLPVIGW  133

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEY+FLERSWAKDE TL  G Q+L D+P PFWLALFV
Sbjct  134  SMWFSEYVFLERSWAKDENTLKVGYQRLSDFPRPFWLALFV  174



>ref|XP_010461958.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Camelina 
sativa]
Length=376

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  140  YRPVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVK  319
            + PVG      GL  N+IQ + F+ +RP S++ YRRIN+  AELLWL+LIWL  WWA +K
Sbjct  9    FIPVGVLFLISGLIVNIIQLVFFITVRPFSRSWYRRINKTVAELLWLQLIWLFDWWACIK  68

Query  320  VKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVI  499
            + LY D ET++L+GKEHALV+SNH+SDIDWL+GWV+AQR+GCLGS+LA+MKK +K LP+I
Sbjct  69   INLYADAETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPII  128

Query  500  GWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            GWSMWFS+Y+FLERSWAKDE  L +G ++L D+P+ FWLALFV
Sbjct  129  GWSMWFSDYIFLERSWAKDENNLKAGFKRLEDFPMTFWLALFV  171



>ref|XP_010909860.1| PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-glycerol-3-phosphate 
acyltransferase PLS1-like [Elaeis guineensis]
Length=373

 Score =   232 bits (591),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            NLIQA CFV+IRP SKN YR+INRV AELLWL+L+WLV WWAGVKV+LY D ET K +GK
Sbjct  24   NLIQATCFVMIRPFSKNLYRKINRVVAELLWLQLVWLVDWWAGVKVQLYADSETYKSLGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVI NHKSDIDWLV W+LAQRSGCLGST+AVMKKSSK L VIGWSMWF+EYLFLERS
Sbjct  84   EHALVICNHKSDIDWLVRWILAQRSGCLGSTVAVMKKSSKFLRVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GLQ+ RD+P PFWLALFV
Sbjct  144  WAKDENTLKLGLQRFRDFPRPFWLALFV  171



>ref|XP_010500700.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Camelina sativa]
Length=376

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +2

Query  140  YRPVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVK  319
            + PVG      GL  N+IQ + F+ +RP S++ YRRIN+  AELLWL+LIWL  WWA +K
Sbjct  9    FIPVGVLFLISGLIVNIIQLVFFITVRPFSRSLYRRINKTVAELLWLQLIWLFDWWACIK  68

Query  320  VKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVI  499
            + LY D ET++ +GKEHALV+SNH+SDIDWL+GWV+AQR+GCLGS+LA+MKK +K LP+I
Sbjct  69   INLYADAETLERIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPII  128

Query  500  GWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            GWSMWFS+Y FLERSWAKDE  L +G ++L D+P+ FWLALFV
Sbjct  129  GWSMWFSDYSFLERSWAKDENNLKAGFKRLEDFPMTFWLALFV  171



>ref|XP_002513487.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
 gb|EEF48890.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
Length=381

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  G   NLIQA+ F+L+RP+SK+ +RRIN++ AELLWLELIWLV WWA +K++
Sbjct  11   PIGILFFVSGFVVNLIQAVLFILVRPVSKSLHRRINKIVAELLWLELIWLVDWWAHLKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +Y D ET +LMGKEHAL+I NH+SDIDWLVGW+LAQRSGCLGS LAVMKK +K+LP+IGW
Sbjct  71   VYADDETFELMGKEHALLICNHRSDIDWLVGWILAQRSGCLGSALAVMKKQAKVLPIIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS+YLFLERSWAKDETTL SG ++L D+P+PFWLALFV
Sbjct  131  SMWFSDYLFLERSWAKDETTLKSGFKRLEDFPMPFWLALFV  171



>emb|CDP18472.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N IQA+ F+L+RPLSKN +RRIN+   ELLWLE++WL  WWA +KV+LYTDPET + +GK
Sbjct  23   NFIQALIFILVRPLSKNLFRRINKEVTELLWLEIVWLFDWWANIKVELYTDPETFEFLGK  82

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHAL+I NH+SDIDWLVGWVLAQR GCLGSTLA++KK++  LPV+GWSMWF+ Y+FLERS
Sbjct  83   EHALLICNHRSDIDWLVGWVLAQRFGCLGSTLALIKKAALYLPVLGWSMWFNNYIFLERS  142

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            W KDE TL SGLQ L D+P PFWLALFV
Sbjct  143  WTKDEYTLKSGLQGLNDFPRPFWLALFV  170



>ref|XP_010031802.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Eucalyptus grandis]
Length=380

 Score =   230 bits (586),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  NL+QA  +VLIRPLSK TYR+IN+V AELL LELIWL  WWAG+KV+
Sbjct  11   PIGMLFILSGLLVNLVQAFFYVLIRPLSKKTYRKINKVVAELLLLELIWLFDWWAGIKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D +T ++MGKEHAL+I NH+SDIDWLVGWV+AQR+GCLGS LA+MKK +K LPV+GW
Sbjct  71   LYMDSQTFEMMGKEHALLICNHRSDIDWLVGWVIAQRAGCLGSALAIMKKEAKFLPVVGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS+Y+F++R WAKDE TL SG ++L D+P+PFWLALFV
Sbjct  131  SMWFSDYVFVDRCWAKDENTLKSGFERLSDFPMPFWLALFV  171



>ref|XP_006597258.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X2 [Glycine max]
Length=450

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  194  QAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGKEHA  373
            QA+ FVL+RPLSKN Y RIN++  E LWLELIWL+ WWAG+K++LYTD ET++LMGKE+A
Sbjct  96   QAVFFVLLRPLSKNCYSRINKLLTESLWLELIWLIDWWAGIKIELYTDSETLQLMGKENA  155

Query  374  LVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERSWAK  553
            LVI NH+SDIDWL+GWVLAQRSGCLGST+A+MKK  K LPV+GWSMWF+EY+FLER WAK
Sbjct  156  LVICNHRSDIDWLIGWVLAQRSGCLGSTVAIMKKEVKFLPVLGWSMWFAEYIFLERDWAK  215

Query  554  DETTLXSGLQQLRDYPLPFWLALFV  628
            DET+L SG + L   P PFWLALFV
Sbjct  216  DETSLKSGFRHLEHMPFPFWLALFV  240



>ref|XP_009395596.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Musa acuminata subsp. malaccensis]
Length=374

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N++QA+CF+ IR  SK+ YRRINRV AELLWL+L+WLV WWAGVK+++Y D +T + MG+
Sbjct  24   NVVQAVCFITIRLFSKSLYRRINRVLAELLWLQLVWLVDWWAGVKIQVYADSKTFESMGE  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVISNH+SDIDWLVGW+LAQRSGCLGS LAVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDETTL  GLQ+L+D+P PFWLALFV
Sbjct  144  WAKDETTLKLGLQRLKDFPRPFWLALFV  171



>ref|XP_004503603.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Cicer arietinum]
Length=380

 Score =   229 bits (584),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  N+IQ + FVL RP+S+  YR+IN+V  E+LWLELIWLV WWAGVK++
Sbjct  11   PLGTLFILSGLIVNVIQVVIFVLFRPISRYYYRKINKVLTEILWLELIWLVDWWAGVKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET +L+G+E+AL+I NH+SDIDWL+GW LAQRSGCLGST+A+MKK  K LPV+GW
Sbjct  71   LYTDSETFELLGRENALLICNHRSDIDWLIGWTLAQRSGCLGSTVAIMKKEVKYLPVLGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWF+++LFLER+WAKDE TL +G +Q    P+PFW+ALFV
Sbjct  131  SMWFADFLFLERNWAKDEVTLKTGFKQQVQNPVPFWMALFV  171



>ref|XP_002894308.1| hypothetical protein ARALYDRAFT_892094 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70567.1| hypothetical protein ARALYDRAFT_892094 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            PVG      GL  N IQ + F+++RP S++ YRRIN+  AELLWL+LIWL  WWA +K+ 
Sbjct  11   PVGILFLVSGLIVNSIQLVFFIIVRPFSRSLYRRINKNVAELLWLQLIWLSDWWACIKIN  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D ET++L+GKEHALV+SNH+SDIDWL+GWV+AQR+GCLGS+LA+M K +K LP+IGW
Sbjct  71   LYADAETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMAKEAKYLPIIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS+Y+FLERSWAKDE TL +G ++L D+P+ FWLALFV
Sbjct  131  SMWFSDYIFLERSWAKDENTLKAGFKRLEDFPMTFWLALFV  171



>ref|XP_006663068.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Oryza brachyantha]
Length=374

 Score =   227 bits (578),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N IQA+ F+ IRP SKN YRRINR  AELLWL+L+WLV WWAGVK++L+ D ET K MG 
Sbjct  24   NAIQAVLFLSIRPFSKNLYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADDETYKSMGT  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVISNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GLQ+L+D+P PFWLALFV
Sbjct  144  WAKDEKTLKWGLQRLKDFPRPFWLALFV  171



>ref|XP_010237505.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
isoform X2 [Brachypodium distachyon]
Length=310

 Score =   225 bits (573),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N +QA+ FV IRP SK+ YRRINR  AELLWL+L+WLV WWAGVK++L+ D E+ + MGK
Sbjct  24   NAVQAVLFVSIRPFSKSFYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADEESYQSMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVISNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GLQ+L+D+P PFWLALFV
Sbjct  144  WAKDEKTLKWGLQRLKDFPRPFWLALFV  171



>gb|ABA94922.2| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAH01342.1| unnamed protein product [Oryza sativa Japonica Group]
Length=374

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N IQA+ F+ IRP SK+ YRRINR  AELLWL+L+WLV WWAGVK++L+ D ET K MG 
Sbjct  24   NAIQAVLFLSIRPFSKSLYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADDETYKAMGN  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVISNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GLQ+L+D+P PFWLALFV
Sbjct  144  WAKDEKTLKWGLQRLKDFPRPFWLALFV  171



>gb|EEC68515.1| hypothetical protein OsI_36790 [Oryza sativa Indica Group]
Length=374

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N IQA+ F+ IRP SK+ YRRINR  AELLWL+L+WLV WWAGVK++L+ D ET K MG 
Sbjct  24   NAIQAVLFLSIRPFSKSLYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADDETYKAMGN  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVISNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GLQ+L+D+P PFWLALFV
Sbjct  144  WAKDEKTLKWGLQRLKDFPRPFWLALFV  171



>ref|XP_003577308.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
isoform X1 [Brachypodium distachyon]
Length=374

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N +QA+ FV IRP SK+ YRRINR  AELLWL+L+WLV WWAGVK++L+ D E+ + MGK
Sbjct  24   NAVQAVLFVSIRPFSKSFYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADEESYQSMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVISNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GLQ+L+D+P PFWLALFV
Sbjct  144  WAKDEKTLKWGLQRLKDFPRPFWLALFV  171



>gb|EEE52425.1| hypothetical protein OsJ_34550 [Oryza sativa Japonica Group]
Length=409

 Score =   225 bits (573),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N IQA+ F+ IRP SK+ YRRINR  AELLWL+L+WLV WWAGVK++L+ D ET K MG 
Sbjct  24   NAIQAVLFLSIRPFSKSLYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADDETYKAMGN  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHALVISNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GLQ+L+D+P PFWLALFV
Sbjct  144  WAKDEKTLKWGLQRLKDFPRPFWLALFV  171



>emb|CDY65469.1| BnaA08g29540D [Brassica napus]
Length=358

 Score =   223 bits (568),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P G      GL  NLIQ + F+ +RP+S+N YRR N    ELLWL+LIWLV WWA +K+ 
Sbjct  43   PFGLLFLVSGLIINLIQLVLFIFVRPVSRNVYRRTNTSVVELLWLQLIWLVDWWAFMKIN  102

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D E ++L+GKEHALV+SNH+ DIDWLVGWV+AQRSGCLGSTLA+M+K +K  P+IGW
Sbjct  103  LYADAEALELLGKEHALVLSNHRGDIDWLVGWVMAQRSGCLGSTLAIMRKEAKYFPIIGW  162

