BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF049P02

Length=591
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783020.1|  PREDICTED: endoglucanase 2                         144   9e-37   Nicotiana sylvestris
ref|XP_009610927.1|  PREDICTED: endoglucanase 2-like                    142   3e-36   Nicotiana tomentosiformis
emb|CDP07412.1|  unnamed protein product                                139   7e-35   Coffea canephora [robusta coffee]
gb|AGV22125.1|  endo-1,4-beta-glucanase 3                               135   8e-34   Betula luminifera [liang ye hua]
ref|XP_003527686.1|  PREDICTED: endoglucanase 10-like                   134   2e-33   Glycine max [soybeans]
ref|XP_004238345.1|  PREDICTED: endoglucanase 2-like                    134   3e-33   Solanum lycopersicum
ref|XP_003523541.1|  PREDICTED: endoglucanase 10                        134   4e-33   Glycine max [soybeans]
ref|XP_003603741.1|  Endoglucanase                                      132   2e-32   
gb|AES73992.2|  glycosyl hydrolase family 9 protein                     132   2e-32   Medicago truncatula
ref|XP_007136082.1|  hypothetical protein PHAVU_009G016100g             130   5e-32   Phaseolus vulgaris [French bean]
ref|XP_010104437.1|  Endoglucanase 24                                   130   1e-31   Morus notabilis
ref|XP_004136389.1|  PREDICTED: endoglucanase 2-like                    129   2e-31   Cucumis sativus [cucumbers]
ref|XP_008466493.1|  PREDICTED: endoglucanase 10                        128   3e-31   Cucumis melo [Oriental melon]
ref|XP_006302134.1|  hypothetical protein CARUB_v10020139mg             128   3e-31   Capsella rubella
gb|KHF97947.1|  hypothetical protein F383_10892                         127   6e-31   Gossypium arboreum [tree cotton]
gb|KJB58118.1|  hypothetical protein B456_009G195400                    127   8e-31   Gossypium raimondii
gb|ADU15552.1|  EG                                                      127   8e-31   Gossypium hirsutum [American cotton]
gb|AID55377.1|  glycoside hydrolase family 9 B5                         127   9e-31   Gossypium hirsutum [American cotton]
ref|XP_010244092.1|  PREDICTED: endoglucanase 24-like                   126   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_008364934.1|  PREDICTED: endoglucanase 10-like                   125   4e-30   
ref|XP_006342034.1|  PREDICTED: endoglucanase 10-like                   124   6e-30   Solanum tuberosum [potatoes]
ref|XP_007017777.1|  EG isoform 3                                       123   6e-30   
ref|XP_009335173.1|  PREDICTED: endoglucanase 2-like                    124   6e-30   
ref|XP_010539853.1|  PREDICTED: endoglucanase 10                        124   9e-30   Tarenaya hassleriana [spider flower]
ref|XP_004500948.1|  PREDICTED: endoglucanase 10-like                   124   1e-29   Cicer arietinum [garbanzo]
ref|XP_010667385.1|  PREDICTED: endoglucanase 2-like                    124   1e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009103373.1|  PREDICTED: endoglucanase 2                         124   2e-29   Brassica rapa
emb|CDY66396.1|  BnaAnng22170D                                          124   2e-29   Brassica napus [oilseed rape]
ref|XP_010471690.1|  PREDICTED: endoglucanase 10                        123   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010416457.1|  PREDICTED: endoglucanase 10-like                   123   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_007017775.1|  EG isoform 1                                       122   3e-29   
ref|XP_007017776.1|  EG isoform 2                                       122   3e-29   Theobroma cacao [chocolate]
ref|XP_010428595.1|  PREDICTED: endoglucanase 10-like                   122   3e-29   Camelina sativa [gold-of-pleasure]
gb|EPS64495.1|  hypothetical protein M569_10284                         122   4e-29   Genlisea aurea
ref|XP_008387935.1|  PREDICTED: endoglucanase 2                         122   6e-29   Malus domestica [apple tree]
gb|EYU36779.1|  hypothetical protein MIMGU_mgv1a004472mg                122   6e-29   Erythranthe guttata [common monkey flower]
ref|XP_009128120.1|  PREDICTED: endoglucanase 10                        122   7e-29   Brassica rapa
ref|XP_011074667.1|  PREDICTED: endoglucanase 10-like                   122   7e-29   Sesamum indicum [beniseed]
dbj|BAF42037.1|  cellulase2                                             122   7e-29   Pyrus communis
ref|XP_010536354.1|  PREDICTED: endoglucanase 10-like                   122   7e-29   Tarenaya hassleriana [spider flower]
ref|XP_008221286.1|  PREDICTED: endoglucanase 10-like                   122   7e-29   Prunus mume [ume]
emb|CDY43425.1|  BnaC07g14920D                                          121   9e-29   Brassica napus [oilseed rape]
gb|EYU38839.1|  hypothetical protein MIMGU_mgv1a004578mg                121   1e-28   Erythranthe guttata [common monkey flower]
emb|CDY39048.1|  BnaA02g17370D                                          121   1e-28   Brassica napus [oilseed rape]
ref|XP_002889037.1|  hypothetical protein ARALYDRAFT_895440             120   2e-28   Arabidopsis lyrata subsp. lyrata
gb|KFK44119.1|  hypothetical protein AALP_AA1G218000                    120   2e-28   Arabis alpina [alpine rockcress]
ref|XP_010459672.1|  PREDICTED: endoglucanase 2                         120   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010061046.1|  PREDICTED: endoglucanase 10-like                   120   4e-28   Eucalyptus grandis [rose gum]
ref|XP_002276739.1|  PREDICTED: endoglucanase 10                        119   4e-28   Vitis vinifera
emb|CDY13546.1|  BnaC02g23570D                                          119   5e-28   Brassica napus [oilseed rape]
ref|XP_010501531.1|  PREDICTED: endoglucanase 2                         119   5e-28   
ref|XP_006390284.1|  hypothetical protein EUTSA_v10018397mg             119   7e-28   Eutrema salsugineum [saltwater cress]
emb|CDX73186.1|  BnaC06g36340D                                          118   1e-27   
ref|XP_010649048.1|  PREDICTED: endoglucanase 24-like                   118   1e-27   Vitis vinifera
gb|AAM63477.1|  endo-beta-1,4-glucanase, putative                       117   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011100152.1|  PREDICTED: endoglucanase 24-like                   117   2e-27   
ref|XP_010477219.1|  PREDICTED: endoglucanase 2-like                    117   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_002510516.1|  endo-1,4-beta-glucanase, putative                  117   3e-27   Ricinus communis
ref|XP_007046716.1|  EG                                                 117   3e-27   
ref|XP_004291374.1|  PREDICTED: endoglucanase 10-like                   117   3e-27   Fragaria vesca subsp. vesca
ref|XP_006435157.1|  hypothetical protein CICLE_v10000849mg             117   3e-27   Citrus clementina [clementine]
gb|KDO84820.1|  hypothetical protein CISIN_1g009846mg                   117   3e-27   Citrus sinensis [apfelsine]
ref|XP_006473639.1|  PREDICTED: endoglucanase 10-like                   117   3e-27   Citrus sinensis [apfelsine]
ref|XP_006416450.1|  hypothetical protein EUTSA_v10007364mg             116   5e-27   Eutrema salsugineum [saltwater cress]
emb|CDY29381.1|  BnaA06g14150D                                          117   5e-27   Brassica napus [oilseed rape]
ref|XP_009106216.1|  PREDICTED: endoglucanase 10-like                   115   1e-26   Brassica rapa
ref|XP_011083520.1|  PREDICTED: endoglucanase 10                        115   1e-26   Sesamum indicum [beniseed]
ref|XP_009398708.1|  PREDICTED: endoglucanase 24-like                   115   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP04112.1|  unnamed protein product                                114   2e-26   Coffea canephora [robusta coffee]
gb|AAF79918.1|AC022472_27  Contains similarity to beta-1,4-glucan...    113   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KDP36939.1|  hypothetical protein JCGZ_08230                         115   2e-26   Jatropha curcas
gb|AFZ78647.1|  korrigan                                                115   2e-26   Populus tomentosa [Chinese white poplar]
ref|NP_177697.1|  glycosyl hydrolase 9B7                                115   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011045112.1|  PREDICTED: endoglucanase 2                         114   2e-26   Populus euphratica
gb|KDP46724.1|  hypothetical protein JCGZ_06512                         115   3e-26   Jatropha curcas
ref|XP_011043209.1|  PREDICTED: endoglucanase 2-like                    114   3e-26   Populus euphratica
ref|XP_006307252.1|  hypothetical protein CARUB_v10008868mg             114   4e-26   Capsella rubella
ref|XP_004957464.1|  PREDICTED: endoglucanase 24-like                   114   4e-26   Setaria italica
gb|KJB14408.1|  hypothetical protein B456_002G123700                    114   5e-26   Gossypium raimondii
gb|KJB43353.1|  hypothetical protein B456_007G195700                    114   6e-26   Gossypium raimondii
gb|KJB58120.1|  hypothetical protein B456_009G195400                    113   7e-26   Gossypium raimondii
ref|NP_173423.1|  glycosyl hydrolase 9B5                                113   9e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893081.1|  glycosyl hydrolase family 9 protein                113   9e-26   Arabidopsis lyrata subsp. lyrata
gb|KHN21266.1|  Endoglucanase 24                                        108   1e-25   Glycine soja [wild soybean]
ref|XP_009149490.1|  PREDICTED: endoglucanase 2                         112   2e-25   Brassica rapa
gb|AID55379.1|  glycoside hydrolase family 9 B7                         112   2e-25   Gossypium hirsutum [American cotton]
gb|EEC84946.1|  hypothetical protein OsI_32163                          112   2e-25   Oryza sativa Indica Group [Indian rice]
gb|KJB63540.1|  hypothetical protein B456_010G005200                    112   2e-25   Gossypium raimondii
ref|XP_002307711.1|  glycosyl hydrolase family 9 family protein         112   3e-25   Populus trichocarpa [western balsam poplar]
emb|CDY47506.1|  BnaAnng09040D                                          111   3e-25   Brassica napus [oilseed rape]
ref|NP_001063771.1|  Os09g0533900                                       112   3e-25   
gb|EEE70113.1|  hypothetical protein OsJ_30126                          111   3e-25   Oryza sativa Japonica Group [Japonica rice]
gb|KCW56649.1|  hypothetical protein EUGRSUZ_I02356                     111   4e-25   Eucalyptus grandis [rose gum]
ref|XP_010029690.1|  PREDICTED: endoglucanase 2-like                    111   5e-25   Eucalyptus grandis [rose gum]
ref|XP_008799407.1|  PREDICTED: endoglucanase 24-like                   110   7e-25   Phoenix dactylifera
ref|XP_002462729.1|  hypothetical protein SORBIDRAFT_02g030990          110   7e-25   Sorghum bicolor [broomcorn]
ref|XP_003563568.1|  PREDICTED: endoglucanase 18-like                   110   7e-25   Brachypodium distachyon [annual false brome]
ref|NP_001145749.1|  hypothetical protein                               110   8e-25   Zea mays [maize]
ref|XP_010935039.1|  PREDICTED: endoglucanase 24-like                   110   8e-25   Elaeis guineensis
ref|XP_006383120.1|  hypothetical protein POPTR_0005s11750g             110   9e-25   
gb|AEO97190.1|  endo-1,4-beta-glucanase                                 110   9e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010113364.1|  Endoglucanase 24                                   110   1e-24   
ref|XP_004232483.1|  PREDICTED: endoglucanase 2-like                    110   1e-24   Solanum lycopersicum
ref|XP_009378180.1|  PREDICTED: endoglucanase 2-like                    110   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_006340729.1|  PREDICTED: endoglucanase 2-like                    109   2e-24   Solanum tuberosum [potatoes]
gb|KDO84821.1|  hypothetical protein CISIN_1g036398mg                   109   2e-24   Citrus sinensis [apfelsine]
gb|KDO78852.1|  hypothetical protein CISIN_1g048736mg                   109   2e-24   Citrus sinensis [apfelsine]
ref|XP_006426144.1|  hypothetical protein CICLE_v10025306mg             109   2e-24   
ref|XP_006466419.1|  PREDICTED: endoglucanase 2-like                    109   2e-24   Citrus sinensis [apfelsine]
ref|XP_008372790.1|  PREDICTED: endoglucanase 24-like                   109   2e-24   
ref|XP_009386441.1|  PREDICTED: endoglucanase 24-like                   108   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008241905.1|  PREDICTED: endoglucanase 24-like                   109   3e-24   Prunus mume [ume]
ref|XP_008788648.1|  PREDICTED: endoglucanase 24                        108   3e-24   Phoenix dactylifera
ref|XP_010941260.1|  PREDICTED: endoglucanase 24-like                   108   4e-24   Elaeis guineensis
ref|XP_003519870.1|  PREDICTED: endoglucanase 24-like                   108   5e-24   Glycine max [soybeans]
ref|XP_006435158.1|  hypothetical protein CICLE_v10003402mg             108   5e-24   
ref|XP_006656489.1|  PREDICTED: endoglucanase 18-like                   108   6e-24   Oryza brachyantha
ref|XP_009624009.1|  PREDICTED: endoglucanase 2-like                    108   6e-24   Nicotiana tomentosiformis
ref|XP_002300715.1|  glycosyl hydrolase family 9 family protein         108   7e-24   Populus trichocarpa [western balsam poplar]
gb|EAZ02358.1|  hypothetical protein OsI_24462                          107   8e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_010530451.1|  PREDICTED: endoglucanase 2-like                    107   8e-24   
ref|NP_001058583.1|  Os06g0715300                                       107   9e-24   
ref|XP_009803640.1|  PREDICTED: endoglucanase 2-like                    107   1e-23   Nicotiana sylvestris
dbj|BAJ93299.1|  predicted protein                                      107   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN00484.1|  Endoglucanase 24                                        107   2e-23   Glycine soja [wild soybean]
ref|XP_004509346.1|  PREDICTED: endoglucanase 10-like                   106   3e-23   Cicer arietinum [garbanzo]
ref|XP_011028991.1|  PREDICTED: endoglucanase 2-like                    106   4e-23   Populus euphratica
ref|XP_011462352.1|  PREDICTED: endoglucanase 2-like                    105   5e-23   Fragaria vesca subsp. vesca
gb|ACC63522.1|  putative glucanase/cellulase                            101   6e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003629333.1|  Endoglucanase                                      105   7e-23   Medicago truncatula
gb|ABE02649.1|  putative glucanase/cellulase                            100   8e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003578508.1|  PREDICTED: endoglucanase 24                        103   2e-22   Brachypodium distachyon [annual false brome]
ref|XP_006661478.1|  PREDICTED: endoglucanase 24-like                   102   8e-22   
ref|XP_007156152.1|  hypothetical protein PHAVU_003G262600g             102   1e-21   Phaseolus vulgaris [French bean]
dbj|BAK04397.1|  predicted protein                                      101   2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN45917.1|  Endoglucanase 2                                         101   2e-21   Glycine soja [wild soybean]
emb|CDY44194.1|  BnaC05g15510D                                          100   1e-20   Brassica napus [oilseed rape]
ref|XP_002439027.1|  hypothetical protein SORBIDRAFT_10g030140        99.0    2e-20   Sorghum bicolor [broomcorn]
ref|XP_004966453.1|  PREDICTED: endoglucanase 18-like                 98.6    2e-20   Setaria italica
ref|NP_001288527.1|  uncharacterized protein LOC103626453 precursor   97.8    3e-20   Zea mays [maize]
ref|XP_002971269.1|  hypothetical protein SELMODRAFT_94888            97.8    5e-20   
ref|XP_002961546.1|  hypothetical protein SELMODRAFT_77612            97.8    5e-20   
gb|ABK24648.1|  unknown                                               94.7    4e-19   Picea sitchensis
ref|XP_002978046.1|  hypothetical protein SELMODRAFT_417952           89.7    3e-17   Selaginella moellendorffii
ref|WP_036707429.1|  hypothetical protein                             82.0    1e-15   
pdb|1JS4|A  Chain A, EndoEXOCELLULASE:CELLOBIOSE FROM THERMOMONOS...  85.1    1e-15   Thermobifida fusca
gb|KFK37261.1|  hypothetical protein AALP_AA4G234600                  85.1    1e-15   Arabis alpina [alpine rockcress]
ref|WP_033300787.1|  endoglucanase                                    85.1    2e-15   