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEY+FLE++WAKDE  L +G  QL+D+P   WL LFV
Sbjct  163  SMWFSEYIFLEKNWAKDEKILKAGFNQLKDFPTTLWLGLFV  203



>ref|XP_007214575.1| hypothetical protein PRUPE_ppa019921mg [Prunus persica]
 gb|EMJ15774.1| hypothetical protein PRUPE_ppa019921mg [Prunus persica]
Length=380

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  NL+Q + F+L+RP+SK  YR+IN+V AELLWLELIWL+ WWAG+KV+
Sbjct  11   PIGVVFILSGLIVNLMQVVSFILLRPISKKLYRKINKVVAELLWLELIWLIDWWAGIKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D +T +LMGKEHALVI NH+SDIDWLVGW++AQRSGCLGS LA+MKK    LPVIGW
Sbjct  71   LYVDSDTFQLMGKEHALVICNHRSDIDWLVGWLVAQRSGCLGSALAIMKKEVMFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEY FLER W KDE TL SG QQL D+P+PFWLALFV
Sbjct  131  SMWFSEYFFLERRWTKDEITLKSGFQQLEDFPMPFWLALFV  171



>ref|XP_009375057.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Pyrus 
x bretschneideri]
Length=380

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            PVG      GL  NL+Q +CF+L+RP+SK+ YR+IN+V AELLWLELIWL+ WWAG+KV+
Sbjct  11   PVGVLFILSGLIVNLMQIVCFLLVRPVSKSMYRKINKVVAELLWLELIWLIDWWAGIKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D +T +LMG+EHALVISNHKSDIDWLVGW++AQR+GCLGS LA++KK    LPVIGW
Sbjct  71   LYVDSKTFQLMGQEHALVISNHKSDIDWLVGWLVAQRTGCLGSALAIIKKEIMFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS+Y+FLER W KDE+TL SG ++L D+P+PFWLALFV
Sbjct  131  SMWFSDYVFLERRWTKDESTLKSGFRRLEDFPMPFWLALFV  171



>emb|CDY03631.1| BnaC03g68900D [Brassica napus]
Length=378

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = +2

Query  152  GRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLY  331
            G   F  GL  NLIQ + F+ +RP+S++ YR IN    ELLWL+LIWLV WWA +KV LY
Sbjct  43   GLLFFVSGLIINLIQLVLFIFVRPVSRSLYRGINTSVVELLWLQLIWLVDWWAFIKVNLY  102

Query  332  TDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSM  511
             D ET++L+GKEHALV+SNH+ DIDWLVGWV+AQ SGCLGSTLA+M+K +K  P+IGWSM
Sbjct  103  ADAETLELLGKEHALVLSNHRGDIDWLVGWVMAQHSGCLGSTLAIMRKEAKYFPIIGWSM  162

Query  512  WFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WFSEY+ LE++WAKDE  L +G  QL+D+P  FWL LFV
Sbjct  163  WFSEYIILEKNWAKDEKILKAGFNQLKDFPTTFWLGLFV  201



>ref|XP_006393066.1| hypothetical protein EUTSA_v10011593mg [Eutrema salsugineum]
 gb|ESQ30352.1| hypothetical protein EUTSA_v10011593mg [Eutrema salsugineum]
Length=365

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            PVG      GL  NLIQ + F+++RP S++ YRRIN+  AELLWL+LIWL+ WWA +K+ 
Sbjct  11   PVGVLFLISGLIVNLIQLVFFIIVRPFSRSLYRRINKTVAELLWLQLIWLIDWWACIKIN  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D ET++L+GKEHALV+SNH+SDIDWL+GWV+AQR+GCLGS+LA+MKK +K LP+IGW
Sbjct  71   LYADAETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPIIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS+Y+FLERSWAKDE TL +G ++L D+P+ FWLALFV
Sbjct  131  SMWFSDYIFLERSWAKDENTLKAGFKRLEDFPMTFWLALFV  171



>ref|XP_010545584.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Tarenaya 
hassleriana]
 ref|XP_010545585.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Tarenaya 
hassleriana]
Length=380

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  140  YRPVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVK  319
            + P+G      GL  N+IQ +  +++ P+S+N YRRIN+   ELLW++LIWLV WWA  K
Sbjct  9    FVPLGVLFLVSGLIVNIIQVVLVIIVLPISRNLYRRINKAVVELLWMQLIWLVDWWAATK  68

Query  320  VKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVI  499
            V LY D ET++ +GKEHAL+I NH+SDIDWL+GWVLAQR+GCLGS+LA+MKK +K LP+I
Sbjct  69   VNLYIDAETLESLGKEHALLICNHRSDIDWLIGWVLAQRAGCLGSSLAMMKKEAKYLPII  128

Query  500  GWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            GWSMWFSEY+FLERSW+KDETTL +GL+QL ++P PFWLALFV
Sbjct  129  GWSMWFSEYIFLERSWSKDETTLKTGLKQLENFPTPFWLALFV  171



>ref|XP_007015031.1| Lysophosphatidyl acyltransferase 3 [Theobroma cacao]
 gb|EOY32650.1| Lysophosphatidyl acyltransferase 3 [Theobroma cacao]
Length=379

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            PVG      GL  NLIQA+  VL+RPLSK+ YRR N+V  ELLWLELIWL+ WWA +K+ 
Sbjct  11   PVGVLFILSGLIVNLIQAVLLVLLRPLSKSLYRRTNKVIVELLWLELIWLIDWWASIKID  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD  T +LMGKEHALVI NH+SDIDWLVGWVLAQRS CLGS LA++K+S+K LP+IGW
Sbjct  71   LYTDAATFQLMGKEHALVICNHRSDIDWLVGWVLAQRSSCLGSALAIIKRSAKFLPIIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS+Y+FLERSWAKD+ TL  G +QL D+P+PFWLALFV
Sbjct  131  SMWFSDYVFLERSWAKDKETLKFGFKQLEDFPMPFWLALFV  171



>ref|XP_004139036.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis sativus]
 ref|XP_004154631.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis sativus]
 gb|KGN66490.1| hypothetical protein Csa_1G613620 [Cucumis sativus]
Length=380

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  N+IQA  FVL+RP+SK  YRRIN+V AELLWLELIWL+ WWA  KV+
Sbjct  11   PLGLLFILSGLIVNVIQAFIFVLVRPISKCLYRRINKVVAELLWLELIWLIDWWAEAKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +YTD  T +LMGKEHALV+ NH+SDIDWLVGWVLAQR+GCLGS LA+MKK +K LPVIGW
Sbjct  71   VYTDQATFQLMGKEHALVLCNHRSDIDWLVGWVLAQRAGCLGSALAIMKKEAKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS+Y+FLERSWAKDE+TL S  Q L D+ +PFWLALFV
Sbjct  131  SMWFSDYIFLERSWAKDESTLESSFQSLMDFSMPFWLALFV  171



>ref|XP_011080283.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Sesamum indicum]
Length=377

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 134/167 (80%), Gaps = 0/167 (0%)
 Frame = +2

Query  128  SCSCYRPVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWW  307
            + + + P+G      G   NLIQA+ FVLIRP+SK+ YRRIN+   ELLWLELIWL  WW
Sbjct  4    AAAVFLPLGILFLLSGFIVNLIQAVLFVLIRPVSKSAYRRINKEIIELLWLELIWLFDWW  63

Query  308  AGVKVKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKL  487
            A +KV+L+ D ET  L+GKE AL+I NH+SDIDWLVGWVLAQR+GCLGS+LA++KKSS  
Sbjct  64   ANIKVELFVDQETFDLLGKERALLICNHRSDIDWLVGWVLAQRAGCLGSSLAMIKKSSLF  123

Query  488  LPVIGWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            LPVIGWSMWFS+Y+FLERSWAKDE TL SGL  L DYPLPFWLALFV
Sbjct  124  LPVIGWSMWFSDYIFLERSWAKDENTLKSGLVALNDYPLPFWLALFV  170



>ref|XP_006361745.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Solanum tuberosum]
Length=377

 Score =   216 bits (551),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 123/161 (76%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  N IQA+ F+L+RP S N +RRIN+  AELLWLE++WL  WWA VKV+
Sbjct  10   PIGLLFLLSGLIINFIQALLFILVRPFSNNIFRRINKEVAELLWLEIVWLFDWWANVKVE  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET  +MGKE AL+ISNH+SDIDWLVGWVLAQR GCLG+T+A+ KKS   LPV+GW
Sbjct  70   LYTDQETYGIMGKEPALIISNHRSDIDWLVGWVLAQRVGCLGNTIALAKKSLSYLPVLGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS  + LERSW KDE  L SG Q+L D+  PFWLA+FV
Sbjct  130  SMWFSCCISLERSWNKDENILKSGFQELNDFHQPFWLAVFV  170



>ref|XP_010102333.1| Xanthine dehydrogenase [Morus notabilis]
 gb|EXB93294.1| Xanthine dehydrogenase [Morus notabilis]
Length=1731

 Score =   228 bits (582),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G    + G   N +QA+ F+L+RP+SK TYRRIN+V AELLWLELIWL+ WWAG+K++
Sbjct  11   PIGILFIFSGFLVNFLQAMLFILVRPISKRTYRRINKVIAELLWLELIWLIDWWAGIKIE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD ET  LMGKEHALVISNH+SDIDWLVGWVLAQR+GCLGS LA+MKK +K LP+IGW
Sbjct  71   VHTDSETFSLMGKEHALVISNHRSDIDWLVGWVLAQRAGCLGSALAIMKKEAKFLPIIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS+Y+FLER WA DE+TL SG ++L D+P+PFWLALFV
Sbjct  131  SMWFSDYVFLERKWAIDESTLKSGFRRLEDFPMPFWLALFV  171



>ref|XP_006446109.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
 gb|ESR59349.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
Length=390

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  N IQA+ FVL+RP SK  YRRIN++  ELLWLELIWL+ WWA +KV+
Sbjct  11   PIGMLFILSGLIVNSIQAVLFVLVRPASKRVYRRINKIIVELLWLELIWLIDWWACIKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D ET +LMGKEHALVI NH+SDIDWLVGWV+AQR GCLGSTLA++KK +K LP IGW
Sbjct  71   LYADAETFQLMGKEHALVICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEY+FLER W KDE TL SG ++L D+P+PFWLAL+V
Sbjct  131  SMWFSEYVFLERRWNKDEQTLKSGFKRLVDFPMPFWLALYV  171



>ref|XP_008450418.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis melo]
Length=380

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  N+IQA  FVL+RP+SK  +RRIN+V AELLWLELIWL+ WWA  KV+
Sbjct  11   PLGLLFILSGLIVNIIQAFIFVLVRPISKCLFRRINKVVAELLWLELIWLIDWWAEAKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD  T +LMGKEHALV+ NH+SDIDWLVGWVLAQR+GCLGS LA+MKK +K LPVIGW
Sbjct  71   VFTDQATFQLMGKEHALVLCNHRSDIDWLVGWVLAQRAGCLGSALAIMKKEAKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS+Y+FLERSWAKDE TL S  Q L D+ +PFWLALFV
Sbjct  131  SMWFSDYIFLERSWAKDENTLESSFQSLMDFSMPFWLALFV  171



>ref|XP_006470598.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X1 [Citrus sinensis]
Length=426

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  N IQA+ F+L+RP SK  YRRIN++  ELLWLELIWL+ WWA +KV+
Sbjct  48   PIGMLFILSGLIVNSIQAVLFILVRPASKRVYRRINKIIVELLWLELIWLIDWWACIKVE  107

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D ET +LMGKEHALVI NH+SDIDWLVGWV+AQR GCLGSTLA++KK +K LP IGW
Sbjct  108  LYADAETFQLMGKEHALVICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGW  167