ref|WP_018105029.1|  MULTISPECIES: hypothetical protein               84.3    3e-15   Streptomyces
ref|XP_006826915.1|  hypothetical protein AMTR_s00010p00165730        83.6    3e-15   Amborella trichopoda
ref|XP_001772307.1|  predicted protein                                84.0    3e-15   
gb|ADX41578.1|  Cel9A                                                 84.3    3e-15   synthetic construct
ref|WP_011292599.1|  endoglucanase                                    84.3    3e-15   Thermobifida fusca
ref|WP_013732376.1|  endoglucanase                                    84.3    4e-15   Verrucosispora maris
ref|XP_002881963.1|  glycosyl hydrolase family 9 protein              83.2    4e-15   Arabidopsis lyrata subsp. lyrata
ref|XP_002966695.1|  hypothetical protein SELMODRAFT_144066           82.8    4e-15   
ref|WP_030488613.1|  endoglucanase                                    84.0    4e-15   
gb|AAV50042.1|  cellulase                                             77.4    5e-15   Saccharum hybrid cultivar Pindar
ref|WP_037655280.1|  endoglucanase                                    83.6    6e-15   Streptomyces achromogenes
ref|WP_030336140.1|  endoglucanase                                    83.6    6e-15   Micromonospora parva
ref|WP_018552941.1|  hypothetical protein                             83.2    7e-15   Streptomyces sp. ATexAB-D23
gb|AHL27899.1|  cellulase                                             83.2    7e-15   uncultured bacterium
ref|WP_033435023.1|  endoglucanase                                    83.2    8e-15   
ref|WP_037701830.1|  endoglucanase                                    83.2    8e-15   
ref|NP_181982.1|  glycosyl hydrolase 9B9                              82.0    9e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413937.1|  hypothetical protein EUTSA_v10027553mg           82.0    1e-14   
emb|CDX74667.1|  BnaA05g04130D                                        81.6    1e-14   
ref|WP_026418585.1|  glycosyl hydrolase family 9                      82.0    1e-14   Actinoalloteichus cyanogriseus
ref|WP_016698150.1|  hypothetical protein                             82.0    1e-14   Actinoalloteichus spitiensis
emb|CDX74664.1|  BnaA05g04100D                                        82.0    1e-14   
ref|XP_009143042.1|  PREDICTED: endoglucanase 14-like                 82.0    1e-14   Brassica rapa
ref|NP_181983.1|  glycosyl hydrolase 9B10                             81.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|WP_039835859.1|  endoglucanase                                    79.0    1e-14   
ref|WP_026214358.1|  endoglucanase                                    82.4    1e-14   
ref|WP_007457075.1|  endoglucanase                                    82.8    1e-14   Micromonospora lupini
gb|ABC70312.1|  endo-1,4-beta-glucanase precursor                     77.0    1e-14   Glycine max [soybeans]
ref|NP_181984.1|  glycosyl hydrolase 9B11                             81.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47674.1|  BnaC04g03850D                                        81.6    1e-14   Brassica napus [oilseed rape]
ref|XP_009143046.1|  PREDICTED: endoglucanase 14-like                 81.3    2e-14   Brassica rapa
ref|XP_008232281.1|  PREDICTED: endoglucanase 14-like                 79.3    2e-14   Prunus mume [ume]
emb|CDX74668.1|  BnaA05g04140D                                        81.3    2e-14   
ref|WP_015942124.1|  endoglucanase                                    82.0    2e-14   Chloroflexus aggregans
ref|XP_002881965.1|  glycosyl hydrolase family 9 protein              81.3    2e-14   
gb|EYU26800.1|  hypothetical protein MIMGU_mgv1a019325mg              81.3    2e-14   Erythranthe guttata [common monkey flower]
gb|EMT32027.1|  Endoglucanase 24                                      81.3    2e-14   
dbj|BAF01119.1|  putative glucanase                                   80.5    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ24519.1|  hypothetical protein OsJ_08281                        81.3    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011085126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  81.3    2e-14   Sesamum indicum [beniseed]
gb|AEH04391.1|  endo-beta-1,4-glucanase                               82.0    2e-14   Thermobifida halotolerans
ref|NP_001048033.1|  Os02g0733300                                     80.9    2e-14   
ref|XP_006829372.1|  hypothetical protein AMTR_s02175p00005920        78.6    2e-14   
ref|XP_007220712.1|  hypothetical protein PRUPE_ppa021556mg           80.5    2e-14   
ref|WP_027622694.1|  endoglucanase [                                  81.6    2e-14   Hungateiclostridium clariflavum
ref|WP_014254351.1|  endoglucanase [                                  81.3    3e-14   Hungateiclostridium clariflavum
ref|WP_036732328.1|  endoglucanase                                    81.6    3e-14   Paenibacillus sp. FSL R7-277
ref|WP_036690521.1|  endoglucanase                                    81.6    3e-14   Paenibacillus sp. FSL R7-269
gb|ADZ85350.1|  Cellulase                                             81.6    3e-14   Cellulosilyticum lentocellum DSM 5427
ref|NP_181985.1|  glycosyl hydrolase 9B12                             80.5    3e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009049941.1|  hypothetical protein LOTGIDRAFT_113537           80.9    3e-14   Lottia gigantea
ref|XP_008232258.1|  PREDICTED: endoglucanase 14-like                 80.5    3e-14   Prunus mume [ume]
gb|KGM14108.1|  endoglucanase                                         81.3    3e-14   Cellulomonas bogoriensis 69B4 = DSM 16987
gb|AIQ70583.1|  endoglucanase                                         81.3    4e-14   Paenibacillus graminis
ref|WP_042268322.1|  endoglucanase                                    81.3    4e-14   
ref|WP_035057437.1|  endoglucanase                                    80.9    4e-14   
ref|XP_009064976.1|  hypothetical protein LOTGIDRAFT_132347           80.5    4e-14   Lottia gigantea
ref|XP_006390849.1|  hypothetical protein EUTSA_v10018439mg           80.1    4e-14   Eutrema salsugineum [saltwater cress]
ref|WP_030479897.1|  endoglucanase                                    80.9    4e-14   Lentzea albidocapillata
ref|WP_035096198.1|  hypothetical protein                             80.5    4e-14   
gb|AFW73285.1|  hypothetical protein ZEAMMB73_816336                  78.2    5e-14   
ref|WP_036944358.1|  endoglucanase                                    80.5    5e-14   
ref|XP_002131623.1|  PREDICTED: endoglucanase 22                      80.9    5e-14   Ciona intestinalis [sea vase]
ref|WP_014256118.1|  cellulose 1,4-beta-cellobiosidase [              80.9    5e-14   Hungateiclostridium clariflavum
gb|EDX71299.1|  Glycosyl hydrolase family 9                           80.1    6e-14   Coleofasciculus chthonoplastes PCC 7420
ref|WP_027621856.1|  cellulose 1,4-beta-cellobiosidase [              80.9    6e-14   Hungateiclostridium clariflavum
ref|WP_043841865.1|  hypothetical protein                             79.3    6e-14   
ref|NP_001288415.1|  endoglucanase 4-like                             79.7    6e-14   Zea mays [maize]
ref|WP_039787404.1|  endoglucanase                                    80.1    7e-14   
ref|WP_044210906.1|  endoglucanase                                    79.7    7e-14   
ref|XP_004953832.1|  PREDICTED: endoglucanase 6-like                  79.3    8e-14   Setaria italica
ref|XP_009771552.1|  PREDICTED: endoglucanase 13-like                 79.3    8e-14   Nicotiana sylvestris
ref|XP_010413050.1|  PREDICTED: endoglucanase 14-like                 79.3    8e-14   
gb|EMT07479.1|  Endoglucanase 18                                      74.7    8e-14   
ref|XP_006294088.1|  hypothetical protein CARUB_v10023082mg           79.3    8e-14   Capsella rubella
ref|XP_010512853.1|  PREDICTED: endoglucanase 14                      79.3    8e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006649019.1|  PREDICTED: endoglucanase 6-like                  79.0    8e-14   Oryza brachyantha
ref|XP_002881964.1|  glycosyl hydrolase family 9 protein              79.3    8e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_006843620.1|  hypothetical protein AMTR_s00007p00146230        76.6    9e-14   
gb|AGO86843.1|  endo-1,4-beta-glucanase                               79.7    9e-14   Bacillus pumilus
gb|EMT11687.1|  Endoglucanase 6                                       79.0    1e-13   
sp|Q5YLG1.1|GUNA_BACPU  RecName: Full=Endoglucanase A; AltName: F...  79.3    1e-13   Bacillus pumilus
ref|WP_036329993.1|  endoglucanase                                    79.7    1e-13   Microbispora sp. ATCC PTA-5024
ref|XP_009115552.1|  PREDICTED: endoglucanase 4                       79.0    1e-13   Brassica rapa
gb|ABC70311.1|  endo-1,4-beta-glucanase precursor                     74.7    1e-13   Glycine max [soybeans]
ref|XP_008809411.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  79.0    1e-13   
dbj|BAJ85886.1|  predicted protein                                    79.0    1e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_029387306.1|  endoglucanase                                    79.3    1e-13   
ref|XP_002454331.1|  hypothetical protein SORBIDRAFT_04g028790        79.0    1e-13   Sorghum bicolor [broomcorn]
ref|XP_004301501.1|  PREDICTED: endoglucanase 5                       79.3    1e-13   Fragaria vesca subsp. vesca
gb|ACY72380.1|  cellulose hydrolase                                   79.3    1e-13   Bacillus licheniformis
ref|WP_039876266.1|  endoglucanase                                    79.7    1e-13   Paenibacillus sp. FSL R7-0273
ref|NP_001234323.1|  endo-1,4-beta-D-glucanase precursor              78.6    1e-13   Solanum lycopersicum
gb|ETW14522.1|  cellobiohydrolase A (1,4-beta-cellobiosidase A)       79.3    1e-13   Roseivivax marinus
ref|XP_006343479.1|  PREDICTED: endoglucanase 3-like                  78.6    1e-13   Solanum tuberosum [potatoes]
ref|XP_001775325.1|  predicted protein                                79.0    1e-13   
gb|AAD28258.1|AF128404_1  cellulase homolog                           78.6    1e-13   Nicotiana alata [flowering tobacco]
ref|NP_001131617.2|  endoglucanase 1 precursor                        78.6    1e-13   Zea mays [maize]
emb|CDP00818.1|  unnamed protein product                              78.6    1e-13   Coffea canephora [robusta coffee]
ref|XP_002451429.1|  hypothetical protein SORBIDRAFT_04g001960        78.6    1e-13   Sorghum bicolor [broomcorn]
ref|XP_009105740.1|  PREDICTED: endoglucanase 8                       78.6    1e-13   Brassica rapa
ref|WP_043179538.1|  endoglucanase                                    79.3    1e-13   
emb|CDY11552.1|  BnaC06g31870D                                        78.6    1e-13   Brassica napus [oilseed rape]
ref|WP_009328502.1|  endoglucanase                                    79.0    1e-13   Bacillus sp. BT1B_CT2
gb|AHE15442.1|  cellulase family protein 9                            79.0    1e-13   Bacillus licheniformis
ref|WP_010251308.1|  endoglucanase                                    79.0    1e-13   Hungateiclostridium cellulolyticum
ref|WP_011197979.1|  endoglucanase                                    79.0    1e-13   Bacillus licheniformis
ref|WP_003181854.1|  MULTISPECIES: endoglucanase                      79.0    1e-13   Bacillus
gb|AAR29083.1|  cellulase                                             79.0    1e-13   Bacillus licheniformis
emb|CDX68334.1|  BnaA07g23740D                                        78.6    1e-13   
ref|WP_041713952.1|  endoglucanase                                    79.0    2e-13   
ref|WP_038595564.1|  endoglucanase                                    79.3    2e-13   Paenibacillus sp. FSL H7-0357
ref|XP_009104944.1|  PREDICTED: endoglucanase 8                       78.6    2e-13   Brassica rapa
ref|WP_030924458.1|  endoglucanase                                    79.3    2e-13   
emb|CDY23486.1|  BnaC06g24550D                                        78.6    2e-13   Brassica napus [oilseed rape]
ref|WP_008045668.1|  glycosyl hydrolase family 5                      79.3    2e-13   Reinekea blandensis
gb|ACZ83939.1|  hypothetical protein Sros_0935                        79.3    2e-13   Streptosporangium roseum DSM 43021
emb|CAA39010.1|  endo-beta-1,4-glucanase (Avicelase I) [ [            79.3    2e-13   Thermoclostridium stercorarium
ref|WP_034836413.1|  endoglucanase [                                  79.3    2e-13   
sp|P23659.1|GUNZ_CLOSR  RecName: Full=Endoglucanase Z; AltName: F...  79.3    2e-13   Thermoclostridium stercorarium
ref|XP_010930836.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  78.6    2e-13   
ref|XP_010271277.1|  PREDICTED: endoglucanase 8-like                  78.6    2e-13   Nelumbo nucifera [Indian lotus]
ref|WP_036628587.1|  endoglucanase                                    79.3    2e-13   
ref|XP_009607784.1|  PREDICTED: endoglucanase 12-like                 78.6    2e-13   Nicotiana tomentosiformis
ref|WP_015359553.1|  endoglucanase Z [                                79.3    2e-13   Thermoclostridium stercorarium
emb|CDX74666.1|  BnaA05g04120D                                        78.6    2e-13   
ref|WP_044387517.1|  endoglucanase                                    79.0    2e-13   
ref|WP_043651319.1|  endoglucanase                                    79.3    2e-13   
gb|ACG39876.1|  endoglucanase 1 precursor                             78.6    2e-13   Zea mays [maize]
emb|CAZ96212.1|  endoglucanase 4 precursor                            78.6    2e-13   Saccharum hybrid cultivar R570
ref|XP_009143044.1|  PREDICTED: endoglucanase 12-like                 78.2    2e-13   Brassica rapa
ref|XP_006385809.1|  hypothetical protein POPTR_0003s14740g           78.6    2e-13   
gb|KCW73253.1|  hypothetical protein EUGRSUZ_E01715                   78.2    2e-13   
gb|AFZ78636.1|  korrigan                                              78.2    2e-13   
gb|AIW39765.1|  putative endoglucanase 4 precursor                    78.2    2e-13   
gb|AEO97202.1|  endo-1,4-beta-glucanase                               78.2    2e-13   
emb|CAZ96184.1|  endoglucanase 4 precursor                            78.2    2e-13   
emb|CAZ96155.1|  endoglucanase 4 precursor                            78.2    2e-13   
ref|XP_004240228.2|  PREDICTED: endoglucanase 13-like                 78.2    2e-13   
gb|AIW39772.1|  putative endoglucanase 4 precursor                    78.2    2e-13   
ref|XP_010058567.1|  PREDICTED: endoglucanase 13-like                 78.2    2e-13   
ref|NP_001289234.1|  endoglucanase 8                                  78.2    2e-13   
emb|CAZ96131.1|  endoglucanase 4 precursor                            78.6    2e-13   
gb|KJB15386.1|  hypothetical protein B456_002G175700                  76.3    2e-13   
ref|XP_010909434.1|  PREDICTED: endoglucanase 23-like                 78.2    2e-13   
gb|KJB15387.1|  hypothetical protein B456_002G175700                  76.3    2e-13   
emb|CAZ96123.1|  endoglucanase 4 precursor                            78.2    2e-13   
gb|AGE09591.1|  CEL2-like protein                                     74.3    2e-13   
gb|ADZ82224.1|  Cellulase                                             79.0    2e-13   
gb|ABD62089.1|  endo-1,4-beta-glucancase precursor                    74.3    2e-13   
gb|AGJ94736.1|  endo-beta-1,4-glucanase 1                             74.3    2e-13   
gb|AAC78293.1|  cellulase                                             78.2    2e-13   
ref|WP_026587001.1|  endoglucanase                                    78.6    2e-13   
emb|CAZ96081.1|  endoglucanase 4 precursor (Sh142J21g280-g330 mod...  78.2    2e-13   
ref|WP_041713262.1|  hypothetical protein                             78.6    2e-13   
ref|WP_025807828.1|  endoglucanase                                    78.6    2e-13   
ref|XP_010508282.1|  PREDICTED: endoglucanase 15-like                 77.8    2e-13   
ref|NP_177228.1|  endo-1,4-beta-glucanase                             77.8    2e-13   
emb|CAA67157.1|  endo-1,4-beta-glucanase                              77.8    3e-13   
ref|XP_006298937.1|  hypothetical protein CARUB_v10015060mg           77.8    3e-13   
dbj|BAK07919.1|  predicted protein                                    77.8    3e-13   
ref|WP_041084840.1|  endoglucanase                                    78.2    3e-13   
gb|KJB15385.1|  hypothetical protein B456_002G175700                  76.6    3e-13   
gb|KIL18226.1|  Endoglucanase 4 precursor                             78.2    3e-13   
ref|XP_008369029.1|  PREDICTED: endoglucanase 17-like                 77.8    3e-13   
ref|XP_008366122.1|  PREDICTED: endoglucanase 14-like                 77.8    3e-13   
dbj|BAK07001.1|  predicted protein                                    77.8    3e-13   
ref|XP_002888789.1|  hypothetical protein ARALYDRAFT_894888           77.8    3e-13   
ref|XP_010471073.1|  PREDICTED: endoglucanase 8-like                  77.8    3e-13   
ref|XP_010427855.1|  PREDICTED: endoglucanase 8                       77.8    3e-13   
emb|CBI27137.3|  unnamed protein product                              78.2    3e-13   
ref|XP_002277177.2|  PREDICTED: LOW QUALITY PROTEIN: endoglucanase 5  77.8    3e-13   
ref|XP_010506383.1|  PREDICTED: endoglucanase 15-like                 77.8    3e-13   
ref|WP_037782374.1|  endoglucanase                                    78.2    3e-13   
ref|XP_003530757.1|  PREDICTED: endoglucanase 8-like                  77.4    3e-13   
ref|WP_044219275.1|  hypothetical protein                             78.6    3e-13   
ref|WP_039178590.1|  endoglucanase                                    77.8    3e-13   
ref|WP_025092594.1|  endoglucanase                                    77.8    3e-13   
gb|AEX68682.1|  endoglucanase                                         77.8    3e-13   
ref|XP_006302180.1|  hypothetical protein CARUB_v10020190mg           77.4    3e-13   
ref|WP_024426995.1|  endoglucanase                                    77.8    3e-13   
gb|KJB15383.1|  hypothetical protein B456_002G175700                  76.6    3e-13   
ref|WP_041109021.1|  endoglucanase                                    77.8    3e-13   
ref|XP_008374126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  77.4    3e-13   
ref|XP_009399740.1|  PREDICTED: endoglucanase 6-like                  77.4    3e-13   
ref|XP_011022406.1|  PREDICTED: endoglucanase 1-like isoform X2       77.4    3e-13   
ref|WP_034623616.1|  endoglucanase                                    77.8    3e-13   
ref|XP_008386675.1|  PREDICTED: endoglucanase 17-like                 77.4    3e-13   
ref|XP_009378750.1|  PREDICTED: endoglucanase 17                      77.4    3e-13   
gb|KDP22411.1|  hypothetical protein JCGZ_26242                       77.4    3e-13   
ref|WP_043615544.1|  endoglucanase                                    78.2    3e-13   
ref|WP_024632469.1|  MULTISPECIES: glycoside hydrolase                78.2    3e-13   
ref|WP_034281815.1|  endoglucanase                                    77.8    3e-13   
ref|XP_002310080.1|  endo-1 family protein                            77.8    3e-13   
ref|XP_007043306.1|  Glycosyl hydrolase 9C1 isoform 2                 77.8    3e-13   
gb|KFK41496.1|  hypothetical protein AALP_AA2G137600                  77.4    3e-13   
ref|WP_036942443.1|  endoglucanase                                    77.8    3e-13   
ref|XP_011022404.1|  PREDICTED: endoglucanase 1-like isoform X1       77.4    3e-13   
ref|XP_010552688.1|  PREDICTED: endoglucanase 8 isoform X2            77.4    3e-13   
ref|XP_010452662.1|  PREDICTED: endoglucanase 15-like                 77.4    3e-13   
ref|XP_010094077.1|  Endoglucanase 13                                 77.4    3e-13   
ref|XP_007043305.1|  Glycosyl hydrolase 9C1 isoform 1                 77.8    3e-13   
ref|XP_010552685.1|  PREDICTED: endoglucanase 8 isoform X1            77.4    3e-13   
ref|WP_044330588.1|  endoglucanase                                    77.8    4e-13   
gb|AJH76970.1|  cellulase                                             77.8    4e-13   
ref|WP_033165790.1|  endoglucanase                                    78.2    4e-13   
ref|XP_008785806.1|  PREDICTED: endoglucanase 23-like                 77.4    4e-13   
ref|WP_041117396.1|  endoglucanase                                    77.8    4e-13   
emb|CAA52343.1|  cellulase                                            77.4    4e-13   
ref|WP_042201038.1|  endoglucanase                                    78.2    4e-13   
ref|XP_002973718.1|  hypothetical protein SELMODRAFT_99802            77.8    4e-13   
gb|AIQ31859.1|  endoglucanase                                         78.2    4e-13   
gb|KHG18580.1|  Endoglucanase 8 -like protein                         77.4    4e-13   
gb|AFK49805.1|  beta-1,4-glucanase 1                                  75.1    4e-13   
emb|CDY04737.1|  BnaC05g18520D                                        77.0    4e-13   
gb|KJB15384.1|  hypothetical protein B456_002G175700                  76.6    4e-13   
emb|CDY37459.1|  BnaC08g45970D                                        77.0    4e-13   
gb|AID55381.1|  glycoside hydrolase family 9 B1                       77.0    4e-13   
ref|WP_042141562.1|  endoglucanase                                    77.8    4e-13   
ref|XP_003601448.1|  Endo-1 4-beta-glucanase                          77.0    4e-13   
ref|WP_010522082.1|  glycoside hydrolase                              77.8    4e-13   
gb|EMT15618.1|  Endoglucanase 8                                       77.0    5e-13   
gb|KDP25379.1|  hypothetical protein JCGZ_20535                       77.0    5e-13   
emb|CDY47675.1|  BnaC04g03840D                                        77.0    5e-13   
gb|AIA83890.1|  Glyco_hydro_9                                         72.4    5e-13   
gb|KJB15382.1|  hypothetical protein B456_002G175700                  77.0    5e-13   
gb|AGG19085.1|  cellulase                                             77.0    5e-13   
ref|WP_042243253.1|  endoglucanase                                    77.8    5e-13   
dbj|BAK01727.1|  predicted protein                                    77.0    5e-13   
ref|WP_004463236.1|  endoglucanase                                    77.4    5e-13   
ref|XP_010227779.1|  PREDICTED: endoglucanase 17                      77.0    5e-13   
gb|AIQ43153.1|  endoglucanase                                         77.8    5e-13   
emb|CAE51308.1|  beta-1,4-glucanase                                   77.4    5e-13   
ref|XP_008220580.1|  PREDICTED: endoglucanase 16                      77.0    5e-13   
ref|XP_010906933.1|  PREDICTED: endoglucanase 17-like                 77.0    5e-13   
ref|WP_011837874.1|  endoglucanase                                    77.4    5e-13   
ref|WP_003517663.1|  endoglucanase                                    77.4    5e-13   
ref|WP_033172752.1|  endoglucanase                                    77.8    5e-13   
ref|XP_004974509.1|  PREDICTED: endoglucanase 19-like                 77.0    5e-13   
ref|WP_025666652.1|  hypothetical protein                             73.9    5e-13   
dbj|BAA85150.1|  endo-1,4-beta-glucanase                              77.0    5e-13   
ref|WP_044479589.1|  endoglucanase                                    77.8    5e-13   
ref|XP_008340449.1|  PREDICTED: endoglucanase 5                       77.0    6e-13   
ref|XP_009393121.1|  PREDICTED: endoglucanase 1-like                  76.6    6e-13   
ref|XP_003630905.1|  Endo-beta-1 4-glucanase                          76.6    6e-13   
ref|XP_009376856.1|  PREDICTED: endoglucanase 14-like                 76.6    6e-13   
ref|XP_011075376.1|  PREDICTED: endoglucanase 8-like                  76.6    6e-13   
ref|WP_035086727.1|  hypothetical protein                             77.8    6e-13   
gb|EYU26799.1|  hypothetical protein MIMGU_mgv1a020424mg              76.6    6e-13   
gb|AFZ78644.1|  korrigan                                              77.0    6e-13   
gb|EMI13369.1|  glycoside hydrolase family 9                          77.0    6e-13   
ref|WP_003518379.1|  endoglucanase                                    77.4    6e-13   
ref|XP_010477612.1|  PREDICTED: endoglucanase 4                       76.6    6e-13   
ref|WP_044202405.1|  hypothetical protein                             77.8    7e-13   
ref|XP_004168441.1|  PREDICTED: endoglucanase 13-like                 76.6    7e-13   
ref|WP_039294541.1|  endoglucanase                                    77.4    7e-13   
ref|WP_033388930.1|  endoglucanase                                    75.1    7e-13   
ref|WP_019909098.1|  hypothetical protein                             77.4    7e-13   
ref|XP_006656855.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  76.6    7e-13   
gb|AFI56491.1|  putative glycoside hydrolase family protein           75.1    7e-13   
ref|XP_006355746.1|  PREDICTED: endoglucanase 14-like                 76.6    7e-13   
ref|XP_010271485.1|  PREDICTED: endoglucanase 23-like                 76.6    7e-13   
gb|AID55387.1|  glycoside hydrolase family 9 A4                       76.6    7e-13   
gb|EYU20028.1|  hypothetical protein MIMGU_mgv1a025805mg              76.6    7e-13   
gb|ABC94541.1|  endo-1,4-beta-glucanase                               72.4    7e-13   
ref|XP_004495939.1|  PREDICTED: endoglucanase 17-like                 76.6    7e-13   
ref|WP_008354456.1|  endoglucanase                                    77.0    7e-13   
ref|XP_005855791.1|  beta- -endoglucanase                             76.6    7e-13   
sp|P05522.1|GUN1_PERAE  RecName: Full=Endoglucanase 1; AltName: F...  76.6    7e-13   
dbj|BAA77239.1|  endo-1,4-beta glucanase                              76.6    7e-13   
ref|WP_044141890.1|  endoglucanase                                    77.0    7e-13   
emb|CAA67156.1|  endo-1,4-beta-glucanase                              76.6    7e-13   
ref|XP_003536878.1|  PREDICTED: endoglucanase 17-like                 76.6    7e-13   
ref|XP_011079628.1|  PREDICTED: endoglucanase 17                      76.6    7e-13   
ref|XP_010263885.1|  PREDICTED: endoglucanase 23-like                 76.6    7e-13   
ref|WP_030468638.1|  endoglucanase                                    77.0    7e-13   
ref|XP_003521576.1|  PREDICTED: endoglucanase 17                      76.6    7e-13   
ref|WP_039963581.1|  endoglucanase                                    76.6    8e-13   
ref|XP_007145197.1|  hypothetical protein PHAVU_007G218400g           76.6    8e-13   
gb|EWM20555.1|  beta- -endoglucanase                                  76.6    8e-13   
emb|CAZ96116.1|  endoglucanase 4 precursor                            76.6    8e-13   
gb|AAF15367.1|  endoglucanase                                         76.6    8e-13   
gb|ABM68635.1|  endoglucanase A                                       76.6    8e-13   
gb|ABO88214.1|  endoglucanase                                         76.6    8e-13   
ref|XP_006416111.1|  hypothetical protein EUTSA_v10007462mg           76.3    8e-13   
ref|XP_001774444.1|  predicted protein                                76.6    8e-13   
gb|KHN32282.1|  Endoglucanase 5                                       76.6    8e-13   
gb|AEQ94264.1|  endoglucanase                                         76.6    8e-13   
ref|XP_004290812.1|  PREDICTED: endoglucanase 17                      76.3    8e-13   
ref|XP_006305871.1|  hypothetical protein CARUB_v10010959mg           76.3    8e-13   
ref|XP_002975769.1|  hypothetical protein SELMODRAFT_232575           76.6    8e-13   
ref|XP_004505716.1|  PREDICTED: endoglucanase 5-like                  76.6    8e-13   
ref|WP_012009987.1|  endoglucanase                                    76.6    8e-13   
ref|XP_006590804.1|  PREDICTED: endoglucanase 5-like                  76.6    9e-13   
ref|WP_025207338.1|  endoglucanase                                    76.6    9e-13   
gb|ABR10904.1|  endoglucanase                                         76.6    9e-13   
ref|XP_002890576.1|  glycosyl hydrolase family 9 protein              76.3    9e-13   
ref|XP_007199651.1|  hypothetical protein PRUPE_ppa004387mg           76.3    9e-13   
ref|WP_011837740.1|  endoglucanase                                    77.0    9e-13   
ref|WP_034229519.1|  hypothetical protein                             77.4    9e-13   
ref|WP_024720368.1|  endoglucanase                                    76.6    9e-13   
ref|WP_035700771.1|  endoglucanase                                    76.6    9e-13   
gb|ACD44896.1|  endoglucanase                                         76.6    9e-13   
gb|AAA20892.1|  endo-1,3-beta-glucanase                               77.0    9e-13   
ref|XP_010031904.1|  PREDICTED: endoglucanase 5                       76.6    9e-13   
ref|XP_003570500.1|  PREDICTED: endoglucanase 8                       76.3    9e-13   
ref|WP_003511958.1|  endoglucanase                                    77.0    9e-13   
gb|EAZ42601.1|  hypothetical protein OsJ_27165                        76.3    9e-13   
gb|KJF48403.1|  endoglucanase                                         76.6    9e-13   
ref|WP_041090501.1|  endoglucanase                                    76.6    9e-13   
ref|WP_035392050.1|  endoglucanase                                    76.6    9e-13   
ref|WP_017367258.1|  endoglucanase                                    76.6    9e-13   
ref|WP_037256689.1|  endoglucanase                                    76.6    9e-13   
ref|WP_008344755.1|  endoglucanase                                    76.6    9e-13   
gb|KGN45077.1|  hypothetical protein Csa_7G420700                     76.6    9e-13   
gb|EGJ33758.1|  glycosyl hydrolase family 9                           76.3    9e-13   
gb|EMS54236.1|  Endoglucanase 18                                      76.3    9e-13   
ref|XP_009383065.1|  PREDICTED: endoglucanase 8-like                  76.3    9e-13   
ref|WP_019744168.1|  endoglucanase                                    76.6    9e-13   
ref|NP_173735.1|  glycosyl hydrolase 9B6                              76.3    9e-13   
ref|NP_001136728.1|  uncharacterized protein LOC100216867 precursor   76.3    9e-13   
ref|WP_033441521.1|  endoglucanase                                    76.6    9e-13   
gb|KGN46280.1|  hypothetical protein Csa_6G079740                     75.9    9e-13   
ref|WP_033257952.1|  endoglucanase                                    76.6    9e-13   
ref|NP_001048297.1|  Os02g0778600                                     76.3    9e-13   
sp|P28622.2|GUN4_BACS5  RecName: Full=Endoglucanase 4; AltName: F...  76.6    9e-13   
ref|XP_008235122.1|  PREDICTED: endoglucanase 17                      76.3    9e-13   
gb|EAZ07843.1|  hypothetical protein OsI_30101                        76.3    9e-13   
ref|XP_007160401.1|  hypothetical protein PHAVU_002G318800g           76.3    9e-13   
ref|WP_039166653.1|  endoglucanase                                    76.6    9e-13   
ref|XP_010460111.1|  PREDICTED: endoglucanase 4-like                  76.3    1e-12   
ref|WP_041507295.1|  endoglucanase                                    76.6    1e-12   
dbj|BAJ32778.1|  putative endoglucanase precursor                     76.6    1e-12   
ref|XP_010498829.1|  PREDICTED: endoglucanase 4                       76.3    1e-12   
gb|KCW51302.1|  hypothetical protein EUGRSUZ_J00862                   76.3    1e-12   
ref|XP_004153697.1|  PREDICTED: endoglucanase 12-like                 76.3    1e-12   
ref|WP_010248355.1|  cellulose 1,4-beta-cellobiosidase                77.0    1e-12   
prf||2113326C  ORF 2 [                                                75.9    1e-12
ref|XP_004135956.1|  PREDICTED: endoglucanase 5-like                  76.3    1e-12   
emb|CDP12234.1|  unnamed protein product                              75.9    1e-12   
ref|NP_001061713.1|  Os08g0387400                                     76.3    1e-12   
pdb|2XFG|A  Chain A, Reassembly And Co-Crystallization Of A Famil...  75.9    1e-12   
ref|XP_008803904.1|  PREDICTED: endoglucanase 17-like                 75.9    1e-12   
gb|AGG19090.1|  cellulase                                             75.9    1e-12   
ref|XP_004158222.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  76.6    1e-12   
ref|WP_044492536.1|  glycosyl hydrolase family 9                      75.9    1e-12   
gb|EAZ06862.1|  hypothetical protein OsI_29098                        75.9    1e-12   
ref|XP_011008907.1|  PREDICTED: endoglucanase 5                       76.3    1e-12   
gb|AIS01267.1|  Endoglucanase E-4                                     76.6    1e-12   
gb|EWM26157.1|  beta- -endoglucanase                                  75.9    1e-12   
ref|XP_004954110.1|  PREDICTED: endoglucanase 8-like                  75.9    1e-12   
ref|WP_043504966.1|  endoglucanase                                    76.6    1e-12   