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEY+FLER W KDE TL SG ++L D+P+PFWLAL+V
Sbjct  168  SMWFSEYVFLERRWNKDEQTLKSGFKRLVDFPMPFWLALYV  208



>emb|CDY35563.1| BnaC05g27180D [Brassica napus]
Length=376

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  140  YRPVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVK  319
            + PVG      GL  NLIQ + F+++RP SK+ YRRIN+   ELLWL+LIWL+ WWA +K
Sbjct  9    FVPVGVLFLVSGLIVNLIQLVFFIIVRPFSKSLYRRINKNVVELLWLQLIWLIDWWACIK  68

Query  320  VKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVI  499
            V LY D ET++L+GKEHALV+SNH+SDIDWL+GWV+AQR+GCLGS+LA+MKK +K LP+I
Sbjct  69   VNLYADAETLQLLGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPII  128

Query  500  GWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            GWSMWFS+Y+FLERSW KDE TL +G ++  D+P+ FWLALFV
Sbjct  129  GWSMWFSDYIFLERSWDKDEKTLTAGFKRFEDFPMTFWLALFV  171



>ref|XP_009144912.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Brassica 
rapa]
 emb|CDY29625.1| BnaA05g15450D [Brassica napus]
Length=376

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  140  YRPVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVK  319
            + PVG      GL  NLIQ + F+++RP SK+ YRRIN+   ELLWL+LIWL+ WWA +K
Sbjct  9    FVPVGVLFLVSGLIVNLIQLVFFIIVRPFSKSLYRRINKNVVELLWLQLIWLIDWWACIK  68

Query  320  VKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVI  499
            V +Y D ET++L+GKEHALV+SNH+SDIDWL+GWV+AQR+GCLGS+LA+MKK +K LP+I
Sbjct  69   VNIYADAETLQLLGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPII  128

Query  500  GWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            GWSMWFS+Y+FLERSW KDE TL +G ++  D+P+ FWLALFV
Sbjct  129  GWSMWFSDYIFLERSWDKDEKTLTAGFKRFEDFPMTFWLALFV  171



>ref|XP_002268451.2| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Vitis vinifera]
Length=386

 Score =   214 bits (544),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  NLIQ   ++L+RP+SKN YRRIN+V  ELLWLELIWL+ WWAGVKV+
Sbjct  16   PLGLLFILSGLVVNLIQVAFYILVRPMSKNLYRRINKVVVELLWLELIWLIDWWAGVKVE  75

Query  326  LYT-DPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIG  502
            ++  D ET +LMGKEH+LVI NH+SDIDWLVGWVLAQRS CLGSTLAVMKKS K LP+IG
Sbjct  76   VFAADSETFELMGKEHSLVICNHRSDIDWLVGWVLAQRSNCLGSTLAVMKKSLKFLPIIG  135

Query  503  WSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WSMWFS+Y+F+ERSWAKDE TL  GL++L D+P PFWLALFV
Sbjct  136  WSMWFSDYVFVERSWAKDERTLKWGLERLEDFPRPFWLALFV  177



>emb|CBI21663.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  NLIQ   ++L+RP+SKN YRRIN+V  ELLWLELIWL+ WWAGVKV+
Sbjct  11   PLGLLFILSGLVVNLIQVAFYILVRPMSKNLYRRINKVVVELLWLELIWLIDWWAGVKVE  70

Query  326  LYT-DPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIG  502
            ++  D ET +LMGKEH+LVI NH+SDIDWLVGWVLAQRS CLGSTLAVMKKS K LP+IG
Sbjct  71   VFAADSETFELMGKEHSLVICNHRSDIDWLVGWVLAQRSNCLGSTLAVMKKSLKFLPIIG  130

Query  503  WSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WSMWFS+Y+F+ERSWAKDE TL  GL++L D+P PFWLALFV
Sbjct  131  WSMWFSDYVFVERSWAKDERTLKWGLERLEDFPRPFWLALFV  172



>ref|XP_002443267.1| hypothetical protein SORBIDRAFT_08g016610 [Sorghum bicolor]
 gb|EES17105.1| hypothetical protein SORBIDRAFT_08g016610 [Sorghum bicolor]
Length=374

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N IQAI  V +RPLSK+ YRRINR   ELLWL+LIWL+ WWA VKV+L+ D ET +LMGK
Sbjct  24   NAIQAILLVSVRPLSKSLYRRINRFLVELLWLQLIWLLDWWAVVKVQLHADQETYQLMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHAL+ISNH+SDIDWL+GW+LAQRSGCLGSTLA+MKKSSK LPVIGWSMWFSEYLFLERS
Sbjct  84   EHALIISNHRSDIDWLIGWILAQRSGCLGSTLAIMKKSSKFLPVIGWSMWFSEYLFLERS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL  GL++L+D+P  FWLALFV
Sbjct  144  WAKDEKTLKWGLRRLKDFPRSFWLALFV  171



>ref|XP_004250948.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
[Solanum lycopersicum]
Length=377

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 121/161 (75%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  N IQ + F+L+RP SKN +RRIN+  AELLWLE+IWL  WWA VKV+
Sbjct  10   PIGLIFLLSGLIINFIQVVLFILVRPFSKNIFRRINKEVAELLWLEIIWLFDWWANVKVE  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET  ++GKE AL+ISNH+SDIDWLVGWVLAQR GCLG T+A+ KKS   LPV+GW
Sbjct  70   LYTDQETYGILGKEPALIISNHRSDIDWLVGWVLAQRVGCLGYTIALAKKSLSYLPVLGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS  + LERSW KDE  L SG ++L  +  PFWLA+FV
Sbjct  130  SMWFSSLISLERSWNKDENILKSGFRELNGFHQPFWLAVFV  170



>ref|XP_007212911.1| hypothetical protein PRUPE_ppa022232mg [Prunus persica]
 gb|EMJ14110.1| hypothetical protein PRUPE_ppa022232mg [Prunus persica]
Length=381

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P G     LGLF NL+QAICF+ IRPLSK+TYR+IN   A LLWL+ IWL+ WWAG+KVK
Sbjct  11   PFGVIFVVLGLFVNLLQAICFLTIRPLSKSTYRKINGTIASLLWLDHIWLLEWWAGLKVK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET +LMG+EHAL++ NH  D D L+G++LAQR GCL S L VMKKS+K LP+ GW
Sbjct  71   LYTDLETYRLMGEEHALLMPNHMCDADILIGFLLAQRLGCLRSALMVMKKSAKFLPIFGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            + WF  ++FL RSW KDE+ L   LQ L+D+P+PFWL +F 
Sbjct  131  TSWFLGFVFLNRSWEKDESNLKRSLQGLKDFPMPFWLTIFA  171



>ref|XP_009615949.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
[Nicotiana tomentosiformis]
Length=377

 Score =   211 bits (537),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 127/161 (79%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  N IQA+ F+L+RP SKN YRRIN+   ELLWLELIWL  WWA VKV+
Sbjct  10   PIGLLFLLSGLIINFIQALLFILVRPCSKNMYRRINKEVTELLWLELIWLFDWWANVKVE  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET  LMGKEHALVISNH+SDIDWLVGWV+AQR GCLGST+A+ KKS   LPV+GW
Sbjct  70   LYTDQETYGLMGKEHALVISNHRSDIDWLVGWVIAQRVGCLGSTIALAKKSLSYLPVLGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS Y+ LERSWAKDE TL SG QQL D+  PFWLA+FV
Sbjct  130  SMWFSGYISLERSWAKDENTLKSGFQQLNDFHQPFWLAVFV  170



>ref|XP_008377433.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Malus 
domestica]
Length=380

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G  L   GL  NL+Q +  +L+RP+SK+ YR+IN+V AELLWLELIWL+ WWAG+KV+
Sbjct  11   PIGVLLVLSGLIVNLMQIVFSILVRPVSKSMYRKINKVVAELLWLELIWLIDWWAGIKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D ET +LMGKE AL+ISNHKSDIDWLVGW++AQRSGCLGSTLA+MKK    +P IGW
Sbjct  71   LYVDSETFQLMGKERALLISNHKSDIDWLVGWLVAQRSGCLGSTLAIMKKEIMFIPFIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEY+FLER W KDE TL S  ++L D+P PFWLALFV
Sbjct  131  SMWFSEYVFLERQWTKDEKTLKSCFRRLEDFPGPFWLALFV  171



>gb|EYU46266.1| hypothetical protein MIMGU_mgv1a026523mg, partial [Erythranthe 
guttata]
Length=351

 Score =   208 bits (529),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 129/161 (80%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  NL+QAI  VL+RPLSKN YRRIN+   ELLWLELIWL  WWA +KV+
Sbjct  10   PIGLMFLLSGLIVNLLQAILLVLVRPLSKNAYRRINKQLIELLWLELIWLFDWWANIKVE  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            L+ D ET  ++GKE AL+I NH+SDIDWLVGWVLAQR+GCLGS+LA++KKSS  LPVIGW
Sbjct  70   LFADEETFAMLGKEPALLICNHRSDIDWLVGWVLAQRAGCLGSSLAMIKKSSLFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS ++FLER+WAKDE T+ SG + L  +P+PFWLALFV
Sbjct  130  SMWFSGFIFLERNWAKDENTMKSGFEALNGFPIPFWLALFV  170



>ref|XP_009773917.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Nicotiana sylvestris]
Length=377

 Score =   208 bits (530),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G      GL  N IQA+ F+L+RP SKN YR IN+   ELLWLELIWL  WWA VKV+
Sbjct  10   PIGLLFLLSGLIINFIQALLFILVRPCSKNIYRGINKEVTELLWLELIWLFDWWANVKVE  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET  LMGKEHALVISNH+SDIDWLVGWV+AQR GCLGST+A+ KKS   LPV+GW
Sbjct  70   LYTDQETFGLMGKEHALVISNHRSDIDWLVGWVIAQRVGCLGSTIALAKKSLSYLPVLGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFS Y+ LERSWAKDE TL SG QQL D+  PFWLA+FV
Sbjct  130  SMWFSGYISLERSWAKDENTLKSGFQQLNDFHQPFWLAVFV  170



>ref|XP_010673625.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=343

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +2

Query  239  YRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGKEHALVISNHKSDIDWLVG  418
            +RR N+V AELLWLE +WL  WWAGVKV+L+TD ET  LMGKEHAL+I NH+SDIDWL+G
Sbjct  2    HRRFNKVVAELLWLETVWLFDWWAGVKVELHTDSETFHLMGKEHALLICNHRSDIDWLIG  61

Query  419  WVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERSWAKDETTLXSGLQQLRDY  598
            WVLAQR+GCLG T+A+MK   K LPVIGWSMWFSEY+F++R W  D++TL SG + L+D+
Sbjct  62   WVLAQRAGCLGCTMAIMKDVLKYLPVIGWSMWFSEYIFIKRRWDVDQSTLTSGCENLKDF  121

Query  599  PLPFWLALFV  628
            P+PFWLALFV
Sbjct  122  PVPFWLALFV  131



>ref|XP_006470599.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Citrus sinensis]
 gb|KDO61277.1| hypothetical protein CISIN_1g016254mg [Citrus sinensis]
Length=392

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +2

Query  197  AICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGKEHAL  376
            A+ F+L+RP SK  YRRIN++  ELLWLELIWL+ WWA +KV+LY D ET +LMGKEHAL
Sbjct  31   AVLFILVRPASKRVYRRINKIIVELLWLELIWLIDWWACIKVELYADAETFQLMGKEHAL  90

Query  377  VISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERSWAKD  556
            VI NH+SDIDWLVGWV+AQR GCLGSTLA++KK +K LP IGWSMWFSEY+FLER W KD
Sbjct  91   VICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGWSMWFSEYVFLERRWNKD  150

Query  557  ETTLXSGLQQLRDYPLPFWLALFV  628
            E TL SG ++L D+P+PFWLAL+V
Sbjct  151  EQTLKSGFKRLVDFPMPFWLALYV  174



>emb|CDY52093.1| BnaC04g55420D [Brassica napus]
Length=496

 Score =   201 bits (511),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 114/161 (71%), Gaps = 25/161 (16%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NL+ AIC+                         L+W+V WWAGV +K
Sbjct  10   PLGLLFFIFGLLVNLLLAICY-------------------------LVWIVDWWAGVTIK  44

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            ++TD ET   MGKEHALV+ NH+SDIDWLVGW+LAQRSGCLGS LAV KKSSK LPV GW
Sbjct  45   VFTDNETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVTKKSSKFLPVKGW  104

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+W KDE+T+ SGLQ+L+D+P PFWLALFV
Sbjct  105  SMWFSEYLFLERNWVKDESTIKSGLQRLKDFPQPFWLALFV  145



>ref|XP_001764965.1| predicted protein [Physcomitrella patens]
 gb|EDQ70181.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 114/161 (71%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G    + G F N++Q +  + I P S+  YR +N +  E+LW ELIWL+ WWA VKV 
Sbjct  11   PLGLMFLFSGFFINILQLLSVLFILPFSRRAYRVVNMIMMEVLWSELIWLLDWWANVKVS  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
              +   ++ L GKEHAL+I NH+SDIDWLVGW++AQR GCLG T AVMKKS+K LPVIGW
Sbjct  71   RLSGSLSISLFGKEHALLICNHRSDIDWLVGWIIAQRLGCLGGTRAVMKKSTKFLPVIGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEY+FL R WAKDE  L +G   L+ +P   W+ALFV
Sbjct  131  SMWFSEYVFLSRDWAKDEKVLKNGYSSLKGFPRTLWVALFV  171



>ref|XP_006421452.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
 gb|ESR34692.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
Length=349

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 109/161 (68%), Gaps = 38/161 (24%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQA+CFV IRPLSKNTYRRINR  AELLWLEL+W+V WWAGVK  
Sbjct  11   PLGLLFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVK--  68

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
                                                RSGCLGSTLAVMKKSSK LPVIGW
Sbjct  69   ------------------------------------RSGCLGSTLAVMKKSSKFLPVIGW  92

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            SMWFSEYLFLER+WAKDE+TL SGLQ+LRDYP PFWLALFV
Sbjct  93   SMWFSEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFV  133



>ref|XP_007015028.1| Lysophosphatidyl acyltransferase 2, putative isoform 2 [Theobroma 
cacao]
 gb|EOY32647.1| Lysophosphatidyl acyltransferase 2, putative isoform 2 [Theobroma 
cacao]
Length=374

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 121/161 (75%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+     ++G   NLIQ  C++ IRPLSK+T+RRIN   +E+LWLEL+WL+ WW+G +VK
Sbjct  11   PLSLMFIFIGTIINLIQVACYLTIRPLSKSTFRRINGAVSEVLWLELVWLMEWWSGCEVK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            L+TD +T +LMGKEHAL++ NH +D D ++ W+LAQR GCL S L + KKS++ LP+ GW
Sbjct  71   LHTDLKTYRLMGKEHALLMPNHVADADTMLVWLLAQRMGCLRSALIISKKSTQYLPIFGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            + WF E++F++R+WAKD + L S  Q L+D+P+PFW+ +F 
Sbjct  131  TTWFYEFIFVDRNWAKDGSKLKSSFQALKDFPIPFWVTIFA  171



>ref|XP_008227143.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Prunus mume]
Length=381

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            NL+QAICF+ IRPLSK+ YR+IN   A LLWL  I L+ WWAG+KVKLYTD ET +LMGK
Sbjct  24   NLLQAICFLTIRPLSKSAYRKINGTVASLLWLVHICLLEWWAGLKVKLYTDLETYRLMGK  83

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
            EHAL++ NH  D D L+G++LAQR GCL S L VMKKS+K LP+ GW+ WF  ++FL RS
Sbjct  84   EHALLMPNHMCDADVLIGFLLAQRLGCLRSALMVMKKSAKYLPIFGWTSWFLGFVFLNRS  143

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            W KDE+ L   LQ L+D+P+PFWL ++ 
Sbjct  144  WEKDESNLKRSLQGLKDFPMPFWLTMYA  171



>ref|XP_002986838.1| hypothetical protein SELMODRAFT_124776 [Selaginella moellendorffii]
 gb|EFJ12168.1| hypothetical protein SELMODRAFT_124776 [Selaginella moellendorffii]
Length=372

 Score =   193 bits (490),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 115/161 (71%), Gaps = 1/161 (1%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  G   NL+Q +C +++ P S+  +R +N    EL   +L+W+V WWAGV+V+
Sbjct  11   PLGLMFFCSGFVVNLLQ-VCSLVLLPFSRGLFRAVNMSLFELASSQLVWMVEWWAGVEVR  69

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +Y D ET K  GKEHAL+ISNH+SDIDWLVGW+ A R GCL  T A+MKKSSK LPVIGW
Sbjct  70   IYADEETRKHFGKEHALIISNHRSDIDWLVGWIFASRVGCLDGTRAIMKKSSKFLPVIGW  129

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             MWF+EY+FLER W KDE TL  G Q+ +++P   W+ALFV
Sbjct  130  GMWFTEYIFLERKWEKDENTLKIGFQRWKNFPRVLWVALFV  170



>ref|XP_002969275.1| hypothetical protein SELMODRAFT_146320 [Selaginella moellendorffii]
 gb|EFJ29363.1| hypothetical protein SELMODRAFT_146320 [Selaginella moellendorffii]
Length=358

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = +2

Query  161  LFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDP  340
             F  G   NL+Q +C +++ P S+  +R +N    EL   +L+W+V WWAGV+V++Y D 
Sbjct  2    FFCSGFVVNLLQ-VCSLVLLPFSRGLFRAVNMSLFELASSQLVWMVEWWAGVEVRIYADE  60

Query  341  ETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFS  520
            ET K  GKEHAL+ISNH+SDIDWLVGW+ A R GCL  T A+MKKSSK LPVIGW MWF+
Sbjct  61   ETRKHFGKEHALIISNHRSDIDWLVGWIFASRVGCLDGTRAIMKKSSKFLPVIGWGMWFT  120

Query  521  EYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            EY+FLER W KDE TL  G Q+ +++P   W+ALFV
Sbjct  121  EYIFLERKWEKDENTLKIGFQRWKNFPRVLWVALFV  156



>ref|XP_006493899.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X1 [Citrus sinensis]
Length=413

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 101/112 (90%), Gaps = 3/112 (3%)
 Frame = +2

Query  293  LVYWWAGVKVKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMK  472
            L +W   +++KL+ D ET +LMGKEHALV+SNHKSDIDWLVGWVL+QRSGCLGSTLAVMK
Sbjct  90   LCFW---LQIKLFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLSQRSGCLGSTLAVMK  146

Query  473  KSSKLLPVIGWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            KSSK LPVIGWSMWFSEYLFLER+W KDE+TL SGLQ+LRDYP PFWLALFV
Sbjct  147  KSSKFLPVIGWSMWFSEYLFLERNWVKDESTLKSGLQRLRDYPQPFWLALFV  198



>ref|XP_008363711.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Malus domestica]
 ref|XP_008363731.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Malus domestica]
Length=169

 Score =   182 bits (462),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 115/158 (73%), Gaps = 1/158 (1%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P G +    GL  NLIQAICF+ IRPLSK+ +R+IN   A  LWL+LIWL+ WW G+KVK
Sbjct  11   PFGLTFLLFGLAINLIQAICFLTIRPLSKSAFRQINGAVASFLWLDLIWLMEWWGGLKVK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LYTD ET +LMGKEHAL++ NH  D D L+G +LA RSGCL S L V+KKSSK LPV GW
Sbjct  71   LYTDLETYRLMGKEHALLMPNHICDADILMGLLLANRSGCLRSALMVVKKSSKYLPVFGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLA  619
            + WF E++FL+RSW KDE+ L     +++ + +P +LA
Sbjct  131  TSWFLEFVFLDRSWEKDESNLKVQFFEMKLF-IPQFLA  167



>ref|XP_002513486.1| 1-acylglycerol-3-phosphate acyltransferase, putative [Ricinus 
communis]
 gb|EEF48889.1| 1-acylglycerol-3-phosphate acyltransferase, putative [Ricinus 
communis]
Length=376

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 112/161 (70%), Gaps = 0/161 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P G    + GL  NLIQ  C++L++PLSK  +RRI     E+LWLE I+L+ WW+G KV 
Sbjct  11   PFGFVFLFSGLIINLIQGACYILVQPLSKTAHRRIIGAVTEILWLEFIFLMDWWSGFKVH  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            L+TD ET +LMGKEHAL++ NH  D D  + W+LAQRS CL   L V+K+SS  +P+ GW
Sbjct  71   LHTDFETYQLMGKEHALLMPNHICDADIFIMWLLAQRSSCLRGALMVVKRSSMYIPIYGW  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            + WF+E++F+ R+W KDE  L S  Q L+D+P PFWL LFV
Sbjct  131  ATWFAEHVFVSRNWGKDEEVLKSRFQSLQDFPRPFWLTLFV  171



>ref|XP_004486965.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X3 [Cicer arietinum]
Length=365

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 111/161 (69%), Gaps = 25/161 (16%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            PVG      GL  N++QAI FVL+RP+S+  YRRIN+V  E LWLELIWLV WWAGVKV+
Sbjct  11   PVGTLFILSGLIVNVLQAIIFVLVRPISRYCYRRINKVLTESLWLELIWLVDWWAGVKVE  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            LY D ET +LMGKE+AL+I NH+SDIDWL+GWVLAQR+GCLG+T+A+MKK  K LPVIG+
Sbjct  71   LYADSETFQLMGKENALLICNHRSDIDWLIGWVLAQRTGCLGNTIAIMKKEVKYLPVIGF  130

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
                                     +QL   P+PFW+ALFV
Sbjct  131  -------------------------KQLEHKPVPFWMALFV  146



>ref|XP_001754626.1| predicted protein [Physcomitrella patens]
 gb|EDQ80596.1| predicted protein [Physcomitrella patens]
Length=554

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G    + GLF N +Q I  + I P S+  YR +N +  E LW EL+WL+ WWAGVKVK
Sbjct  137  PLGLMFIFSGLFINGLQVISVLFILPFSRRAYRVVNMIMMEALWSELVWLLDWWAGVKVK  196

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            +YT  ET + +GKE ALVISNH+SDIDWLVGW++AQR GCLG T AVMKKS+K LPVIGW
Sbjct  197  VYTPRETSEHLGKERALVISNHRSDIDWLVGWIIAQRLGCLGGTRAVMKKSTKFLPVIGW  256

Query  506  SMWFSEYLFLERSWAKDETTL  568
            SMWFSEY+FL R+W KDE  L
Sbjct  257  SMWFSEYVFLSRNWTKDEKVL  277



>gb|EMT23643.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Aegilops 
tauschii]
Length=439

 Score =   184 bits (466),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 109/148 (74%), Gaps = 13/148 (9%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N +QA+ F+ IRP SK  YR+IN   AELLWL+LIWLV WWAG+KV++Y DPET KLM  
Sbjct  24   NTVQAVLFLTIRPFSKRLYRQINVFLAELLWLQLIWLVDWWAGIKVQVYADPETWKLM--  81

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
                V  +     D        QRSGCLGS +A+MKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  82   ----VHYDESPVFD-------GQRSGCLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERS  130

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL SGLQ+L+D+P  FWLALFV
Sbjct  131  WAKDEKTLKSGLQRLKDFPRSFWLALFV  158



>gb|AAF20003.1|AF213937_1 1-acyl-sn-glycerol-3-phosphate acyltransferase [Prunus dulcis]
Length=306