>ref|XP_009783020.1| PREDICTED: endoglucanase 2 [Nicotiana sylvestris]
Length=525

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 104/123 (85%), Gaps = 4/123 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSR KGGWCGW++V+IV AA   +I VLVKKKH G   S PDAAPVPGPPG+ T+KY
Sbjct  1    MGEKSR-KGGWCGWIIVLIVVAAAAGAIVVLVKKKHNG---SSPDAAPVPGPPGSPTKKY  56

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK AMQFFDVQKSGKLV+NKISWRGDS +KDG  A LDLSKGMYDAGD MKFGFPMA
Sbjct  57   ADALKTAMQFFDVQKSGKLVNNKISWRGDSAVKDGSPAKLDLSKGMYDAGDHMKFGFPMA  116

Query  583  YTA  591
            YTA
Sbjct  117  YTA  119



>ref|XP_009610927.1| PREDICTED: endoglucanase 2-like [Nicotiana tomentosiformis]
Length=525

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 104/123 (85%), Gaps = 4/123 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSR KGGWCGW++V+IV AA   +I VLVKKKH G   S PDAAPVPGPPG+ T+KY
Sbjct  1    MGEKSR-KGGWCGWIIVLIVVAAAAGAIVVLVKKKHNG---SSPDAAPVPGPPGSPTKKY  56

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK AMQFFDVQKSGKLV+NKISWRGDS +KDG  A +DLSKGMYDAGD MKFGFPMA
Sbjct  57   ADALKTAMQFFDVQKSGKLVNNKISWRGDSAVKDGSQAKVDLSKGMYDAGDHMKFGFPMA  116

Query  583  YTA  591
            YTA
Sbjct  117  YTA  119



>emb|CDP07412.1| unnamed protein product [Coffea canephora]
Length=526

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 98/124 (79%), Gaps = 5/124 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGG-GSSEPDaapvpgppgavTQK  399
            MG+KSRSKGGWCGWLLV+IVAAAI   IFV +KKKH    G + P    VPGPPGAVT+K
Sbjct  1    MGEKSRSKGGWCGWLLVLIVAAAIAFGIFVTIKKKHHASKGEAAP----VPGPPGAVTKK  56

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  579
            Y DAL  AMQF DVQKSGKLV NKI WRGDS L DG  A +DLSKGMYDAGD MKFGFPM
Sbjct  57   YADALHAAMQFLDVQKSGKLVHNKIPWRGDSALDDGSPAKVDLSKGMYDAGDHMKFGFPM  116

Query  580  AYTA  591
            AYTA
Sbjct  117  AYTA  120



>gb|AGV22125.1| endo-1,4-beta-glucanase 3 [Betula luminifera]
Length=527

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 97/123 (79%), Gaps = 4/123 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSRS  GWCGW LV+++ A +  ++ + +KKK     S    A PVPGPPGA+ +KY
Sbjct  1    MGEKSRSSKGWCGWFLVLVILALVVGAVVITIKKK----TSHSDKAPPVPGPPGAIVKKY  56

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALKIAMQFFDVQKSGKLVDN ISWRGDS LKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  57   SDALKIAMQFFDVQKSGKLVDNPISWRGDSALKDGSEATLDLSKGMYDAGDHMKFGFPMA  116

Query  583  YTA  591
            +TA
Sbjct  117  FTA  119



>ref|XP_003527686.1| PREDICTED: endoglucanase 10-like [Glycine max]
 gb|KHN09095.1| Endoglucanase 24 [Glycine soja]
Length=529

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 95/123 (77%), Gaps = 2/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSRSKGG CGW +  ++ A +  +I   VKKK    GS +   APVPGPPGAV QKY
Sbjct  1    MGEKSRSKGGCCGWFIAFVILALVVGAIVFTVKKKFSHSGSDK--PAPVPGPPGAVDQKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
              ALK AMQFFDVQKSG+LVDNKISWRG+S LKDG  A LDLSKGMYDAGD MKFGFPMA
Sbjct  59   STALKTAMQFFDVQKSGRLVDNKISWRGNSALKDGSQAKLDLSKGMYDAGDNMKFGFPMA  118

Query  583  YTA  591
            +TA
Sbjct  119  FTA  121



>ref|XP_004238345.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
 ref|XP_010320423.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
Length=519

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 91/123 (74%), Gaps = 9/123 (7%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+ KGGWCGW++ ++V AA   +I VL  KKH G GS            GA  +KY
Sbjct  1    MGEKSK-KGGWCGWIIALVVVAAAAGAIVVLFMKKHNGSGSD--------AASGASEKKY  51

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
            GDALKIAMQFFDVQKSGKLV+NKISWRGDS +KDG    LDLS+GMYDAGD MKF FPMA
Sbjct  52   GDALKIAMQFFDVQKSGKLVNNKISWRGDSAVKDGSQEKLDLSQGMYDAGDHMKFNFPMA  111

Query  583  YTA  591
            YTA
Sbjct  112  YTA  114



>ref|XP_003523541.1| PREDICTED: endoglucanase 10 [Glycine max]
Length=529

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 95/123 (77%), Gaps = 2/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSRSKGG CGW +  I+ A +  +I   VKKK    GS +   APVPGPPGAV QKY
Sbjct  1    MGEKSRSKGGCCGWFIAFIILALVVGAIVFTVKKKFSHSGSDK--PAPVPGPPGAVDQKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
              ALK AMQFFD+QKSGKLVDNKISWRG+S LKDG  A LDL+KGMYDAGD MKFGFPMA
Sbjct  59   STALKTAMQFFDIQKSGKLVDNKISWRGNSALKDGSQAKLDLTKGMYDAGDNMKFGFPMA  118

Query  583  YTA  591
            +TA
Sbjct  119  FTA  121



>ref|XP_003603741.1| Endoglucanase [Medicago truncatula]
Length=535

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 87/123 (71%), Gaps = 2/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M +KS+SKGG CGW +  ++ A +  +I   VKKK     S +P+  P P       QKY
Sbjct  1    MREKSKSKGGCCGWFIAFVILALVVGAIVYAVKKKIDNSNSDKPEPVPGPPGAID--QKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
              ALK AMQFFDVQKSGKL +NKISWRGDS LKDGK A LDL+KGMYDAGD MKFGFPMA
Sbjct  59   ASALKTAMQFFDVQKSGKLENNKISWRGDSALKDGKQADLDLTKGMYDAGDHMKFGFPMA  118

Query  583  YTA  591
            +TA
Sbjct  119  FTA  121



>gb|AES73992.2| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=529

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 87/123 (71%), Gaps = 2/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M +KS+SKGG CGW +  ++ A +  +I   VKKK     S +P+  P P       QKY
Sbjct  1    MREKSKSKGGCCGWFIAFVILALVVGAIVYAVKKKIDNSNSDKPEPVPGPPGAID--QKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
              ALK AMQFFDVQKSGKL +NKISWRGDS LKDGK A LDL+KGMYDAGD MKFGFPMA
Sbjct  59   ASALKTAMQFFDVQKSGKLENNKISWRGDSALKDGKQADLDLTKGMYDAGDHMKFGFPMA  118

Query  583  YTA  591
            +TA
Sbjct  119  FTA  121



>ref|XP_007136082.1| hypothetical protein PHAVU_009G016100g [Phaseolus vulgaris]
 gb|ESW08076.1| hypothetical protein PHAVU_009G016100g [Phaseolus vulgaris]
Length=529

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 2/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+SKGG CGW +  ++ A +  ++   VKKK G  GS +  AAPVPGPPGAV QKY
Sbjct  1    MGEKSKSKGGCCGWFIAFVILAIVVGAVVYTVKKKFGHSGSDK--AAPVPGPPGAVDQKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
              ALK ++QFFD+QKSGKLV+NKI WRGDSGLKDG  A LDL+KGMYDAGD +KFGFPMA
Sbjct  59   ATALKTSLQFFDIQKSGKLVNNKIPWRGDSGLKDGSQAKLDLTKGMYDAGDHIKFGFPMA  118

Query  583  YTA  591
            +TA
Sbjct  119  FTA  121



>ref|XP_010104437.1| Endoglucanase 24 [Morus notabilis]
 gb|EXC00970.1| Endoglucanase 24 [Morus notabilis]
Length=525

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 96/126 (76%), Gaps = 10/126 (8%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK---HGGGGSSEPDaapvpgppgavT  393
            MG+KS SKG WCGW LV+++ A +  +I + +KKK   H    +  P      GPPGA++
Sbjct  1    MGEKSSSKG-WCGWFLVLVILALVVGAIVITIKKKQSDHSDKAAPVP------GPPGAIS  53

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            QKY DALKIA+QFFDVQKSGKL DNKISWRGDSGL+DG  A +DLSKGMYDAGD MKFGF
Sbjct  54   QKYADALKIAIQFFDVQKSGKLEDNKISWRGDSGLRDGSDAKVDLSKGMYDAGDHMKFGF  113

Query  574  PMAYTA  591
            PMA+TA
Sbjct  114  PMAFTA  119



>ref|XP_004136389.1| PREDICTED: endoglucanase 2-like [Cucumis sativus]
 ref|XP_004162553.1| PREDICTED: endoglucanase 2-like [Cucumis sativus]
 gb|KGN60025.1| hypothetical protein Csa_3G872070 [Cucumis sativus]
Length=523

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 100/123 (81%), Gaps = 4/123 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSRS+G  CGW LV++V A I  +I   VKKK      S+ D APVPGPPGA+ +KY
Sbjct  1    MGEKSRSRGC-CGWFLVLVVLALIAGAIVFAVKKK---SSHSDDDPAPVPGPPGAIEKKY  56

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+AM+FFDVQKSGKLVDN+ISWRGDSGLKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  57   SDALKMAMKFFDVQKSGKLVDNQISWRGDSGLKDGSDANLDLSKGMYDAGDHMKFGFPMA  116

Query  583  YTA  591
            +TA
Sbjct  117  FTA  119



>ref|XP_008466493.1| PREDICTED: endoglucanase 10 [Cucumis melo]
Length=523

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 99/123 (80%), Gaps = 4/123 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSRS+G  CGW LV+++   I  +I   VKKK      S+ D APVPGPPGA+ +KY
Sbjct  1    MGEKSRSRGC-CGWFLVLVILGLIAGAIVFAVKKK---SSHSDDDPAPVPGPPGAIQKKY  56

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+A++FFDVQKSGKLVDNKISWRGDSGLKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  57   SDALKMALRFFDVQKSGKLVDNKISWRGDSGLKDGSEANLDLSKGMYDAGDHMKFGFPMA  116

Query  583  YTA  591
            +TA
Sbjct  117  FTA  119



>ref|XP_006302134.1| hypothetical protein CARUB_v10020139mg [Capsella rubella]
 gb|EOA35032.1| hypothetical protein CARUB_v10020139mg [Capsella rubella]
Length=525

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 100/123 (81%), Gaps = 2/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+S+G WCGWL+ +IV A++ +++   VK +    G  E  A PVPGPPGA+ +KY
Sbjct  1    MGEKSKSRG-WCGWLIAIIVLASVVLAVVYTVKSRMKKSGDDE-GAGPVPGPPGAIDKKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+A+QFFD+QKSGKLV+NKISWRGDSGLKDG  A LDLSKG+YDAGD +KFGFPMA
Sbjct  59   ADALKMALQFFDIQKSGKLVNNKISWRGDSGLKDGSEADLDLSKGLYDAGDHIKFGFPMA  118

Query  583  YTA  591
            +TA
Sbjct  119  FTA  121



>gb|KHF97947.1| hypothetical protein F383_10892 [Gossypium arboreum]
Length=526

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKESKS-GGCLGWLLAIVILALVVGAIVYAVKQKMDHANDNKPSPVPGPPGAID--KKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  58   ADALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGNEANLDLSKGMYDAGDHMKFGFPMA  117

Query  583  YTA  591
            +TA
Sbjct  118  FTA  120



>gb|KJB58118.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=526

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKESKS-GGCLGWLLAIVILALVVGAIVYAVKQKIDHANDNKPSPVPGPPGAID--KKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  58   ADALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGNEANLDLSKGMYDAGDHMKFGFPMA  117

Query  583  YTA  591
            +TA
Sbjct  118  FTA  120



>gb|ADU15552.1| EG [Gossypium hirsutum]
Length=526

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKESKS-GGCLGWLLAIVILALVVGAIVYAVKQKIDHANDNKPSPVPGPPGAID--KKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  58   ADALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGNEANLDLSKGMYDAGDHMKFGFPMA  117

Query  583  YTA  591
            +TA
Sbjct  118  FTA  120



>gb|AID55377.1| glycoside hydrolase family 9 B5 [Gossypium hirsutum]
Length=526

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKQSKS-GGCLGWLLAIVILALVVGAIVYAVKQKIDHANDNKPSPVPGPPGAID--KKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  58   ADALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGNEANLDLSKGMYDAGDHMKFGFPMA  117

Query  583  YTA  591
            +TA
Sbjct  118  FTA  120



>ref|XP_010244092.1| PREDICTED: endoglucanase 24-like [Nelumbo nucifera]
 ref|XP_010244093.1| PREDICTED: endoglucanase 24-like [Nelumbo nucifera]
Length=527

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG K +SKG +CGWL+  +V   +   I + V+ KH    S +P  AP+PGPPGA+ +KY
Sbjct  1    MGGKEKSKG-YCGWLIAFVVLGIVVAVIVLTVRHKHS---SHKPVPAPIPGPPGAIEKKY  56

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DAL +AMQFFDVQKSGKLV+NKISWRGDS L+DGK   LDLSKGMYDAGD MKFG PMA
Sbjct  57   ADALGVAMQFFDVQKSGKLVNNKISWRGDSALQDGKEKKLDLSKGMYDAGDHMKFGLPMA  116

Query  583  YTA  591
            +TA
Sbjct  117  FTA  119



>ref|XP_008364934.1| PREDICTED: endoglucanase 10-like [Malus domestica]
Length=526

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 95/127 (75%), Gaps = 11/127 (9%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvi----vaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgav  390
            MG KSR KG W  WLLV+     V  A+ +++   VKK  GG  S+ P      GPPGA+
Sbjct  1    MGAKSRCKG-WWAWLLVLAILGLVVGAVVLAVVKKVKKNSGGDDSAVP------GPPGAI  53

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
            TQKY DALK+A+QFFDVQKSG+LVDNKISWRGDSGLKDG  A LDLSKGMYDAGD MKFG
Sbjct  54   TQKYSDALKLAVQFFDVQKSGQLVDNKISWRGDSGLKDGSDAKLDLSKGMYDAGDHMKFG  113

Query  571  FPMAYTA  591
            FPMAYTA
Sbjct  114  FPMAYTA  120



>ref|XP_006342034.1| PREDICTED: endoglucanase 10-like [Solanum tuberosum]
Length=519

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 91/123 (74%), Gaps = 9/123 (7%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+ KGGWCGW++V+IVAAA   +I VLV KKH    S            GA  +KY
Sbjct  1    MGEKSK-KGGWCGWIIVLIVAAAAAGAIVVLVMKKHKDSSSDA--------ASGASEKKY  51

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
            GDALKIAMQFFDVQKSGKLV+NKI WRGDS +KDG    LDLS+GMYDAGD MKF FPMA
Sbjct  52   GDALKIAMQFFDVQKSGKLVNNKIPWRGDSAIKDGSQEKLDLSQGMYDAGDHMKFNFPMA  111

Query  583  YTA  591
            YTA
Sbjct  112  YTA  114



>ref|XP_007017777.1| EG isoform 3 [Theobroma cacao]
 gb|EOY15002.1| EG isoform 3 [Theobroma cacao]
Length=365

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 95/125 (76%), Gaps = 7/125 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  396
            MG +S+SKG   GW LV+++ A +  ++   +K+K  H     + P    VPGPPGA+ +
Sbjct  1    MGKESKSKGC-LGWFLVIVILALVVGAVVYAIKQKMDHSDDDKAAP----VPGPPGAIDK  55

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY DALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD MKFGFP
Sbjct  56   KYADALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGSEAKLDLSKGMYDAGDHMKFGFP  115

Query  577  MAYTA  591
            +A+TA
Sbjct  116  LAFTA  120



>ref|XP_009335173.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
Length=526

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
            TQKY DALK+A+QFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD MKFG
Sbjct  54   TQKYSDALKVAVQFFDVQKSGKLVDNKISWRGDSGLKDGSDAKLDLSKGMYDAGDHMKFG  113

Query  571  FPMAYTA  591
            FPMAYTA
Sbjct  114  FPMAYTA  120



>ref|XP_010539853.1| PREDICTED: endoglucanase 10 [Tarenaya hassleriana]
Length=524

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 96/123 (78%), Gaps = 3/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+S+G WCGW + ++V A + V++   ++ K   G S +    PVPGPPGA+ +KY
Sbjct  1    MGEKSQSRG-WCGWFIALVVLAVVVVAVVFTIRAK--TGHSDDGGDGPVPGPPGAIDKKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALKIAMQFFD+QKSGKL +NKI WRGDSGLKDG   +LDLSKG+YDAGD MKFGFPMA
Sbjct  58   SDALKIAMQFFDIQKSGKLENNKIPWRGDSGLKDGNEVNLDLSKGLYDAGDHMKFGFPMA  117

Query  583  YTA  591
            +TA
Sbjct  118  FTA  120



>ref|XP_004500948.1| PREDICTED: endoglucanase 10-like [Cicer arietinum]
Length=528

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 93/123 (76%), Gaps = 3/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG KSRS+G  CGW +  ++ A +  ++   +KKK     S +   APVPGPPGA+ QKY
Sbjct  1    MGGKSRSRGC-CGWFIAFVIFALVVGAVVYTIKKKIDNSDSDK--PAPVPGPPGAIEQKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
              ALK AMQFFDVQKSGKL +NKISWRGDS LKDGK A+LDLSKGMYDAGD MKFGFPMA
Sbjct  58   STALKTAMQFFDVQKSGKLENNKISWRGDSALKDGKQANLDLSKGMYDAGDHMKFGFPMA  117

Query  583  YTA  591
            +TA
Sbjct  118  FTA  120



>ref|XP_010667385.1| PREDICTED: endoglucanase 2-like [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 94/124 (76%), Gaps = 5/124 (4%)
 Frame = +1

Query  223  MGDKSRSKGG-WCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK  399
            MG +  SKGG  CGW LV+IVA+AI   I + V+ K      +EP    VPGPPGA+  K
Sbjct  1    MGKEKESKGGGCCGWFLVIIVASAIVAGIVIAVRSKFHHSDKAEP----VPGPPGAIVTK  56

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  579
            Y DALK+A+QFFDVQKSG+LVDNKISWRG+S L+DG  A LDLSKGMYDAGD MKFGFPM
Sbjct  57   YSDALKLALQFFDVQKSGRLVDNKISWRGNSALEDGSEAKLDLSKGMYDAGDHMKFGFPM  116

Query  580  AYTA  591
            A+TA
Sbjct  117  AFTA  120



>ref|XP_009103373.1| PREDICTED: endoglucanase 2 [Brassica rapa]
Length=533

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 87/128 (68%), Gaps = 9/128 (7%)
 Frame = +1

Query  208  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  387
            KGGEKM  KS S+   C W L +IV  A+ +++   ++ +        P         G+
Sbjct  11   KGGEKMVAKSGSRCCCCCWFLGIIVVIAVVLAVVFTIRHRANHSDDVAP---------GS  61

Query  388  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
              +KY DALKIAMQFFD+QKSGKL +NKI WRGDSGLKDG  ASLDLSKG+YDAGD MKF
Sbjct  62   TDKKYADALKIAMQFFDIQKSGKLENNKIPWRGDSGLKDGSEASLDLSKGLYDAGDHMKF  121

Query  568  GFPMAYTA  591
            GFPMA+TA
Sbjct  122  GFPMAFTA  129



>emb|CDY66396.1| BnaAnng22170D [Brassica napus]
Length=533

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 87/128 (68%), Gaps = 9/128 (7%)
 Frame = +1

Query  208  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  387
            KGGEKM  KS S+   C W L +IV  A+ +++   ++ +        P         G+
Sbjct  11   KGGEKMVAKSGSRCCCCCWFLGIIVVIAVVLAVVFTIRHRANHSDDVAP---------GS  61

Query  388  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
              +KY DALKIAMQFFD+QKSGKL +NKI WRGDSGLKDG  ASLDLSKG+YDAGD MKF
Sbjct  62   TDKKYADALKIAMQFFDIQKSGKLENNKIPWRGDSGLKDGSEASLDLSKGLYDAGDHMKF  121

Query  568  GFPMAYTA  591
            GFPMA+TA
Sbjct  122  GFPMAFTA  129



>ref|XP_010471690.1| PREDICTED: endoglucanase 10 [Camelina sativa]
Length=525

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+SKG WCGW + +IV AA+ +++   VK +    G ++  + PVPGPPGA+ +KY
Sbjct  1    MGEKSKSKG-WCGWFIAIIVLAAVVLAVVYTVKSRMKKSGEAD-GSGPVPGPPGAIDKKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+++QFFD+QKSGKLV+NKI WRGDSGLKDG  A LDLSKG+YDAGD +KFGFPMA
Sbjct  59   ADALKLSLQFFDIQKSGKLVNNKIPWRGDSGLKDGSEADLDLSKGLYDAGDHIKFGFPMA  118

Query  583  YTA  591
            +TA
Sbjct  119  FTA  121



>ref|XP_010416457.1| PREDICTED: endoglucanase 10-like [Camelina sativa]
Length=525

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+SKG WCGW + +IV A + +++   VK +    G ++  + PVPGPPGA+ +KY
Sbjct  1    MGEKSKSKG-WCGWFIAIIVLAVVVLAVVYTVKSRMKKSGEAD-GSGPVPGPPGAIDKKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+++QFFD+QKSGKLV+NKI WRGDSGLKDG  A LDLSKG+YDAGD +KFGFPMA
Sbjct  59   ADALKLSLQFFDIQKSGKLVNNKIPWRGDSGLKDGSEADLDLSKGLYDAGDHIKFGFPMA  118

Query  583  YTA  591
            +TA
Sbjct  119  FTA  121



>ref|XP_007017775.1| EG isoform 1 [Theobroma cacao]
 gb|EOY15000.1| EG isoform 1 [Theobroma cacao]
Length=533

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 95/125 (76%), Gaps = 7/125 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  396
            MG +S+SKG   GW LV+++ A +  ++   +K+K  H     + P    VPGPPGA+ +
Sbjct  1    MGKESKSKGC-LGWFLVIVILALVVGAVVYAIKQKMDHSDDDKAAP----VPGPPGAIDK  55

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY DALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD MKFGFP
Sbjct  56   KYADALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGSEAKLDLSKGMYDAGDHMKFGFP  115

Query  577  MAYTA  591
            +A+TA
Sbjct  116  LAFTA  120



>ref|XP_007017776.1| EG isoform 2 [Theobroma cacao]
 gb|EOY15001.1| EG isoform 2 [Theobroma cacao]
Length=526

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 95/125 (76%), Gaps = 7/125 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  396
            MG +S+SKG   GW LV+++ A +  ++   +K+K  H     + P    VPGPPGA+ +
Sbjct  1    MGKESKSKGC-LGWFLVIVILALVVGAVVYAIKQKMDHSDDDKAAP----VPGPPGAIDK  55

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY DALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD MKFGFP
Sbjct  56   KYADALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGSEAKLDLSKGMYDAGDHMKFGFP  115

Query  577  MAYTA  591
            +A+TA
Sbjct  116  LAFTA  120



>ref|XP_010428595.1| PREDICTED: endoglucanase 10-like [Camelina sativa]
Length=525

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+SKG WCGW + +IV AA+ +++   VK +    G ++  + PVPGPPGA+ +KY
Sbjct  1    MGEKSKSKG-WCGWFIAIIVLAAVVLAVVYTVKSRMKKSGDAD-GSGPVPGPPGAIDKKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+++QFFD+QKSGKLV+NKI WRGDSGLKDG  A LDLSKG+YDAGD +KFGFPMA
Sbjct  59   ADALKLSLQFFDIQKSGKLVNNKIPWRGDSGLKDGSEADLDLSKGLYDAGDHIKFGFPMA  118

Query  583  YTA  591
            +TA
Sbjct  119  FTA  121



>gb|EPS64495.1| hypothetical protein M569_10284, partial [Genlisea aurea]
Length=530

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 103/123 (84%), Gaps = 7/123 (6%)
 Frame = +1

Query  232  KSRSKGGWCGWLLvvivaaaigvsifvLVKKK-HGGGGSSEP--DaapvpgppgavTQKY  402
            + R  GGWCGW LV+IV A++G+++F++VK+K H     S+P  +AAPVPGPPGAV  KY
Sbjct  1    EKRGGGGWCGWFLVLIVLASVGLAVFLVVKQKIH----KSQPPGEAAPVPGPPGAVVAKY  56

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALKIAMQF D+QKSGKL++N+++WRGDSGL+DG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  57   SDALKIAMQFLDIQKSGKLMNNEVAWRGDSGLQDGSEANLDLSKGMYDAGDHMKFGFPMA  116

Query  583  YTA  591
            +TA
Sbjct  117  FTA  119



>ref|XP_008387935.1| PREDICTED: endoglucanase 2 [Malus domestica]
Length=526

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/67 (88%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
            TQKY  ALK+A+QFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD MKFG
Sbjct  54   TQKYSAALKVAVQFFDVQKSGKLVDNKISWRGDSGLKDGSDAKLDLSKGMYDAGDHMKFG  113

Query  571  FPMAYTA  591
            FPMAYTA
Sbjct  114  FPMAYTA  120



>gb|EYU36779.1| hypothetical protein MIMGU_mgv1a004472mg [Erythranthe guttata]
Length=525

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 96/124 (77%), Gaps = 6/124 (5%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK-HGGGGSSEPDaapvpgppgavTQK  399
            MG+K++S+G WCGW L  IV AA+  ++F  +++K H     + P    +PGPPGA+T+K
Sbjct  1    MGEKNKSRG-WCGWFLAFIVLAAVAFALFFTLRQKFHKSDSGAAP----IPGPPGAITKK  55

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  579
            Y DALKIA QF D+QKSGKLV+N+ISWRGDS LKDG   +LDLSKGMYDAGD +KFGFPM
Sbjct  56   YADALKIASQFLDIQKSGKLVNNQISWRGDSALKDGNQENLDLSKGMYDAGDHVKFGFPM  115

Query  580  AYTA  591
            A+TA
Sbjct  116  AFTA  119



>ref|XP_009128120.1| PREDICTED: endoglucanase 10 [Brassica rapa]
 ref|XP_009128121.1| PREDICTED: endoglucanase 10 [Brassica rapa]
Length=526

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG++     GWCGW + +IV AA+ +++  +VK K       +  A PVPGPPGA+ +KY
Sbjct  1    MGEEKSKSRGWCGWFIALIVLAAVILAVVYMVKSKMKKSDDGD-GAGPVPGPPGAIDKKY  59

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+++QFFD+QKSGKLV+NKISWRGDSGLKDG  A LDLSKG+YDAGD +KFGFPMA
Sbjct  60   ADALKLSLQFFDIQKSGKLVNNKISWRGDSGLKDGSEADLDLSKGLYDAGDHIKFGFPMA  119

Query  583  YTA  591
            +TA
Sbjct  120  FTA  122



>ref|XP_011074667.1| PREDICTED: endoglucanase 10-like [Sesamum indicum]
Length=525

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 95/121 (79%), Gaps = 3/121 (2%)
 Frame = +1

Query  229  DKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGD  408
            ++ R   GWCGW LV+IV AAI  +IF  V++K      SEP AAPVPGPPGAVT+KY D
Sbjct  2    EEKRGSRGWCGWFLVLIVLAAIAFAIFYAVRQKQH---KSEPGAAPVPGPPGAVTKKYAD  58

Query  409  ALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYT  588
            ALK+AMQF D+QKSGKL +N I WRGDSGLKDG  A +DLSKGMYDAGD MKFGFPMA+T
Sbjct  59   ALKVAMQFLDIQKSGKLENNNIPWRGDSGLKDGSEAQVDLSKGMYDAGDHMKFGFPMAFT  118

Query  589  A  591
            A
Sbjct  119  A  119



>dbj|BAF42037.1| cellulase2 [Pyrus communis]
Length=526

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 93/127 (73%), Gaps = 11/127 (9%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvi----vaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgav  390
            MG KSR KG W  WLLV+     V  A+ +++   VKK  GG   + P      GPPGA+
Sbjct  1    MGAKSRCKG-WWAWLLVLAIFGLVVGAVVLAVVKKVKKNSGGDDGAVP------GPPGAI  53

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
            TQKY DALK+A+QFFDVQKSG+LVDNKISWRGDSGLKDG    LDLSKGMYDAGD MKFG
Sbjct  54   TQKYSDALKLAVQFFDVQKSGQLVDNKISWRGDSGLKDGSDVRLDLSKGMYDAGDQMKFG  113

Query  571  FPMAYTA  591
            FPMAYTA
Sbjct  114  FPMAYTA  120



>ref|XP_010536354.1| PREDICTED: endoglucanase 10-like [Tarenaya hassleriana]
Length=524

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 98/125 (78%), Gaps = 7/125 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  396
            MG KSR +G  CGW + +IV AA+ +++   ++KK  H   G  +P    VPGPPGAV +
Sbjct  1    MGAKSRRRG-LCGWFIALIVLAAVVLAVVYTIRKKTGHSDDGGDDP----VPGPPGAVDK  55

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY DAL+IA+QFFD+QKSGKL +NKISWRGDSGLKDGK A+LDLSKG+YDAGD MKFGFP
Sbjct  56   KYADALEIALQFFDIQKSGKLGNNKISWRGDSGLKDGKEANLDLSKGLYDAGDHMKFGFP  115

Query  577  MAYTA  591
            MA+TA
Sbjct  116  MAFTA  120



>ref|XP_008221286.1| PREDICTED: endoglucanase 10-like [Prunus mume]
Length=526

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 97/123 (79%), Gaps = 3/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG KSRSKG W   L++V++A  +   +  +VKKK     SS+ D  PVPGPPGA+TQKY
Sbjct  1    MGAKSRSKGCWAWLLVLVVLALVVTAIVVAIVKKK---SNSSDDDNGPVPGPPGAITQKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+A+QFFD+QKSGKLVDNKISWRGDSGLKDG    LDLSKGMYDAGD MKFGFPMA
Sbjct  58   SDALKLAVQFFDIQKSGKLVDNKISWRGDSGLKDGSDEKLDLSKGMYDAGDHMKFGFPMA  117