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +2

Query  356  MGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFL  535
            MGKEHALVISNH+SDIDWLVGWVLAQRSGCLGS+LAVMKKSSK LPVIGWSMWFSEYLFL
Sbjct  1    MGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSSLAVMKKSSKFLPVIGWSMWFSEYLFL  60

Query  536  ERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            ERSWAKDE TL SG+Q+L+D+P PFWLALFV
Sbjct  61   ERSWAKDEGTLKSGVQRLKDFPQPFWLALFV  91



>ref|XP_007015027.1| Lysophosphatidyl acyltransferase 2, putative isoform 1 [Theobroma 
cacao]
 gb|EOY32646.1| Lysophosphatidyl acyltransferase 2, putative isoform 1 [Theobroma 
cacao]
Length=367

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 114/161 (71%), Gaps = 7/161 (4%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+     ++G   NLIQ  C++ IRPLSK+T+RRIN   +E+LWLEL+WL+ WW+G    
Sbjct  11   PLSLMFIFIGTIINLIQVACYLTIRPLSKSTFRRINGAVSEVLWLELVWLMEWWSGYL--  68

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
                 +T +LMGKEHAL++ NH +D D ++ W+LAQR GCL S L + KKS++ LP+ GW
Sbjct  69   -----KTYRLMGKEHALLMPNHVADADTMLVWLLAQRMGCLRSALIISKKSTQYLPIFGW  123

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            + WF E++F++R+WAKD + L S  Q L+D+P+PFW+ +F 
Sbjct  124  TTWFYEFIFVDRNWAKDGSKLKSSFQALKDFPIPFWVTIFA  164



>gb|KJB16431.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=301

 Score =   172 bits (437),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +2

Query  356  MGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFL  535
            MGKEHAL++ NH+SDIDWLVGWVLAQRSGCLGS++AVMKKSSK LPVIGWSMWFSEYLFL
Sbjct  1    MGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGWSMWFSEYLFL  60

Query  536  ERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            ERSWAKDE T+ +GLQ+LRDYP PFWLALFV
Sbjct  61   ERSWAKDENTIKAGLQRLRDYPQPFWLALFV  91



>gb|EMS63864.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Triticum 
urartu]
Length=347

 Score =   174 bits (440),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 102/148 (69%), Gaps = 27/148 (18%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGK  364
            N +QA+ F+ IRP SK  YR+IN   AELLWL+LIWLV WWAG+KV++Y DP T KLMG 
Sbjct  24   NTVQAVLFLTIRPFSKRLYRQINVFLAELLWLQLIWLVDWWAGIKVQVYADPATWKLMG-  82

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
                                      CLGS +A+MKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  83   --------------------------CLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERS  116

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL SGLQ+L+D+P  FWLALFV
Sbjct  117  WAKDEKTLKSGLQRLKDFPRSFWLALFV  144



>ref|XP_002314068.2| hypothetical protein POPTR_0009s05930g [Populus trichocarpa]
 gb|EEE88023.2| hypothetical protein POPTR_0009s05930g [Populus trichocarpa]
Length=423

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 115/163 (71%), Gaps = 0/163 (0%)
 Frame = +2

Query  140  YRPVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVK  319
            + P G      G+   +IQA CF++I PLS+NTYRRI     E+L+LE+I+L+ W AG++
Sbjct  10   FMPFGMVFCLTGVLITIIQAACFLIIWPLSRNTYRRIVGAVTEILFLEMIFLMDWLAGLE  69

Query  320  VKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVI  499
            V+L+TD ET +L+GKE+ALV+ NH  D D L+ W+LA+R  CL   L VMKKSSK LP+ 
Sbjct  70   VRLHTDLETYELIGKENALVMPNHICDADVLIMWLLAERFNCLRGALMVMKKSSKYLPIY  129

Query  500  GWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            GW+ WF+  +FL R+WAKDE  L S  Q+L+D+P  FWL +FV
Sbjct  130  GWANWFNGAVFLNRNWAKDEGKLKSSFQELKDFPGSFWLTIFV  172



>gb|ACU18782.1| unknown [Glycine max]
Length=297

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/91 (88%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +2

Query  356  MGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFL  535
            MGKEHALVISNH+ DIDWLVG V AQRSGCLGSTLAVMKKSSK LPVIGWSMWFSEYLFL
Sbjct  1    MGKEHALVISNHRGDIDWLVGRVSAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFL  60

Query  536  ERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            ERSWAKDE+TL SG+Q+L D+PLPFWLALFV
Sbjct  61   ERSWAKDESTLKSGIQRLSDFPLPFWLALFV  91



>gb|AFW60270.1| hypothetical protein ZEAMMB73_783506 [Zea mays]
Length=294

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +2

Query  356  MGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFL  535
            MGKEHALVISNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFL
Sbjct  1    MGKEHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFL  60

Query  536  ERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            ERSWAKDE TL  GLQ+L+D+P PFWLALFV
Sbjct  61   ERSWAKDEKTLKWGLQRLKDFPRPFWLALFV  91



>ref|XP_011025521.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X2 [Populus euphratica]
Length=371

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 116/163 (71%), Gaps = 0/163 (0%)
 Frame = +2

Query  140  YRPVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVK  319
            + P+G      G+  N+IQA CF++I PLSKNTYRRI     E+ +L + +LV W+AG++
Sbjct  10   FLPLGMVFCLTGIAINIIQAACFLIIWPLSKNTYRRIVGAVTEIFFLVMTFLVNWFAGLE  69

Query  320  VKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVI  499
            V L+TD ET +L+GKE+ALV+ NH  D+D L+ W+LA+R  CL   L VMKKSSK LP+ 
Sbjct  70   VHLHTDLETYELIGKENALVMPNHICDVDVLMMWLLAERFNCLRGVLMVMKKSSKYLPIY  129

Query  500  GWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            GW+ WF+  +FL+R+WAKDE  L S  ++L+D+P  FWL +FV
Sbjct  130  GWANWFNGAVFLDRNWAKDEGKLKSSFRELKDFPGSFWLTIFV  172



>ref|XP_011025520.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Populus euphratica]
Length=378

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 116/163 (71%), Gaps = 0/163 (0%)
 Frame = +2

Query  140  YRPVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVK  319
            + P+G      G+  N+IQA CF++I PLSKNTYRRI     E+ +L + +LV W+AG++
Sbjct  10   FLPLGMVFCLTGIAINIIQAACFLIIWPLSKNTYRRIVGAVTEIFFLVMTFLVNWFAGLE  69

Query  320  VKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVI  499
            V L+TD ET +L+GKE+ALV+ NH  D+D L+ W+LA+R  CL   L VMKKSSK LP+ 
Sbjct  70   VHLHTDLETYELIGKENALVMPNHICDVDVLMMWLLAERFNCLRGVLMVMKKSSKYLPIY  129

Query  500  GWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            GW+ WF+  +FL+R+WAKDE  L S  ++L+D+P  FWL +FV
Sbjct  130  GWANWFNGAVFLDRNWAKDEGKLKSSFRELKDFPGSFWLTIFV  172



>tpg|DAA42326.1| TPA: hypothetical protein ZEAMMB73_334173 [Zea mays]
Length=294

 Score =   171 bits (432),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 86/91 (95%), Gaps = 0/91 (0%)
 Frame = +2

Query  356  MGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFL  535
            MGKEHAL+ISNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFL
Sbjct  1    MGKEHALIISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFL  60

Query  536  ERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            ERSWAKDE TL  GLQ+L+D+P PFWLALFV
Sbjct  61   ERSWAKDEKTLKWGLQRLKDFPRPFWLALFV  91



>ref|NP_001068336.2| Os11g0637800 [Oryza sativa Japonica Group]
 dbj|BAF28699.2| Os11g0637800, partial [Oryza sativa Japonica Group]
Length=100

 Score =   164 bits (415),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  359  GKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLE  538
            G EHALVISNH+SDIDWL+GW+LAQRSGCLGSTLAVMKKSSK LPVIGWSMWF+EYLFLE
Sbjct  11   GNEHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLE  70

Query  539  RSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            RSWAKDE TL  GLQ+L+D+P PFWLALFV
Sbjct  71   RSWAKDEKTLKWGLQRLKDFPRPFWLALFV  100



>ref|XP_010672762.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=462

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 106/143 (74%), Gaps = 14/143 (10%)
 Frame = +2

Query  242  RRINRVFAE--LLWLELIWLVYWWAG--VKVKLYTDPETV----------KLMGKEHALV  379
            RR +R  AE  LLW  ++     W G  + + L    E+           +  GKEHALV
Sbjct  100  RRGDRSLAEAQLLWRLMVKPPLIWLGEYIDIGLSEGEESTLSCSLKVSWYQPSGKEHALV  159

Query  380  ISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERSWAKDE  559
            + NHKSDIDWLVGWVLAQR+GCLGSTLAVMKKSSK+LPVIGWSMWFSEYLFLERSWAKDE
Sbjct  160  VCNHKSDIDWLVGWVLAQRAGCLGSTLAVMKKSSKMLPVIGWSMWFSEYLFLERSWAKDE  219

Query  560  TTLXSGLQQLRDYPLPFWLALFV  628
            +T+  GL++L+DYPLPFWLALFV
Sbjct  220  STIKLGLERLKDYPLPFWLALFV  242


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +2

Query  185  NLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLM  358
            N++QA CFVL+RPLSK+TYRRINR+ AELLWLEL+WLV WWA V+VK++TDPET + M
Sbjct  24   NVLQATCFVLVRPLSKSTYRRINRLVAELLWLELVWLVDWWARVQVKVFTDPETFRQM  81



>gb|EYU39879.1| hypothetical protein MIMGU_mgv1a010933mg [Erythranthe guttata]
Length=297

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +2

Query  356  MGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFL  535
            MGKEHALVI NHKSDIDWLVGWVLAQRSGCLGS+ AVMKKS K+LPVIGW+MWFSE+LFL
Sbjct  1    MGKEHALVICNHKSDIDWLVGWVLAQRSGCLGSSFAVMKKSMKVLPVIGWAMWFSEHLFL  60

Query  536  ERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            ERSWA DE+TL SGLQ+L+D+P PFWLALFV
Sbjct  61   ERSWATDESTLKSGLQRLKDFPQPFWLALFV  91



>gb|KCW51192.1| hypothetical protein EUGRSUZ_J00779 [Eucalyptus grandis]
Length=308

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  335  DPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMW  514
            D +T ++MGKEHAL+I NH+SDIDWLVGWV+AQR+GCLGS LA+MKK +K LPV+GWSMW
Sbjct  2    DSQTFEMMGKEHALLICNHRSDIDWLVGWVIAQRAGCLGSALAIMKKEAKFLPVVGWSMW  61

Query  515  FSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            FS+Y+F++R WAKDE TL SG ++L D+P+PFWLALFV
Sbjct  62   FSDYVFVDRCWAKDENTLKSGFERLSDFPMPFWLALFV  99



>gb|KHG13155.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 -like protein 
[Gossypium arboreum]
Length=311

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 106/158 (67%), Gaps = 21/158 (13%)
 Frame = +2

Query  158  SLF-YLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYT  334
            SLF + G+  NLIQ  C++ I P+SK+T+RRIN    ELLWLE++WL+ WW+G +VK++T
Sbjct  14   SLFIFTGILVNLIQVSCYLTIWPVSKSTFRRINGAITELLWLEVVWLMEWWSGFEVKVHT  73

Query  335  DPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMW  514
            D +T +LMGKEHA+++ NH SD D L+ W+LAQ                    V GW+ W
Sbjct  74   DAKTCQLMGKEHAIIMPNHVSDSDTLLTWILAQ--------------------VFGWTNW  113

Query  515  FSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            FSE +FL+R+WAKDE+ L S  + L DYP PFW+ +FV
Sbjct  114  FSESIFLDRNWAKDESKLKSSFEALSDYPTPFWMTIFV  151



>gb|AAP80656.1|AF479037_1 1-acy1-glycerol-3-phosphate acyltransferase, partial [Triticum 
aestivum]
Length=237

 Score =   155 bits (392),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +2

Query  365  EHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERS  544
              AL+ISNH+SDIDWLVGW+LAQRSGCLGS +A+MKKSSK LPVIGWSMWF+EYLFLERS
Sbjct  1    RDALLISNHRSDIDWLVGWILAQRSGCLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERS  60

Query  545  WAKDETTLXSGLQQLRDYPLPFWLALFV  628
            WAKDE TL SGLQ+L+D+P  FWLALFV
Sbjct  61   WAKDEKTLKSGLQRLKDFPRSFWLALFV  88



>gb|KDO61278.1| hypothetical protein CISIN_1g016254mg [Citrus sinensis]
 gb|KDO61279.1| hypothetical protein CISIN_1g016254mg [Citrus sinensis]
Length=309

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +2

Query  356  MGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFL  535
            MGKEHALVI NH+SDIDWLVGWV+AQR GCLGSTLA++KK +K LP IGWSMWFSEY+FL
Sbjct  1    MGKEHALVICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGWSMWFSEYVFL  60

Query  536  ERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            ER W KDE TL SG ++L D+P+PFWLAL+V
Sbjct  61   ERRWNKDEQTLKSGFKRLVDFPMPFWLALYV  91



>ref|XP_006446108.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
 gb|ESR59348.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
Length=310

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +2

Query  356  MGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFL  535
            MGKEHALVI NH+SDIDWLVGWV+AQR GCLGSTLA++KK +K LP IGWSMWFSEY+FL
Sbjct  1    MGKEHALVICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGWSMWFSEYVFL  60

Query  536  ERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            ER W KDE TL SG ++L D+P+PFWLAL+V
Sbjct  61   ERRWNKDEQTLKSGFKRLVDFPMPFWLALYV  91



>ref|XP_008363635.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Malus domestica]
Length=385

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 112/166 (67%), Gaps = 5/166 (3%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            PVG      GL  NL+Q +CF+L+RP+SK  YR+IN++ AELLWLELIWL+ WWAG+K  
Sbjct  11   PVGVLFILSGLIVNLMQIVCFLLVRPVSKRMYRKINKLVAELLWLELIWLIDWWAGIKAC  70

Query  326  LYTD-----PETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLL  490
             +         T  L+    A +  + +S  +    W++ QRSGC GS LA++KK    L
Sbjct  71   FFLKVVHIYAFTSHLLNNIIADLSFSSRSFFEINAQWIVQQRSGCXGSALAIIKKEIMFL  130

Query  491  PVIGWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            PVIGWSMWFSEY+FL+R W KDE TL SG ++L D+P+PFWLALFV
Sbjct  131  PVIGWSMWFSEYVFLQRRWTKDEXTLKSGFRRLEDFPMPFWLALFV  176



>ref|XP_008337106.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Malus domestica]
Length=123

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+G   F  GL  NLIQAICF+LIRPLSKNTYRRINRV AELLWLEL+WL+ WWAGVK++
Sbjct  11   PLGLLFFVSGLXVNLIQAICFILIRPLSKNTYRRINRVVAELLWLELVWLIDWWAGVKIQ  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQ  433
            +YTDPET  LMGKEHALV+ NH+SDIDWLVGWVLAQ
Sbjct  71   VYTDPETFCLMGKEHALVMCNHRSDIDWLVGWVLAQ  106



>ref|XP_002590323.1| hypothetical protein BRAFLDRAFT_121375 [Branchiostoma floridae]
 gb|EEN46334.1| hypothetical protein BRAFLDRAFT_121375 [Branchiostoma floridae]
Length=373

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 103/151 (68%), Gaps = 0/151 (0%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            G+  N+ QA  ++L+RP+S   YR++   F  + W +L++L  WWAG  + +Y     + 
Sbjct  25   GIICNIFQAAGYLLLRPISLTAYRKLAAFFTNMHWSQLVFLNEWWAGSTINMYGTDADIG  84

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
             +GKE+A+++ NHK + D + GW + +R GCLG++ A++K+S K LPV+GW+M+F E+LF
Sbjct  85   RIGKENAVLLMNHKYETDMISGWTVCERFGCLGTSRALIKESVKYLPVVGWTMFFIEFLF  144

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALF  625
            L+R + +D+ T+   L++L++YP  FWL LF
Sbjct  145  LKRDYEEDKRTIIKQLKELQNYPDNFWLLLF  175



>ref|XP_007015029.1| Lysophosphatidyl acyltransferase 2, putative isoform 3 [Theobroma 
cacao]
 gb|EOY32648.1| Lysophosphatidyl acyltransferase 2, putative isoform 3 [Theobroma 
cacao]
Length=338

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 96/161 (60%), Gaps = 36/161 (22%)
 Frame = +2

Query  146  PVGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVK  325
            P+     ++G   NLIQ  C++ IRPLSK+T+RRIN   +E+LWLEL+WL+ WW+G +VK
Sbjct  11   PLSLMFIFIGTIINLIQVACYLTIRPLSKSTFRRINGAVSEVLWLELVWLMEWWSGCEVK  70

Query  326  LYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGW  505
            L+TD +T +LMGKEHAL                                    L+P+ GW
Sbjct  71   LHTDLKTYRLMGKEHAL------------------------------------LMPIFGW  94

Query  506  SMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            + WF E++F++R+WAKD + L S  Q L+D+P+PFW+ +F 
Sbjct  95   TTWFYEFIFVDRNWAKDGSKLKSSFQALKDFPIPFWVTIFA  135



>ref|XP_003419084.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Loxodonta africana]
Length=376

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 98/152 (64%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +++ P++K  YRR+N   A  LW +L+ L+ WW+  +  L+TD  T+ 
Sbjct  25   GLTINFIQ-LCTLILWPVNKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATID  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
             +GKEH ++I NH  +ID+L GW + +R G LGS+  + KK    +P++GW+ +F EY+F
Sbjct  84   RLGKEHVIIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLVGWTWYFLEYVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP PFW  L+ 
Sbjct  144  CKRKWEEDRQTVIEGLKRLSDYPEPFWFLLYC  175



>ref|XP_004364540.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE90348.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Capsaspora owczarzaki 
ATCC 30864]
Length=400

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 97/154 (63%), Gaps = 3/154 (2%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETV-  349
            GL  N++Q +  +L+ P+S   YRR N    ++ W E+IW+  WWAG+KV L +      
Sbjct  50   GLAVNVLQ-LASLLLWPVSPLLYRRFNHTIIQIHWSEMIWVAEWWAGIKVVLSSSSRKAL  108

Query  350  -KLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEY  526
               +G +  + + NH+SD+DWL G VLA++  CLG   A MK ++K LP++GWS WF E+
Sbjct  109  EASIGVDQGVALCNHRSDVDWLFGLVLAEKYNCLGGAKAYMKGNTKFLPILGWSWWFLEF  168

Query  527  LFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            +FL R+W KD++ L S  + L  +PLPFW+ +F 
Sbjct  169  VFLSRAWDKDQSKLASACKSLDGFPLPFWMVIFA  202



>ref|XP_004602547.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Sorex araneus]
Length=362

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 96/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N +Q +C +L+ PL K  YRR+N   A  LW +L+ L+ WW+G +  L+TDP T+ 
Sbjct  25   GLLINALQ-LCSLLLWPLDKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFTDPATLS  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
             +GKEH ++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   RLGKEHVVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLCVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GLQ+L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIQGLQRLSDYPEYMWFLLYC  175



>ref|XP_001944534.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta-like 
[Acyrthosiphon pisum]
Length=386

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 104/175 (59%), Gaps = 6/175 (3%)
 Frame = +2

Query  122  DCSCSCYRPVGRSLFYL-----GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLEL  286
            D S     PV   LF L     GL  NL+Q + F+ + PL+K+ +R+IN  F+ +++ EL
Sbjct  4    DMSSIKSSPVTHVLFTLVFLVSGLTVNLLQLLFFITLWPLNKDLFRKINYYFSYIIYSEL  63

Query  287  IWLVYWWAGVKVKLYTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQR-SGCLGSTLA  463
            ++L  WWAG+    Y + E  K  GKEHA+ I NHK +IDWL  WV+  R  G LG+  A
Sbjct  64   VFLSDWWAGIPYYFYINKEDYKFFGKEHAIFIINHKYEIDWLTAWVVHDRIGGILGNCKA  123

Query  464  VMKKSSKLLPVIGWSMWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
              K S K +PVIGW+ WF E+LFL+R   KD+ T+ + L +L ++  P  + L+ 
Sbjct  124  FAKNSLKYMPVIGWAWWFGEFLFLQRDLVKDKHTIETKLGKLFEHGNPVTMLLYA  178



>emb|CAX11992.1| 1-acylglycerol-3-phosphate O-acyltransferase 3, partial [Danio 
rerio]
Length=221

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 91/152 (60%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N  Q +C  ++ P  K  YRRIN   +  LW +L+ L+ WW+G +  LYTD  TV 
Sbjct  25   GLIINFTQ-LCTCVLWPFDKQLYRRINTRLSYSLWSQLVMLLEWWSGTECTLYTDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  ++D+L GW + +R G LGS+  + K     +P+IGW+ +F E +F
Sbjct  84   KFGKEHVIIILNHNFEVDFLCGWTICERYGVLGSSKVLAKHELLKVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+ SGL +LRDYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVFSGLSRLRDYPEYMWFLLYC  175



>ref|XP_001745510.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89481.1| predicted protein [Monosiga brevicollis MX1]
Length=367

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 87/135 (64%), Gaps = 0/135 (0%)
 Frame = +2

Query  224  LSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKLMGKEHALVISNHKSDI  403
             S+  YR  N    +L W EL+W++  W+G ++ +Y   E ++LMG E ++ + NH S++
Sbjct  36   FSRKHYRLANSAIVQLYWTELLWMLEQWSGCRLVVYGKDEDLELMGTESSVALCNHVSNV  95

Query  404  DWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFLERSWAKDETTLXSGLQ  583
            DWL+GW+LA + G LG    ++KK    LPV+GWS WF EY ++ R+W KDE  +  GL 
Sbjct  96   DWLIGWLLADKFGVLGGAKCLLKKDLAFLPVLGWSWWFLEYTYISRNWEKDEKKIHQGLS  155

Query  584  QLRDYPLPFWLALFV  628
            +L+DYPLPFW  ++ 
Sbjct  156  RLQDYPLPFWEVIYA  170



>ref|XP_005427279.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Geospiza fortis]
Length=376

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 96/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +L+ PL+K  YRR+N   A  LW +L+ L+ WW+G +  L++D  TVK
Sbjct  25   GLIINFIQ-LCTLLLWPLNKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVK  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYC  175



>ref|XP_005037280.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Ficedula albicollis]
 ref|XP_005037281.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Ficedula albicollis]
 ref|XP_005037282.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X3 [Ficedula albicollis]
 ref|XP_005037283.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X4 [Ficedula albicollis]
 ref|XP_005037284.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X5 [Ficedula albicollis]
 ref|XP_005037285.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X6 [Ficedula albicollis]
 ref|XP_005037286.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X7 [Ficedula albicollis]
 ref|XP_005037287.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X8 [Ficedula albicollis]
Length=376

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 96/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +L+ PL+K  YRR+N   A  LW +L+ L+ WW+G +  L++D  TVK
Sbjct  25   GLIINFIQ-LCTLLLWPLNKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVK  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYC  175



>ref|XP_005037288.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X9 [Ficedula albicollis]
Length=376

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 96/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +L+ PL+K  YRR+N   A  LW +L+ L+ WW+G +  L++D  TVK
Sbjct  25   GLIINFIQ-LCTLLLWPLNKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVK  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYC  175