Query  583  YTA  591
            +TA
Sbjct  118  FTA  120



>emb|CDY43425.1| BnaC07g14920D [Brassica napus]
Length=533

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 87/128 (68%), Gaps = 9/128 (7%)
 Frame = +1

Query  208  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  387
            KGGEKM  KS S+   C W L +IV  A+ +++   ++ +        P         G+
Sbjct  11   KGGEKMVAKSGSRCCCCCWFLGIIVVIAVVLAVVFTIRHRANHSDDIAP---------GS  61

Query  388  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
              +KY DALKIAMQFF++QKSGKL +NKI WRGDSGLKDG  ASLDLSKG+YDAGD MKF
Sbjct  62   TDKKYADALKIAMQFFNIQKSGKLENNKIPWRGDSGLKDGSEASLDLSKGLYDAGDHMKF  121

Query  568  GFPMAYTA  591
            GFPMA+TA
Sbjct  122  GFPMAFTA  129



>gb|EYU38839.1| hypothetical protein MIMGU_mgv1a004578mg [Erythranthe guttata]
Length=519

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 83/123 (67%), Gaps = 10/123 (8%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M  + RS  G CGW LV+IV A I  ++F ++K K  G GS                +KY
Sbjct  1    MKQRKRSSSGCCGWFLVIIVLAGIAFAVFAVLKHKTWGSGSP----------ALGDPKKY  50

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALKIAMQFFD+QKSGKL +N+I WRGDS LKDG  A +DLSKGMYDAGD MKFGFPMA
Sbjct  51   SDALKIAMQFFDIQKSGKLDENQIPWRGDSALKDGSEAKIDLSKGMYDAGDHMKFGFPMA  110

Query  583  YTA  591
            +TA
Sbjct  111  FTA  113



>emb|CDY39048.1| BnaA02g17370D [Brassica napus]
Length=526

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG++     GWCGW + +IV AA+ +++  +VK K       +  A PVPGPPGA+ +KY
Sbjct  1    MGEEKSKSRGWCGWFIALIVLAAVILAVVYMVKSKMKKSDDGD-GAGPVPGPPGAIDKKY  59

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+++QFFD+QKSG+LV+NKISWRGDSGLKDG  A LDLSKG+YDAGD +KFGFPMA
Sbjct  60   ADALKLSLQFFDIQKSGRLVNNKISWRGDSGLKDGSEADLDLSKGLYDAGDHIKFGFPMA  119

Query  583  YTA  591
            +TA
Sbjct  120  FTA  122



>ref|XP_002889037.1| hypothetical protein ARALYDRAFT_895440 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65296.1| hypothetical protein ARALYDRAFT_895440 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 97/123 (79%), Gaps = 2/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+S+G WCGW + +IV A++ +++   VK +    G       PVPGPPGA+ +KY
Sbjct  1    MGEKSKSRG-WCGWFIAIIVLASVVLAVVYTVKLRMKKSGDDG-GGGPVPGPPGAIDKKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+A+QFFD+QKSGKL +NKISWRGDSGLKDG  A+LDLSKG+YDAGD +KFGFPMA
Sbjct  59   ADALKLALQFFDIQKSGKLANNKISWRGDSGLKDGSEANLDLSKGLYDAGDHIKFGFPMA  118

Query  583  YTA  591
            +TA
Sbjct  119  FTA  121



>gb|KFK44119.1| hypothetical protein AALP_AA1G218000 [Arabis alpina]
Length=517

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            +KY DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  ASLDLSKG+YDAGD MKFGF
Sbjct  48   KKYSDALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGSEASLDLSKGLYDAGDHMKFGF  107

Query  574  PMAYTA  591
            PMA+TA
Sbjct  108  PMAFTA  113



>ref|XP_010459672.1| PREDICTED: endoglucanase 2 [Camelina sativa]
 ref|XP_010459674.1| PREDICTED: endoglucanase 2 [Camelina sativa]
Length=518

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 87/123 (71%), Gaps = 9/123 (7%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M  K +S+   C WL+ +IV  A+ +++ +  + +    G  +P         G++ +KY
Sbjct  1    MVAKPKSRCCCCTWLIGIIVLIAVILAVVLTFRHRSNHSGDDQP---------GSIDKKY  51

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALKIAMQFFD+QKSGKL +NKISWRGDSGLKDG  AS+DLSKG+YDAGD MKFGFPMA
Sbjct  52   ADALKIAMQFFDIQKSGKLENNKISWRGDSGLKDGSEASIDLSKGLYDAGDHMKFGFPMA  111

Query  583  YTA  591
            +TA
Sbjct  112  FTA  114



>ref|XP_010061046.1| PREDICTED: endoglucanase 10-like [Eucalyptus grandis]
 gb|KCW67943.1| hypothetical protein EUGRSUZ_F01640 [Eucalyptus grandis]
Length=528

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 6/125 (5%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  396
            MG + RS GGWCGWLLV+++ A +  ++ V VKK+  HGGGG    +AAPVPGPPGAV +
Sbjct  1    MGAEKRS-GGWCGWLLVLLILAVVAAAVVVTVKKRSGHGGGGD---EAAPVPGPPGAVQK  56

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY DALK+A QFFD+QKSGKL DN ISWRG+S LKDG  A +DLSKGM+DAGD MKFGFP
Sbjct  57   KYADALKLATQFFDIQKSGKLEDNPISWRGNSALKDGSDADIDLSKGMFDAGDHMKFGFP  116

Query  577  MAYTA  591
            +A+TA
Sbjct  117  LAFTA  121



>ref|XP_002276739.1| PREDICTED: endoglucanase 10 [Vitis vinifera]
 emb|CBI19843.3| unnamed protein product [Vitis vinifera]
Length=525

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 95/123 (77%), Gaps = 5/123 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG +S+SKG WCGW +V++VAA +   I + ++K+      + P    VPGPPGA+ +KY
Sbjct  1    MGQRSKSKG-WCGWFIVLVVAALVAAVIVISIRKRSDHSDKAAP----VPGPPGAIDKKY  55

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+AMQFFD+QKSGKL +NKISWRG+S L+DG  A LDLSKGMYDAGD +KFGFPMA
Sbjct  56   SDALKLAMQFFDIQKSGKLENNKISWRGNSALQDGSEAKLDLSKGMYDAGDHIKFGFPMA  115

Query  583  YTA  591
            +TA
Sbjct  116  FTA  118



>emb|CDY13546.1| BnaC02g23570D [Brassica napus]
Length=422

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 94/123 (76%), Gaps = 1/123 (1%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG++     G CGW + +IV  A+ +++  +VK K       +  A PVPGPPGA+ +KY
Sbjct  1    MGEEKSKSRGRCGWFIALIVLTAVILAVVYMVKSKMKKSDDGDG-AGPVPGPPGAIDKKY  59

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+++QFFD+QKSGKLVDNKISWRGDSGLKDG  A+LDLSKG+YDAGD +KFGFPMA
Sbjct  60   ADALKLSLQFFDIQKSGKLVDNKISWRGDSGLKDGSEANLDLSKGLYDAGDHIKFGFPMA  119

Query  583  YTA  591
            +TA
Sbjct  120  FTA  122



>ref|XP_010501531.1| PREDICTED: endoglucanase 2 [Camelina sativa]
Length=517

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 85/123 (69%), Gaps = 9/123 (7%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M  K RS+   C W + +IV  A+ +++ +  K +       +P         G++ +KY
Sbjct  1    MVAKPRSRCCCCTWFIGIIVLIAVILAVVLTFKHRSNHSDDDQP---------GSIDKKY  51

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALKIAMQFFD+QKSGKL +NKISWRGDSGLKDG  ASLDLSKG+YDAGD MKFGFPMA
Sbjct  52   ADALKIAMQFFDIQKSGKLENNKISWRGDSGLKDGSEASLDLSKGLYDAGDHMKFGFPMA  111

Query  583  YTA  591
            +TA
Sbjct  112  FTA  114



>ref|XP_006390284.1| hypothetical protein EUTSA_v10018397mg [Eutrema salsugineum]
 gb|ESQ27570.1| hypothetical protein EUTSA_v10018397mg [Eutrema salsugineum]
Length=524

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 99/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+S+G WCGWL+ +IV AA+ +++   VK +     S +  A PVPGPPGA+ +KY
Sbjct  1    MGEKSKSRG-WCGWLIAIIVLAAVVLAVVYTVKSRMKK--SDDDGAGPVPGPPGAIDKKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALKIA+QFFD+QKSGKL  NK+SWRGDSGLKDG  A+LDLSKG+YDAGD +KFGFPMA
Sbjct  58   ADALKIALQFFDIQKSGKLEKNKLSWRGDSGLKDGSEANLDLSKGLYDAGDHIKFGFPMA  117

Query  583  YTA  591
            +TA
Sbjct  118  FTA  120



>emb|CDX73186.1| BnaC06g36340D [Brassica napus]
Length=527

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 93/124 (75%), Gaps = 2/124 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppg-avTQK  399
            MG+KS+S+G + GW + +IV AA+ +++  +VK K      ++ D A     P  A+ +K
Sbjct  1    MGEKSKSRGCF-GWFIALIVLAAVILAVVYMVKSKMNKSDDNDDDEAGPVPGPPGAIDKK  59

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  579
            Y DALK+A+QFFD+QKSGKLV+N I WRGDSGLKDG  A+LDLSKG+YDAGD +KFGFPM
Sbjct  60   YADALKLALQFFDIQKSGKLVNNTIPWRGDSGLKDGSEANLDLSKGLYDAGDHIKFGFPM  119

Query  580  AYTA  591
            A+TA
Sbjct  120  AFTA  123



>ref|XP_010649048.1| PREDICTED: endoglucanase 24-like [Vitis vinifera]
 emb|CBI17386.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 81/124 (65%), Gaps = 7/124 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK-HGGGGSSEPDaapvpgppgavTQK  399
            M  + +   GWC W+LV+ +AA +  S  + +         SS PD            + 
Sbjct  1    METEPKKSKGWCWWILVLAIAAMVVASATLTIWSNGRHSKVSSVPDRPGKI------AEN  54

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  579
            Y DALKIA+QFFD+QKSGKLV+NKI WRGDSGL+DG+   LDLSKGMYDAGD MKFGFPM
Sbjct  55   YADALKIAIQFFDIQKSGKLVNNKIDWRGDSGLEDGREEMLDLSKGMYDAGDHMKFGFPM  114

Query  580  AYTA  591
            A+TA
Sbjct  115  AFTA  118



>gb|AAM63477.1| endo-beta-1,4-glucanase, putative [Arabidopsis thaliana]
Length=525

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 95/123 (77%), Gaps = 2/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M +KS+S+G WCGW + +IV A++ +++   VK +    G  +    PVPGPPGA+ +KY
Sbjct  1    MEEKSKSRG-WCGWFIAIIVLASVILAVVYTVKLRTKKSGDDD-GGCPVPGPPGAIDKKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+A+QFFD+QKSGKL +NKI WRGDSGLKDG   +LDLSKG+YDAGD +KFGFPMA
Sbjct  59   ADALKLALQFFDIQKSGKLENNKIPWRGDSGLKDGSEDNLDLSKGLYDAGDHIKFGFPMA  118

Query  583  YTA  591
            +TA
Sbjct  119  FTA  121



>ref|XP_011100152.1| PREDICTED: endoglucanase 24-like [Sesamum indicum]
Length=528

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             +KY DAL IA+QFFDVQKSGKLV N+ISWRGDSGL+DG+ A+LDLSKG+YDAGDLMKFG
Sbjct  55   VEKYSDALAIALQFFDVQKSGKLVKNRISWRGDSGLEDGQDANLDLSKGLYDAGDLMKFG  114

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  115  FPMAFTA  121



>ref|XP_010477219.1| PREDICTED: endoglucanase 2-like [Camelina sativa]
Length=517

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 85/123 (69%), Gaps = 9/123 (7%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M  K +S+   C W + +IV  A+ +++ +  K +       +P         G++ +KY
Sbjct  1    MVAKPKSRCCCCTWFIGIIVLIAVILAVVLTFKHRSNHSNDDQP---------GSIDKKY  51

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALKIAMQFFD+QKSGKL +NKISWRGDSGLKDG  AS+DLSKG+YDAGD MKFGFPMA
Sbjct  52   ADALKIAMQFFDIQKSGKLENNKISWRGDSGLKDGSEASIDLSKGLYDAGDHMKFGFPMA  111

Query  583  YTA  591
            +TA
Sbjct  112  FTA  114



>ref|XP_002510516.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF52703.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=523

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 92/123 (75%), Gaps = 5/123 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSRS+G +CGW +V +V   + V++   VKKK    G + P    VPGPPGAV +KY
Sbjct  1    MGEKSRSRG-FCGWFIVAVVLTIVVVAVVYTVKKKTHNSGDASP----VPGPPGAVEKKY  55

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DAL IAMQFFD+QKSGKLVDN ISWRGDS L DG  A  DLSKGMYDAGD MKFGFPMA
Sbjct  56   ADALNIAMQFFDIQKSGKLVDNGISWRGDSALDDGNEAKRDLSKGMYDAGDHMKFGFPMA  115

Query  583  YTA  591
            +TA
Sbjct  116  FTA  118



>ref|XP_007046716.1| EG [Theobroma cacao]
 gb|EOX90873.1| EG [Theobroma cacao]
Length=527

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
            ++KY DAL+IA+QFFD+QKSGKLVDN+ISWRGDSGL+DG   +LDLSKGMYDAGD MKFG
Sbjct  53   SKKYADALEIALQFFDIQKSGKLVDNRISWRGDSGLQDGSEGNLDLSKGMYDAGDTMKFG  112

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  113  FPMAFTA  119



>ref|XP_004291374.1| PREDICTED: endoglucanase 10-like [Fragaria vesca subsp. vesca]
Length=529

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 87/125 (70%), Gaps = 6/125 (5%)
 Frame = +1

Query  223  MGDKSRSKG-GWCGWLLvvivaaaig-vsifvLVKKKHGGGGSSEPDaapvpgppgavTQ  396
            MG K  SKG  W  W +V +V A I      V++KKK     +  P      GPPGAV  
Sbjct  1    MGAKQDSKGCKWLSWFIVFVVLAVIAGAVALVMIKKKQNDKDNEVP----TMGPPGAVVD  56

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY DALK AMQFFD+QKSGKLV+NKISWRGDSGLKDG+   +DLSKGMYDAGD MKFGFP
Sbjct  57   KYSDALKTAMQFFDIQKSGKLVNNKISWRGDSGLKDGEDVKVDLSKGMYDAGDHMKFGFP  116

Query  577  MAYTA  591
            MA+TA
Sbjct  117  MAFTA  121



>ref|XP_006435157.1| hypothetical protein CICLE_v10000849mg [Citrus clementina]
 gb|ESR48397.1| hypothetical protein CICLE_v10000849mg [Citrus clementina]
Length=524

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 89/124 (72%), Gaps = 7/124 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK-  399
            MG+KS+SKG + GW LV+++ A +  +I   +KKK     +S  D       P    +K 
Sbjct  1    MGEKSKSKGCF-GWFLVLVLLALVVGAIVYTIKKK-----TSHSDKPAPVPGPPGAVEKK  54

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  579
            Y +ALK+AMQFFDVQKSGKLV+NKISWRGDS LKDG+   LDL+KGMYDAGD MKFGFPM
Sbjct  55   YAEALKVAMQFFDVQKSGKLVNNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPM  114

Query  580  AYTA  591
            A+TA
Sbjct  115  AFTA  118



>gb|KDO84820.1| hypothetical protein CISIN_1g009846mg [Citrus sinensis]
Length=524

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 89/124 (72%), Gaps = 7/124 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK-  399
            MG+KS+SKG + GW LV+++ A +  +I   +KKK     +S  D       P    +K 
Sbjct  1    MGEKSKSKGCF-GWFLVLVLLALVVGAIVYTIKKK-----TSHSDKPAPVPGPPGAVEKK  54

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  579
            Y +ALK+AMQFFDVQKSGKLV+NKISWRGDS LKDG+   LDL+KGMYDAGD MKFGFPM
Sbjct  55   YAEALKVAMQFFDVQKSGKLVNNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPM  114