>ref|XP_007251394.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Astyanax mexicanus]
 ref|XP_007251395.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X2 [Astyanax mexicanus]
 ref|XP_007251396.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X3 [Astyanax mexicanus]
Length=377

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 91/152 (60%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C  +I P +K  YR+ N   +  LW +L+ L+ WW+G    LYTD  TV 
Sbjct  25   GLIINFIQ-LCSCVIWPFNKQLYRKFNTRMSYSLWSQLVMLLEWWSGTDCTLYTDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
            + GKEH ++I NH  +ID+L GW + +R G LGS+  + K     +P+IGW+ +F E +F
Sbjct  84   MFGKEHVIIILNHNFEIDFLCGWTMCERYGVLGSSKVLAKHELLKVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL QLRDYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVFKGLHQLRDYPEYMWFLLYC  175



>ref|NP_001279132.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 [Callorhinchus 
milii]
 gb|AFM90035.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like protein 
[Callorhinchus milii]
 gb|AFM90356.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like protein 
[Callorhinchus milii]
Length=376

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GLF N IQ +C +L+ P++K  YR++N   A  LW +L+ L+ +W+G +  L++D  TV 
Sbjct  25   GLFINFIQ-LCTLLLWPINKQLYRKLNCRLAYALWSQLVMLLEFWSGTECTLFSDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEHA++I NH  ++D+L GW + +R G LGS+  + KK    +P+IGW+ +F E +F
Sbjct  84   KFGKEHAIIILNHNFELDFLCGWTMCERYGVLGSSKVLAKKELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D+ T+ SGL+ L+DYP   W  L+ 
Sbjct  144  CKRRWEEDKDTVLSGLRSLQDYPESMWFLLYC  175



>gb|AFM88716.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like protein 
[Callorhinchus milii]
Length=376

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GLF N IQ +C +L+ P++K  YR++N   A  LW +L+ L+ +W+G +  L++D  TV 
Sbjct  25   GLFINFIQ-LCTLLLWPINKQLYRKLNCRLAYALWSQLVMLLEFWSGTECTLFSDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEHA++I NH  ++D+L GW + +R G LGS+  + KK    +P+IGW+ +F E +F
Sbjct  84   KFGKEHAIIILNHNFELDFLCGWTMCERYGVLGSSKVLAKKELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D+ T+ SGL+ L+DYP   W  L+ 
Sbjct  144  CKRRWEEDKDTVLSGLRSLQDYPESMWFLLYC  175



>ref|XP_009071880.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Acanthisitta chloris]
 gb|KFP79366.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Acanthisitta 
chloris]
Length=256

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 95/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +++ P++K  YRR+N   A  LW +L+ L+ WW+G +  L++D  TV 
Sbjct  25   GLIINFIQ-LCTLVLWPINKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVN  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYC  175



>ref|XP_006109547.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like, 
partial [Myotis lucifugus]
Length=204

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 96/151 (64%), Gaps = 1/151 (1%)
 Frame = +2

Query  176  LFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVKL  355
            L  N IQ +C +++ PL+K  YRR+N   A  LW +L+ L+ WW+  +  L++D  T+  
Sbjct  33   LVINFIQ-LCTLVLWPLNKQLYRRLNCRLAYSLWSQLVMLLEWWSCTQCTLFSDQATIDC  91

Query  356  MGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLFL  535
            +GKEHA++I NH  +ID+L GW + +R G LGS+ A+ K+    +P+IGW+ +F E +F 
Sbjct  92   LGKEHAIIILNHNFEIDFLCGWTMCERFGVLGSSKALAKRELLCVPLIGWTWYFLEIVFC  151

Query  536  ERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            +R W +D  T+ +GL+ L DYP   W  L+ 
Sbjct  152  KRKWEEDRDTVMAGLRCLADYPEYMWFLLYC  182



>ref|XP_010127144.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Chlamydotis macqueenii]
 gb|KFP45955.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Chlamydotis 
macqueenii]
Length=256

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 95/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +++ P++K  YRR+N   A  LW +L+ L+ WW+G +  L++D  TV 
Sbjct  25   GLIINFIQ-LCTLVLWPINKQFYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVN  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYC  175



>ref|XP_008327138.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Cynoglossus semilaevis]
Length=377

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 95/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C  ++ P++K  YRRIN   +  LW +L+ L+ WW+G +  LYTD  TV 
Sbjct  25   GLIINFIQ-LCTCILWPINKQLYRRINCRLSYSLWSQLVMLLEWWSGTECTLYTDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH +VI NH  +ID+L GW + +R G LGS+  + K     +P+IGW+ +F E +F
Sbjct  84   KFGKEHVIVILNHNYEIDFLCGWTMCERFGILGSSKVLAKHELLKVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D+ T+ SGL +L+DYP   W  L+ 
Sbjct  144  CKRRWEEDKKTVFSGLNRLKDYPEFMWFLLYC  175



>ref|XP_008939552.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Merops nubicus]
 ref|XP_009695017.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Cariama cristata]
 gb|KFP57188.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Cariama 
cristata]
 gb|KFQ30670.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Merops 
nubicus]
Length=256

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 95/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +++ P++K  YRR+N   A  LW +L+ L+ WW+G +  L++D  TV 
Sbjct  25   GLIINFIQ-LCTLVLWPINKQFYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVN  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIEGLKRLADYPEYMWFLLYC  175



>ref|XP_005489059.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Zonotrichia albicollis]
 ref|XP_005489060.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Zonotrichia albicollis]
Length=376

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 96/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +L+ P++K  YRR+N   A  LW +L+ L+ WW+G +  L++D  TVK
Sbjct  25   GLIINFIQ-LCTLLLWPINKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVK  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYC  175



>ref|XP_009087839.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Serinus canaria]
Length=376

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 96/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +L+ P++K  YRR+N   A  LW +L+ L+ WW+G +  L++D  TVK
Sbjct  25   GLIINFIQ-LCTLLLWPINKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVK  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYC  175



>ref|XP_006922611.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Pteropus alecto]
Length=376

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 96/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +++ P++K  YRR+N   A  LW +L+ L+ WW+  +  L+TD  TV+
Sbjct  25   GLIINFIQ-LCTLVLWPVNKQLYRRLNCRLAYSLWSQLVMLLEWWSRTECTLFTDQATVR  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
             +GKEHA++I NH  +ID+L GW + +R G LGS+  + K+    +PVIGW+ +F E +F
Sbjct  84   RLGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLCVPVIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
              R W +D  T+  GLQ+L DYP   W  L+ 
Sbjct  144  CRRRWEEDRDTVVRGLQRLADYPEYMWFLLYC  175



>gb|KDR11829.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Zootermopsis 
nevadensis]
Length=398

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 97/158 (61%), Gaps = 1/158 (1%)
 Frame = +2

Query  158  SLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTD  337
            + F  GL  NLIQA+ +  +RP SK  YR+IN      L+ +L+++  WWA   + +Y D
Sbjct  21   TFFVSGLIINLIQALLYCGLRPFSKYLYRKINYYVCYSLYCQLVFMAEWWASTDLIIYID  80

Query  338  PETV-KLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMW  514
             E + +  GKEH  +I NH+ ++DWL+GWVL  R   LG+     KKS + +P +GW+  
Sbjct  81   KEDLERYYGKEHGFLIMNHRYEVDWLMGWVLCDRVNILGNCKTYAKKSIQYVPTMGWAWM  140

Query  515  FSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
            F+E +FLER+W KD+ T+   +++L ++P P WL L  
Sbjct  141  FAESVFLERNWEKDKETIGRQIKELVEHPDPIWLLLMA  178



>ref|XP_008275417.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Stegastes partitus]
 ref|XP_008275418.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Stegastes partitus]
Length=377

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 94/152 (62%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C  ++ P++K  YRRIN   +  LW +L+ L+ WW+G    LYTD  TV 
Sbjct  25   GLIINFIQ-LCTCVLWPINKQLYRRINCRLSYSLWSQLVMLLEWWSGTDCTLYTDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEHA++I NH  +ID+L GW + +R G LGS+  + K     +P+IGW+ +F E +F
Sbjct  84   KFGKEHAIIILNHNFEIDFLCGWTMCERYGVLGSSKVLAKHELLKVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+ +GL +L+DYP   W  L+ 
Sbjct  144  CKRKWEEDRNTVFTGLGRLKDYPEYMWFLLYC  175



>ref|XP_006608633.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X2 [Apis dorsata]
Length=371

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 91/149 (61%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  SLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTD  337
            + F  GL TN  Q   +  +RP S+  YR+IN       + +L++L+ WW+G    LY D
Sbjct  38   TFFTTGLITNFFQCFLYFGLRPFSRYCYRKINYYLCYSFYTQLVFLIEWWSGSDFILYMD  97

Query  338  PETV-KLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMW  514
               + K  G+EH  ++ NH  +IDWL+GWVL +R G LG+  A +KKS + +P +GW   
Sbjct  98   RNDLEKHFGEEHGYILMNHSYEIDWLIGWVLCERKGILGNCKAYVKKSLQYIPTLGWGWK  157

Query  515  FSEYLFLERSWAKDETTLXSGLQQLRDYP  601
            FSEY+FLER+W KD+  + S +++  +YP
Sbjct  158  FSEYIFLERNWEKDKEIIRSQIREFGNYP  186



>gb|ADO27983.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Ictalurus 
furcatus]
Length=377

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 94/152 (62%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C  ++ P +K  YRRI+   +  LW +L+ L+ WW+G +  LYTD  TV 
Sbjct  25   GLIINFIQ-LCTCVLWPFNKQLYRRIDTRMSYSLWSQLVMLLEWWSGTECVLYTDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   QFGKEHVIIILNHNYEIDFLCGWTMCERYGVLGSSKVLAKRELLKVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+ +GL QL+DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVFNGLSQLKDYPEYMWFLLYC  175



>ref|XP_001621942.1| predicted protein [Nematostella vectensis]
 gb|EDO29842.1| predicted protein [Nematostella vectensis]
Length=385

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 95/153 (62%), Gaps = 3/153 (2%)
 Frame = +2

Query  176  LFTNLIQAICFVLIRPL---SKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPET  346
            L T +I  I  V I PL   +K  YR IN     L W +L +LV WW+   ++LY + E 
Sbjct  23   LITGMIINIIQVAILPLWTFNKTLYRWINMHVVYLHWSQLTFLVDWWSETDLRLYGNEED  82

Query  347  VKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEY  526
             +  GKE A+ ++NH+SD+DWL+GWV+A R   LG+T   MK   K LP++G+S   SEY
Sbjct  83   FRYFGKESAICVANHRSDVDWLIGWVMADRVDTLGTTKCYMKGYLKYLPIMGFSWLSSEY  142

Query  527  LFLERSWAKDETTLXSGLQQLRDYPLPFWLALF  625
             F+ R+W KD+  L + L  L+D+P PFW+A+F
Sbjct  143  AFVSRNWQKDQRVLQNSLDTLQDFPYPFWIAIF  175



>ref|XP_008498571.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Calypte anna]
 gb|KFP05918.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Calypte 
anna]
Length=376

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 96/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +++ P++K  YRR+N   A  LW +L+ L+ WW+G +  L++D  TVK
Sbjct  25   GLIINFIQ-LCTLVLWPVNKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVK  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + KK    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIEGLKRLADYPEYMWFLLYC  175



>ref|XP_006724095.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X6 [Homo sapiens]
Length=265

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 97/160 (61%), Gaps = 1/160 (1%)
 Frame = +2

Query  149  VGRSLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKL  328
            VG      GL  N +Q +C + + P+SK  YRR+N   A  LW +L+ L+ WW+  +  L
Sbjct  17   VGFVFVVSGLVINFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTL  75

Query  329  YTDPETVKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWS  508
            +TD  TV+  GKEHA++I NH  +ID+L GW + +R G LGS+  + KK    +P+IGW+
Sbjct  76   FTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWT  135

Query  509  MWFSEYLFLERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +F E +F +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  136  WYFLEIVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLLYC  175



>ref|XP_011374681.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Pteropus vampyrus]
Length=333

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 95/149 (64%), Gaps = 1/149 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +++ P++K  YRR+N   A  LW +L+ L+ WW+  +  L+TD  TV+
Sbjct  25   GLIINFIQ-LCTLVLWPVNKQLYRRLNCRLAYSLWSQLVMLLEWWSRTECTLFTDQATVR  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
             +GKEHA++I NH  +ID+L GW + +R G LGS+  + K+    +PVIGW+ +F E +F
Sbjct  84   CLGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLCVPVIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLA  619
              R W +D  T+  GLQ+L DYP   W+ 
Sbjct  144  CRRRWEEDRDTVVRGLQRLADYPEYMWVC  172



>gb|KFP28149.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma, partial 
[Colius striatus]
Length=281

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 95/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +++ P++K  YRR+N   A  LW +L+ L+ WW+G +  L++D  TV 
Sbjct  25   GLIINFIQ-LCTLVLWPINKQFYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVN  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYC  175



>ref|XP_010206239.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Colius striatus]
Length=289

 Score =   130 bits (327),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 95/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +++ P++K  YRR+N   A  LW +L+ L+ WW+G +  L++D  TV 
Sbjct  25   GLIINFIQ-LCTLVLWPINKQFYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVN  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYC  175



>ref|XP_004384856.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Trichechus manatus latirostris]
Length=376

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 95/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N +Q +C +++ P++K  YRR N   A  LW +L+ L+ WW+  +  L+TD  TV 
Sbjct  25   GLAINFLQ-LCTLVLWPVNKQLYRRFNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + KK    +P+IGW+ +F E++F
Sbjct  84   HFGKEHVIIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEFVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP P W  L+ 
Sbjct  144  CKRKWEEDRQTVIEGLKRLSDYPEPLWFLLYC  175



>gb|ACY30369.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 [Salmo salar]
Length=377

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 93/152 (61%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +  VL  PL+K  YRRIN   +  LW +L+ L+ WW+G +  LYTD  TV 
Sbjct  25   GLLINFIQLLTCVLW-PLNKQLYRRINTRLSYSLWSQLVMLLEWWSGTQCTLYTDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K     +P+IGW+ +F E +F
Sbjct  84   KFGKEHVIIILNHNYEIDFLCGWTICERYGVLGSSKVLAKHELLKVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++LRDYP   W  L+ 
Sbjct  144  CKRKWEEDRETVFRGLERLRDYPEFMWFLLYC  175



>ref|XP_002189743.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Taeniopygia guttata]
 ref|XP_005526574.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Pseudopodoces humilis]
Length=376

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 96/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +++ P++K  YRR+N   A  LW +L+ L+ WW+G +  L++D  TVK
Sbjct  25   GLIINFIQ-LCTLVLWPINKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVK  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYC  175



>ref|XP_008631063.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Corvus brachyrhynchos]
 ref|XP_010392907.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Corvus cornix cornix]
 ref|XP_010392908.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Corvus cornix cornix]
 gb|KFO58491.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Corvus 
brachyrhynchos]
Length=376

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 96/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +++ P++K  YRR+N   A  LW +L+ L+ WW+G +  L++D  TVK
Sbjct  25   GLIINFIQ-LCTLVLWPINKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVK  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYC  175



>ref|XP_010884320.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Esox lucius]
Length=377

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 94/152 (62%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C  ++ PL++  YR+IN   +  LW +L+ L+ WW+G +  L+TD  TV 
Sbjct  25   GLIINFIQ-LCTCVLWPLNRQLYRKINTRLSYSLWSQLVMLLEWWSGTECTLFTDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEHA++I NH  +ID+L GW + +R G LGS+  + K     +P+IGW+ +F E +F
Sbjct  84   KFGKEHAIIILNHNYEIDFLCGWTMCERYGVLGSSKVLAKYDLLKVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL QL+DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVFKGLNQLKDYPEFMWFLLYC  175



>ref|XP_006608632.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Apis dorsata]
Length=404

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 91/149 (61%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  SLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTD  337
            + F  GL TN  Q   +  +RP S+  YR+IN       + +L++L+ WW+G    LY D
Sbjct  38   TFFTTGLITNFFQCFLYFGLRPFSRYCYRKINYYLCYSFYTQLVFLIEWWSGSDFILYMD  97

Query  338  PETV-KLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMW  514
               + K  G+EH  ++ NH  +IDWL+GWVL +R G LG+  A +KKS + +P +GW   
Sbjct  98   RNDLEKHFGEEHGYILMNHSYEIDWLIGWVLCERKGILGNCKAYVKKSLQYIPTLGWGWK  157

Query  515  FSEYLFLERSWAKDETTLXSGLQQLRDYP  601
            FSEY+FLER+W KD+  + S +++  +YP
Sbjct  158  FSEYIFLERNWEKDKEIIRSQIREFGNYP  186



>ref|XP_009996223.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Chaetura pelagica]
 gb|KFU84109.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Chaetura 
pelagica]
Length=376

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 95/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +++ P++K  YRRIN   A  LW +L+ L+ WW+G +  L++D  TV 
Sbjct  25   GLIINFIQ-LCTLVLWPINKQFYRRINCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVN  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + KK    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYC  175



>ref|XP_006639021.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Lepisosteus oculatus]
Length=376

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 96/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +++ P++K  YRR+N   +  LW +L+ L+ WW+G K  L+TD  TV 
Sbjct  25   GLIINFIQ-LCTLVLWPVNKQLYRRVNCRLSYSLWSQLVMLLEWWSGTKCTLFTDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEHA++I NH  +ID+L GW + +R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   KFGKEHAIIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKQELLKVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D   + SGL+ L DYP   W+ L+ 
Sbjct  144  CKRKWEEDRDKVISGLKNLADYPECMWILLYC  175



>ref|XP_010739293.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Larimichthys crocea]
Length=377

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 92/152 (61%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C  ++ P++K  YRRIN   +  LW +L+ L+ WW+G    LYTD  TV 
Sbjct  25   GLIINFIQ-LCTCILWPINKQLYRRINCRLSYSLWSQLVMLLEWWSGTDCTLYTDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH +VI NH  +ID+L GW + +R G LGS+  + K     +P+IGW+ +F E +F
Sbjct  84   KFGKEHVIVILNHNFEIDFLCGWTMCERFGVLGSSKVLAKHELLKVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL +L+DYP   W  L+ 
Sbjct  144  CKRKWEEDRKTVFKGLSRLKDYPECMWFLLYC  175



>ref|XP_003689806.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Apis florea]
Length=404

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 91/149 (61%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  SLFYLGLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTD  337
            + F  GL TN  Q   +  +RP S+  YR+IN       + +L++L+ WW+G    LY D
Sbjct  38   TFFTTGLITNFFQCFLYFGLRPFSRYCYRKINYYLCYSFYTQLVFLIEWWSGSDFILYMD  97

Query  338  PETV-KLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMW  514
               + K  G+EH  ++ NH  ++DWL+GWVL +R G LG+  A +KKS + +P +GW   
Sbjct  98   KNDLEKHFGEEHGYILMNHSYEVDWLIGWVLCERKGILGNCKAYVKKSLQYIPTLGWGWK  157

Query  515  FSEYLFLERSWAKDETTLXSGLQQLRDYP  601
            FSEY+FLER+W KD+  + S +++  +YP
Sbjct  158  FSEYIFLERNWEKDKEIIRSQIREFGNYP  186



>ref|XP_007557237.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Poecilia formosa]
 ref|XP_007557238.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Poecilia formosa]
 ref|XP_007557239.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Poecilia formosa]
Length=377

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 95/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C  ++ P+++  YRRIN   +  LW +L+ ++ WW+G +  LYTD  TV 
Sbjct  25   GLIINFIQ-LCTCILWPINRQLYRRINCRLSYSLWSQLVMMLEWWSGTECTLYTDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH +VI NH  +ID+L GW + +R G LGS+  + K     +P+IGW+ +F E +F
Sbjct  84   KFGKEHVIVILNHNFEIDFLCGWTMCERYGVLGSSKVLAKHELLKVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D+ T+ +GL +L+DYP   W  L+ 
Sbjct  144  CKRKWEEDKETVFAGLDRLKDYPEYMWFLLYC  175



>ref|NP_998590.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Danio rerio]
 ref|XP_005171033.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Danio rerio]
 ref|XP_005171034.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Danio rerio]
 ref|XP_005171035.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Danio rerio]
 ref|XP_009292100.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Danio rerio]
 ref|XP_009292101.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Danio rerio]
 ref|XP_009292112.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Danio rerio]
 ref|XP_009292116.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Danio rerio]
 gb|AAH49474.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 [Danio rerio]
 emb|CAX11990.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 [Danio rerio]
Length=377

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 91/152 (60%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N  Q +C  ++ P  K  YRRIN   +  LW +L+ L+ WW+G +  LYTD  TV 
Sbjct  25   GLIINFTQ-LCTCVLWPFDKQLYRRINTRLSYSLWSQLVMLLEWWSGTECTLYTDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  ++D+L GW + +R G LGS+  + K     +P+IGW+ +F E +F
Sbjct  84   KFGKEHVIIILNHNFEVDFLCGWTICERYGVLGSSKVLAKHELLKVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+ SGL +LRDYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVFSGLSRLRDYPEYMWFLLYC  175



>ref|XP_003434035.1| PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-glycerol-3-phosphate 
acyltransferase gamma [Canis lupus familiaris]
Length=376

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 96/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N +Q +C +++RP++K  YRR+    A  LW +L+ L+ WW+G +  L+TD  TV 
Sbjct  25   GLLINFVQ-LCTLVLRPINKQLYRRLXCRLAYSLWSQLVMLLEWWSGTECTLFTDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW +++R G LGS+  + K+    +P+IGW+ +F E +F
Sbjct  84   RFGKEHVVIILNHNFEIDFLCGWTMSERFGMLGSSQVLAKRELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+  GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIQGLKRLSDYPEYMWFLLYC  175



>ref|XP_006799219.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Neolamprologus brichardi]
Length=360

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 93/151 (62%), Gaps = 1/151 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C  ++ P+++  YRRIN   +  LW +L+ L+ WW+G +  LYTD  TV 
Sbjct  25   GLIINFIQ-LCTCILWPINRQLYRRINCRLSYSLWSQLVMLLEWWSGTECTLYTDQATVD  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + K     +P+IGW+ +F E +F
Sbjct  84   KFGKEHVIIILNHNFEIDFLCGWTMCERYGVLGSSKVLAKHELLKVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALF  625
             +R W +D  T+  GL +L+DYP   W  L+
Sbjct  144  CKRKWEEDRNTVFKGLDRLKDYPEYMWFLLY  174



>ref|XP_005501703.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Columba livia]
 ref|XP_005501704.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Columba livia]
 ref|XP_005501705.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X3 [Columba livia]
 gb|EMC79519.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Columba 
livia]
Length=376

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 96/152 (63%), Gaps = 1/152 (1%)
 Frame = +2

Query  173  GLFTNLIQAICFVLIRPLSKNTYRRINRVFAELLWLELIWLVYWWAGVKVKLYTDPETVK  352
            GL  N IQ +C +++ P++K  YRR+N   A  LW +L+ L+ WW+G +  L++D  TV 
Sbjct  25   GLIINFIQ-LCTLVLWPINKQFYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSDEATVN  83

Query  353  LMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWFSEYLF  532
              GKEH ++I NH  +ID+L GW + +R G LGS+  + KK    +P+IGW+ +F E +F
Sbjct  84   TFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVF  143

Query  533  LERSWAKDETTLXSGLQQLRDYPLPFWLALFV  628
             +R W +D  T+ +GL++L DYP   W  L+ 
Sbjct  144  CKRKWEEDRDTVIAGLKRLADYPEYMWFLLYC  175



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250