Query  580  AYTA  591
            A+TA
Sbjct  115  AFTA  118



>ref|XP_006473639.1| PREDICTED: endoglucanase 10-like [Citrus sinensis]
Length=524

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 89/124 (72%), Gaps = 7/124 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK-  399
            MG+KS+SKG + GW LV+++ A +  +I   +KKK     +S  D       P    +K 
Sbjct  1    MGEKSKSKGCF-GWFLVLVLLALVVGAIVYTIKKK-----TSHSDKPAPVPGPPGAVEKK  54

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  579
            Y +ALK+AMQFFDVQKSGKLV+NKISWRGDS LKDG+   LDL+KGMYDAGD MKFGFPM
Sbjct  55   YAEALKVAMQFFDVQKSGKLVNNKISWRGDSALKDGRDMGLDLTKGMYDAGDHMKFGFPM  114

Query  580  AYTA  591
            A+TA
Sbjct  115  AFTA  118



>ref|XP_006416450.1| hypothetical protein EUTSA_v10007364mg [Eutrema salsugineum]
 gb|ESQ34803.1| hypothetical protein EUTSA_v10007364mg [Eutrema salsugineum]
Length=523

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            +KY DALKIAMQFFD+QKSGKL +NKI WRGDSGLKDG  ASLDLSKG+YDAGD MKFGF
Sbjct  54   KKYADALKIAMQFFDIQKSGKLENNKIPWRGDSGLKDGNEASLDLSKGLYDAGDHMKFGF  113

Query  574  PMAYTA  591
            PMA+TA
Sbjct  114  PMAFTA  119



>emb|CDY29381.1| BnaA06g14150D [Brassica napus]
Length=548

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 87/123 (71%), Gaps = 2/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS S+   C W + +IV  A+ ++I   ++  H        D A +   PG++ + Y
Sbjct  1    MGEKSSSRCCCCIWFIGIIVLIAVVLAIVFTIR--HNKSNKHPDDGADIVPLPGSIDKNY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALKIAMQFFD+QKSGKL +NKI+WRGDSGL+DG  A LDLSKG+YDAGD MKFGFPMA
Sbjct  59   ADALKIAMQFFDIQKSGKLENNKITWRGDSGLEDGSEAGLDLSKGLYDAGDHMKFGFPMA  118

Query  583  YTA  591
            +TA
Sbjct  119  FTA  121



>ref|XP_009106216.1| PREDICTED: endoglucanase 10-like [Brassica rapa]
Length=527

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 93/124 (75%), Gaps = 2/124 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppg-avTQK  399
            MG+KS+S+G + GW + +IV AA+ +++  +VK K      ++ + A     P  A+ +K
Sbjct  1    MGEKSKSRGCF-GWFIALIVLAAVILAVVYMVKSKMKKPDDNDDNEAGPVPGPPGAIDKK  59

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  579
            Y DALK+A+QFFD+QKSGKLV+N I WRGDSGLKDG  A+LDLSKG+YDAGD +KFGFPM
Sbjct  60   YADALKLALQFFDIQKSGKLVNNTIPWRGDSGLKDGSEANLDLSKGLYDAGDHIKFGFPM  119

Query  580  AYTA  591
            A+TA
Sbjct  120  AFTA  123



>ref|XP_011083520.1| PREDICTED: endoglucanase 10 [Sesamum indicum]
Length=518

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 81/125 (65%), Gaps = 15/125 (12%)
 Frame = +1

Query  223  MGDKSRSKGGWCGW--LLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQ  396
            M  K +SKG  C W  L +V++A    + + V+VK   G G    P             +
Sbjct  1    MRQKKKSKGV-CCWSMLALVVLAIVAVILLVVMVKTDEGSGSPGAP------------VK  47

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY DALK+AMQFFDVQKSGKL  N+I WRGDSGLKDG  A LDLSKGMYDAGD MKFGFP
Sbjct  48   KYADALKLAMQFFDVQKSGKLEKNQIDWRGDSGLKDGSEAKLDLSKGMYDAGDHMKFGFP  107

Query  577  MAYTA  591
            MA+TA
Sbjct  108  MAFTA  112



>ref|XP_009398708.1| PREDICTED: endoglucanase 24-like [Musa acuminata subsp. malaccensis]
Length=524

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             QKY DAL +A+QFF VQKSGKLVDNKI+WRGDS L DGK A LDLSKGMYDAGD MKFG
Sbjct  51   NQKYADALGVALQFFQVQKSGKLVDNKITWRGDSALHDGKDAGLDLSKGMYDAGDHMKFG  110

Query  571  FPMAYTA  591
            FPMAYTA
Sbjct  111  FPMAYTA  117



>emb|CDP04112.1| unnamed protein product [Coffea canephora]
Length=373

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            +KY +AL +AMQFF+VQKSGKLVDNKI+WRGDSGL+DG+  +LDLSKGMYDAGD MKFGF
Sbjct  59   EKYANALGVAMQFFEVQKSGKLVDNKIAWRGDSGLQDGREENLDLSKGMYDAGDDMKFGF  118

Query  574  PMAYTA  591
            PMA+TA
Sbjct  119  PMAFTA  124



>gb|AAF79918.1|AC022472_27 Contains similarity to beta-1,4-glucanase 1 (EG1) from Mastotermes 
darwiniensis gb|AF220593 and is a member of glycosyl hydrolase 
family 9 PF|00759. This gene may be cut off, partial 
[Arabidopsis thaliana]
Length=300

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            + Y +ALKIAMQFFD+QKSGKL +N+ISWRGDSGLKDG  AS+DLSKG+YDAGD MKFGF
Sbjct  47   KNYANALKIAMQFFDIQKSGKLENNEISWRGDSGLKDGSEASIDLSKGLYDAGDHMKFGF  106

Query  574  PMAYTA  591
            PMA+TA
Sbjct  107  PMAFTA  112



>gb|KDP36939.1| hypothetical protein JCGZ_08230 [Jatropha curcas]
Length=523

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 91/123 (74%), Gaps = 5/123 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG KSRS+G + GW +V IV A +  ++   VKKK         DA  VPGPPGA+ +KY
Sbjct  1    MGKKSRSRGCF-GWFIVAIVLAVVVAAVVYTVKKKI----HKSDDAGAVPGPPGAIDKKY  55

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+AMQFFDVQKSG L DN+ISWRGDSG+ DG  A +DLSKGMYDAGD MKFGFPMA
Sbjct  56   ADALKVAMQFFDVQKSGNLEDNEISWRGDSGINDGSQAKVDLSKGMYDAGDHMKFGFPMA  115

Query  583  YTA  591
            +TA
Sbjct  116  FTA  118



>gb|AFZ78647.1| korrigan [Populus tomentosa]
Length=523

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            +KY DALKIA QFFD+QKSGKLVDNKISWRGDS L+DG  A LDLSKGMYDAGD MKFG 
Sbjct  53   KKYADALKIATQFFDIQKSGKLVDNKISWRGDSALRDGSQAKLDLSKGMYDAGDHMKFGL  112

Query  574  PMAYTA  591
            PMA+TA
Sbjct  113  PMAFTA  118



>ref|NP_177697.1| glycosyl hydrolase 9B7 [Arabidopsis thaliana]
 sp|Q8LCP6.2|GUN10_ARATH RecName: Full=Endoglucanase 10; AltName: Full=Endo-1,4-beta glucanase 
10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF87112.1|AC006434_8 F10A5.13 [Arabidopsis thaliana]
 gb|AAK64042.1| putative endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AAN12892.1| putative endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AEE35745.1| glycosyl hydrolase 9B7 [Arabidopsis thaliana]
Length=525

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 95/123 (77%), Gaps = 2/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M +KS+S+G WCGW + +IV A++ +++   VK +    G  +    PVPGPPGA+ +KY
Sbjct  1    MEEKSKSRG-WCGWFIAIIVLASVILAVVYTVKLRTKKSGDDD-GGGPVPGPPGAIDKKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALK+A+QFFD+QKSGKL +NKI WRGDSGLKDG   +LDLSKG+YDAGD +KFGFPMA
Sbjct  59   ADALKLALQFFDIQKSGKLENNKIPWRGDSGLKDGSEDNLDLSKGLYDAGDHIKFGFPMA  118

Query  583  YTA  591
            +TA
Sbjct  119  FTA  121



>ref|XP_011045112.1| PREDICTED: endoglucanase 2 [Populus euphratica]
Length=523

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            +KY DALKIA QFFD+QKSGKLVDNKISWRGDS L+DG  A LDLSKGMYDAGD MKFG 
Sbjct  53   KKYADALKIATQFFDIQKSGKLVDNKISWRGDSALRDGSQAKLDLSKGMYDAGDHMKFGL  112

Query  574  PMAYTA  591
            PMA+TA
Sbjct  113  PMAFTA  118



>gb|KDP46724.1| hypothetical protein JCGZ_06512 [Jatropha curcas]
Length=538

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             +KY DAL++A+QFFDVQKSGKLVDN+I+WRGDSGL+DG+   LDLSKG+YDAGDL+KFG
Sbjct  64   VKKYADALEVALQFFDVQKSGKLVDNRIAWRGDSGLQDGRQQGLDLSKGIYDAGDLIKFG  123

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  124  FPMAFTA  130



>ref|XP_011043209.1| PREDICTED: endoglucanase 2-like [Populus euphratica]
Length=530

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             +KY DAL+IA+QFFDVQKSGKLV+N+I WRGDSGL DG   +LDLSKGMYDAGDLMKFG
Sbjct  56   VKKYADALEIALQFFDVQKSGKLVNNRIVWRGDSGLLDGIEMNLDLSKGMYDAGDLMKFG  115

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  116  FPMAFTA  122



>ref|XP_006307252.1| hypothetical protein CARUB_v10008868mg [Capsella rubella]
 gb|EOA40150.1| hypothetical protein CARUB_v10008868mg [Capsella rubella]
Length=517

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            +KY DALKIA+QFFD+QKSGKL +NKISWRGDSGLKDG  AS+DLSKG+YDAGD MKFGF
Sbjct  48   KKYADALKIALQFFDIQKSGKLENNKISWRGDSGLKDGSDASIDLSKGLYDAGDHMKFGF  107

Query  574  PMAYTA  591
            PMA+T 
Sbjct  108  PMAFTT  113



>ref|XP_004957464.1| PREDICTED: endoglucanase 24-like [Setaria italica]
Length=528

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = +1

Query  235  SRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGDAL  414
            S+   G CGWL+V ++AA +  +    + K+  GGG       PVPGPPGA+  KYGDAL
Sbjct  3    SKYTRGCCGWLIVALIAALVATAAMFAIMKRKPGGGGKHLKPLPVPGPPGAIDSKYGDAL  62

Query  415  KIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
             +A+QFF VQKSGKL +N+I WRGDS L DGK A LDLSKGMYDAGD MKF FPMA+TA
Sbjct  63   GVALQFFQVQKSGKLENNQIPWRGDSALTDGKEAGLDLSKGMYDAGDHMKFTFPMAFTA  121



>gb|KJB14408.1| hypothetical protein B456_002G123700 [Gossypium raimondii]
Length=529

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 95/123 (77%), Gaps = 3/123 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG +S+S+G + GWLLV+++ A +  ++  ++KKK   G  ++P   PVPGPPGA+  KY
Sbjct  1    MGKESKSRG-FFGWLLVLVILALVVGAVVYIIKKKLDHGNDNKP--TPVPGPPGAIDHKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
              AL+IAMQFFDVQKSG+LVDNKISWRGDS L DG  A LDLSKGMY AGD +KFGFPMA
Sbjct  58   AYALEIAMQFFDVQKSGRLVDNKISWRGDSALTDGSEAKLDLSKGMYVAGDHVKFGFPMA  117

Query  583  YTA  591
            +TA
Sbjct  118  FTA  120



>gb|KJB43353.1| hypothetical protein B456_007G195700, partial [Gossypium raimondii]
Length=521

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            +KY DAL++A+QFFDVQKSGKLVDN+I WRGDSGL+DG   +LDLSKGMYDAGD +KFGF
Sbjct  55   KKYADALELALQFFDVQKSGKLVDNRIPWRGDSGLQDGSEENLDLSKGMYDAGDAIKFGF  114

Query  574  PMAYTA  591
            PMA+TA
Sbjct  115  PMAFTA  120



>gb|KJB58120.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=522

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 86/123 (70%), Gaps = 7/123 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKESKS-GGCLGWLLAIVILALVVGAIVYAVKQKIDHANDNKPSPVPGPPGAID--KKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
             DALKIAMQFFD+QK    ++NKISWRGDSGLKDG  A+LDLSKGMYDAGD MKFGFPMA
Sbjct  58   ADALKIAMQFFDIQK----LNNKISWRGDSGLKDGNEANLDLSKGMYDAGDHMKFGFPMA  113

Query  583  YTA  591
            +TA
Sbjct  114  FTA  116



>ref|NP_173423.1| glycosyl hydrolase 9B5 [Arabidopsis thaliana]
 sp|Q9FXI9.1|GUN2_ARATH RecName: Full=Endoglucanase 2; AltName: Full=Endo-1,4-beta glucanase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG12562.1|AC007797_22 Similar to endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AAK82507.1| At1g19940/F6F9_1 [Arabidopsis thaliana]
 gb|AAM47371.1| At1g19940/F6F9_1 [Arabidopsis thaliana]
 gb|AEE29915.1| probably endoglucanase [Arabidopsis thaliana]
Length=515

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            + Y +ALKIAMQFFD+QKSGKL +N+ISWRGDSGLKDG  AS+DLSKG+YDAGD MKFGF
Sbjct  47   KNYANALKIAMQFFDIQKSGKLENNEISWRGDSGLKDGSEASIDLSKGLYDAGDHMKFGF  106

Query  574  PMAYTA  591
            PMA+TA
Sbjct  107  PMAFTA  112



>ref|XP_002893081.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69340.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=516

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            + Y +ALKIAMQFFD+QKSGKL +NKISWRGDSGLKDG  A++DLSKG+YDAGD MKFGF
Sbjct  48   KNYANALKIAMQFFDIQKSGKLENNKISWRGDSGLKDGSEANIDLSKGLYDAGDHMKFGF  107

Query  574  PMAYTA  591
            PMA+TA
Sbjct  108  PMAFTA  113



>gb|KHN21266.1| Endoglucanase 24 [Glycine soja]
Length=185

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            QKY  ALK AMQFFDVQKSG+LVD+KISWRG+S LKDG  A LDLSKGMYDAGD MKFGF
Sbjct  66   QKYRTALKTAMQFFDVQKSGRLVDSKISWRGNSALKDGSQAKLDLSKGMYDAGDNMKFGF  125

Query  574  PMAYTA  591
             MA+TA
Sbjct  126  SMAFTA  131



>ref|XP_009149490.1| PREDICTED: endoglucanase 2 [Brassica rapa]
 ref|XP_009149491.1| PREDICTED: endoglucanase 2 [Brassica rapa]
Length=525

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            + Y DALKIAMQFFD+QKSGKL +NKI+WRGDSGL+DG  A LDLSKG+YDAGD MKFGF
Sbjct  56   KNYADALKIAMQFFDIQKSGKLENNKITWRGDSGLEDGSEAGLDLSKGLYDAGDHMKFGF  115

Query  574  PMAYTA  591
            PMA+TA
Sbjct  116  PMAFTA  121



>gb|AID55379.1| glycoside hydrolase family 9 B7 [Gossypium hirsutum]
Length=525

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY DALKIAMQFFDVQKSGKLVD+KI WRG+SGLKDG  A LDLS GMYDAGD +KFGFP
Sbjct  53   KYSDALKIAMQFFDVQKSGKLVDDKIPWRGNSGLKDGSEAKLDLSMGMYDAGDNIKFGFP  112

Query  577  MAYTA  591
            MA+TA
Sbjct  113  MAFTA  117



>gb|EEC84946.1| hypothetical protein OsI_32163 [Oryza sativa Indica Group]
Length=528

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 91/124 (73%), Gaps = 4/124 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaa-aigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK  399
            MG K++   G CGWL+V +VA+     ++  ++KKK GGG   +    PVPGPPGA+  K
Sbjct  1    MGSKTK---GCCGWLIVALVASLVATAAVVAIMKKKAGGGSGRKLKPLPVPGPPGAIDSK  57

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  579
            YGDAL +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD +KF FPM
Sbjct  58   YGDALGVALQFFQVQKAGKLENNQIPWRGDSALDDGKPAGLDLSKGMYDAGDHIKFSFPM  117

Query  580  AYTA  591
            A+TA
Sbjct  118  AFTA  121



>gb|KJB63540.1| hypothetical protein B456_010G005200 [Gossypium raimondii]
Length=525

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY DALKIAMQFFDVQKSGKLVD+KI WRG+SGLKDG  A LDLS GMYDAGD +KFGFP
Sbjct  53   KYSDALKIAMQFFDVQKSGKLVDDKIPWRGNSGLKDGSEAKLDLSMGMYDAGDNIKFGFP  112

Query  577  MAYTA  591
            MA+TA
Sbjct  113  MAFTA  117



>ref|XP_002307711.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE94707.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|AEO97189.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97216.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=523

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            +KY DALKIA QFFD+QKSGKLVD KISWRGDS L+DG  A LDLSKGMYDAGD MKFG 
Sbjct  53   KKYADALKIATQFFDIQKSGKLVDKKISWRGDSALRDGSQAKLDLSKGMYDAGDHMKFGL  112

Query  574  PMAYTA  591
            PMA+TA
Sbjct  113  PMAFTA  118



>emb|CDY47506.1| BnaAnng09040D [Brassica napus]
Length=499

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY DALK+A+QFFD+QKSGKLV+N I WRGDSGLKDG  A+LDLSKG+YDAGD +KFGFP
Sbjct  31   KYADALKLALQFFDIQKSGKLVNNTIPWRGDSGLKDGSEANLDLSKGLYDAGDHIKFGFP  90

Query  577  MAYTA  591
            MA+TA
Sbjct  91   MAFTA  95



>ref|NP_001063771.1| Os09g0533900 [Oryza sativa Japonica Group]
 sp|Q69SG5.1|GUN24_ORYSJ RecName: Full=Endoglucanase 24; AltName: Full=Endo-1,4-beta glucanase 
24; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD33331.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAF25685.1| Os09g0533900 [Oryza sativa Japonica Group]
 dbj|BAG94612.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGW30395.1| cellulase [Oryza sativa]
Length=528

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 91/124 (73%), Gaps = 4/124 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaa-aigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK  399
            MG K++   G CGWL+V +VA+     ++  ++KKK GGG   +    PVPGPPGA+  K
Sbjct  1    MGSKTK---GCCGWLIVALVASLVATAAVVAIMKKKVGGGSGRKLKPLPVPGPPGAIDSK  57

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  579
            YGDAL +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD +KF FPM
Sbjct  58   YGDALGVALQFFQVQKAGKLENNQIPWRGDSALDDGKPAGLDLSKGMYDAGDHIKFSFPM  117

Query  580  AYTA  591
            A+TA
Sbjct  118  AFTA  121



>gb|EEE70113.1| hypothetical protein OsJ_30126 [Oryza sativa Japonica Group]
Length=528

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 91/124 (73%), Gaps = 4/124 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsi-fvLVKKKHGGGGSSEPDaapvpgppgavTQK  399
            MG K++   G CGWL+V +VA+ +  +    ++KKK GGG   +    PVPGPPGA+  K
Sbjct  1    MGSKTK---GCCGWLIVALVASLVATAALVAIMKKKVGGGSGRKLKPLPVPGPPGAIDSK  57

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPM  579
            YGDAL +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD +KF FPM
Sbjct  58   YGDALGVALQFFQVQKAGKLENNQIPWRGDSALDDGKPAGLDLSKGMYDAGDHIKFSFPM  117

Query  580  AYTA  591
            A+TA
Sbjct  118  AFTA  121



>gb|KCW56649.1| hypothetical protein EUGRSUZ_I02356 [Eucalyptus grandis]
Length=523

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            QKY DAL IAMQFFDVQKSG+LV+N+ISWRGDSGL DG    LDLSKGMYDAGD MKF F
Sbjct  50   QKYADALGIAMQFFDVQKSGQLVNNRISWRGDSGLMDGSGEGLDLSKGMYDAGDSMKFSF  109

Query  574  PMAYTA  591
            PMA+TA
Sbjct  110  PMAFTA  115



>ref|XP_010029690.1| PREDICTED: endoglucanase 2-like [Eucalyptus grandis]
Length=527

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            QKY DAL IAMQFFDVQKSG+LV+N+ISWRGDSGL DG    LDLSKGMYDAGD MKF F
Sbjct  54   QKYADALGIAMQFFDVQKSGQLVNNRISWRGDSGLMDGSGEGLDLSKGMYDAGDSMKFSF  113

Query  574  PMAYTA  591
            PMA+TA
Sbjct  114  PMAFTA  119



>ref|XP_008799407.1| PREDICTED: endoglucanase 24-like [Phoenix dactylifera]
Length=524

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
            TQKY +AL +A+QFF VQKSGKLV+NKI+WRGDS L DGK   +DLSKGMYDAGD MKFG
Sbjct  51   TQKYAEALSVALQFFQVQKSGKLVNNKITWRGDSALDDGKEEGVDLSKGMYDAGDHMKFG  110

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  111  FPMAFTA  117



>ref|XP_002462729.1| hypothetical protein SORBIDRAFT_02g030990 [Sorghum bicolor]
 gb|EER99250.1| hypothetical protein SORBIDRAFT_02g030990 [Sorghum bicolor]
Length=525

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 88/123 (72%), Gaps = 5/123 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG  +R   G CGWL+V ++AA +  +    + K+  GG   +P   PVPGPPGA+  KY
Sbjct  1    MGKYTR---GCCGWLIVALIAALVATAAMFAIMKRKPGGRHIKP--LPVPGPPGAIDSKY  55

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMA  582
            GDAL +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD MKF FPMA
Sbjct  56   GDALGVALQFFQVQKAGKLENNQIPWRGDSALTDGKEAGLDLSKGMYDAGDHMKFTFPMA  115

Query  583  YTA  591
            +TA
Sbjct  116  FTA  118



>ref|XP_003563568.1| PREDICTED: endoglucanase 18-like [Brachypodium distachyon]
Length=516

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 76/115 (66%), Gaps = 17/115 (15%)
 Frame = +1

Query  256  CGWLLvvivaaaigvsifvLVKKKHGGGG---SSEPDaapvpgppgavTQKYGDALKIAM  426
            C WLLV+ + A    +  V V+ K+GGGG   S +P              KY +AL +A+
Sbjct  8    CCWLLVLTLVALGITAAVVFVRHKNGGGGVPGSVDP--------------KYAEALAVAL  53

Query  427  QFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
            QFF VQKSGKLV N+I WRGDS + DG+ A LDLSKGMYDAGD +KFGFPMA+TA
Sbjct  54   QFFQVQKSGKLVKNEIPWRGDSAVDDGQEAGLDLSKGMYDAGDHIKFGFPMAFTA  108



>ref|NP_001145749.1| hypothetical protein [Zea mays]
 gb|ACL52523.1| unknown [Zea mays]
 tpg|DAA62473.1| TPA: hypothetical protein ZEAMMB73_855274 [Zea mays]
Length=526

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = +1

Query  235  SRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGDAL  414
            S+   G CGWL+V ++AA +  +    + K+  GG   +P   PVPGPPGA+  KYGDAL
Sbjct  3    SKYTRGCCGWLIVALIAALVATAAMFAIMKRKPGGRHIKP--LPVPGPPGAIDSKYGDAL  60

Query  415  KIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
             +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD MKF FPMA+TA
Sbjct  61   GVALQFFQVQKAGKLENNQIPWRGDSALTDGKEAGLDLSKGMYDAGDHMKFTFPMAFTA  119



>ref|XP_010935039.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
Length=520

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             QKY +AL +A+QFF VQKSGKLV+NKI WRGDSGL DGK   +DLSKGMYDAGD MKFG
Sbjct  47   NQKYAEALSVALQFFQVQKSGKLVNNKIPWRGDSGLDDGKEEKVDLSKGMYDAGDHMKFG  106

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  107  FPMAFTA  113



>ref|XP_006383120.1| hypothetical protein POPTR_0005s11750g [Populus trichocarpa]
 gb|ERP60917.1| hypothetical protein POPTR_0005s11750g [Populus trichocarpa]
Length=530

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             +KY DAL+IA+QFFD QKSGKLV+N+I WRGDSGL DG   +LDLSKGMYDAGDLMKFG
Sbjct  56   VKKYADALEIALQFFDGQKSGKLVNNRIGWRGDSGLLDGIEMNLDLSKGMYDAGDLMKFG  115

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  116  FPMAFTA  122



>gb|AEO97190.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97217.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=530

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             +KY DAL+IA+QFFD QKSGKLV+N+I WRGDSGL DG   +LDLSKGMYDAGDLMKFG
Sbjct  56   VKKYADALEIALQFFDGQKSGKLVNNRIGWRGDSGLLDGIEMNLDLSKGMYDAGDLMKFG  115

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  116  FPMAFTA  122



>ref|XP_010113364.1| Endoglucanase 24 [Morus notabilis]
 gb|EXC35371.1| Endoglucanase 24 [Morus notabilis]
Length=544

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            +Y  AL+IAMQFFDVQKSGKLVDN+I WRGDSGL+DG   +LDLSKGMYDAGDL+KFGFP
Sbjct  61   QYAKALEIAMQFFDVQKSGKLVDNRIWWRGDSGLQDGIDQNLDLSKGMYDAGDLVKFGFP  120

Query  577  MAYTA  591
            +A+TA
Sbjct  121  LAFTA  125



>ref|XP_004232483.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
Length=526

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             +KY +AL IAMQFFDVQKSGKLV+NKI+WRGDS + DG   +LDLS+GMYDAGD +KFG
Sbjct  50   VEKYANALSIAMQFFDVQKSGKLVNNKIAWRGDSAMGDGSEVNLDLSRGMYDAGDHVKFG  109

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  110  FPMAFTA  116



>ref|XP_009378180.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
 ref|XP_009378181.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
Length=537

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY +AL+I+MQFFD QKSGKLVDN I WRGDSGL+DG    LDLSKG+YDAGDL+KFGFP
Sbjct  65   KYSEALQISMQFFDAQKSGKLVDNPIPWRGDSGLQDGSEEDLDLSKGLYDAGDLIKFGFP  124

Query  577  MAYTA  591
            MA+TA
Sbjct  125  MAFTA  129



>ref|XP_006340729.1| PREDICTED: endoglucanase 2-like [Solanum tuberosum]
Length=526

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY +AL IAMQFFDVQKSGKLV+NKI+WRGDS L DG   +LDLS+GMYDAGD +KFGFP
Sbjct  52   KYANALSIAMQFFDVQKSGKLVNNKIAWRGDSALGDGSEVNLDLSRGMYDAGDHVKFGFP  111

Query  577  MAYTA  591
            MA+TA
Sbjct  112  MAFTA  116



>gb|KDO84821.1| hypothetical protein CISIN_1g036398mg [Citrus sinensis]
Length=514

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
              Y  ALKIAMQFFD+QKSGKLV+N+I WRGDSGLKDGK   LDLSKGMYDAGD +KFGF
Sbjct  43   HNYVAALKIAMQFFDIQKSGKLVNNQIKWRGDSGLKDGKEVDLDLSKGMYDAGDAVKFGF  102

Query  574  PMAYTA  591
            P+A+TA
Sbjct  103  PLAFTA  108



>gb|KDO78852.1| hypothetical protein CISIN_1g048736mg [Citrus sinensis]
Length=550

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             + Y +AL I+MQFFDVQKSGKLV+NKI WRGDS L DG   +LDLSKG+YDAGDLMKFG
Sbjct  76   VENYANALGISMQFFDVQKSGKLVNNKIVWRGDSALHDGSEENLDLSKGLYDAGDLMKFG  135

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  136  FPMAFTA  142



>ref|XP_006426144.1| hypothetical protein CICLE_v10025306mg [Citrus clementina]
 gb|ESR39384.1| hypothetical protein CICLE_v10025306mg [Citrus clementina]
Length=550

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             + Y +AL I+MQFFDVQKSGKLV+NKI WRGDS L DG   +LDLSKG+YDAGDLMKFG
Sbjct  76   VENYANALGISMQFFDVQKSGKLVNNKIVWRGDSALHDGSEENLDLSKGLYDAGDLMKFG  135

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  136  FPMAFTA  142



>ref|XP_006466419.1| PREDICTED: endoglucanase 2-like [Citrus sinensis]
Length=551

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             + Y +AL I+MQFFDVQKSGKLV+NKI WRGDS L DG   +LDLSKG+YDAGDLMKFG
Sbjct  77   VENYANALGISMQFFDVQKSGKLVNNKIVWRGDSALHDGSEENLDLSKGLYDAGDLMKFG  136

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  137  FPMAFTA  143



>ref|XP_008372790.1| PREDICTED: endoglucanase 24-like [Malus domestica]
Length=537

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY +AL+I+MQFFD QKSGKLVDN I WRGDSGL+DG    LDLSKG+YDAGDL+KFGFP
Sbjct  65   KYSEALQISMQFFDAQKSGKLVDNPIPWRGDSGLQDGSEDDLDLSKGLYDAGDLIKFGFP  124

Query  577  MAYTA  591
            MA+TA
Sbjct  125  MAFTA  129



>ref|XP_009386441.1| PREDICTED: endoglucanase 24-like [Musa acuminata subsp. malaccensis]
Length=523

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            QKY  AL +A+QFF +QKSGKLV+NK SWRGDS L DGK A LDLSKGMYD+GD MKFGF
Sbjct  51   QKYASALAVALQFFQLQKSGKLVNNKFSWRGDSALDDGKEAGLDLSKGMYDSGDHMKFGF  110

Query  574  PMAYTA  591
            PMAYTA
Sbjct  111  PMAYTA  116



>ref|XP_008241905.1| PREDICTED: endoglucanase 24-like [Prunus mume]
Length=533

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             QKY +AL+++MQFFD+QKSGKLVDN I WRGDSGL+DG    LDLSKG+YD+GDL+KFG
Sbjct  59   VQKYSEALQLSMQFFDIQKSGKLVDNPIPWRGDSGLQDGSEEDLDLSKGLYDSGDLIKFG  118

Query  571  FPMAYT  588
            FPMA+T
Sbjct  119  FPMAFT  124



>ref|XP_008788648.1| PREDICTED: endoglucanase 24 [Phoenix dactylifera]
Length=524

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             QKY +AL +A+QFF VQKSGKLV+N+I WRGDSGL DGK   +DLSKGMYDAGD MKFG
Sbjct  51   NQKYAEALSVALQFFQVQKSGKLVNNEIPWRGDSGLDDGKEEKVDLSKGMYDAGDHMKFG  110

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  111  FPMAFTA  117



>ref|XP_010941260.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941261.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941262.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941263.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941264.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
Length=524

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
            TQKY DAL +A+QFF VQKSG+LV+NKI WRG+S L DGK   +DLSKGMYDAGD MKFG
Sbjct  51   TQKYADALSVALQFFQVQKSGQLVNNKIPWRGNSALDDGKEEGVDLSKGMYDAGDHMKFG  110

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  111  FPMAFTA  117



>ref|XP_003519870.1| PREDICTED: endoglucanase 24-like [Glycine max]
Length=535

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 82/128 (64%), Gaps = 3/128 (2%)
 Frame = +1

Query  208  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  387
            K  +K  +K    G  C WL V I+A  + V+  + +  K   G S+ P+    P     
Sbjct  4    KVNDKEPNKKHYVGALCWWLTVSIIAVLVVVAGVLSLITKFKFGHSNSPEFTSHPTNV--  61

Query  388  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
              QKY  AL++A+QFFDVQKSGKL + ++ WRGDSGL+DG   +LDLSKGMYDAGD MKF
Sbjct  62   -VQKYASALELALQFFDVQKSGKLENKRVWWRGDSGLRDGSEENLDLSKGMYDAGDHMKF  120

Query  568  GFPMAYTA  591
            GFP+A+TA
Sbjct  121  GFPLAFTA  128



>ref|XP_006435158.1| hypothetical protein CICLE_v10003402mg, partial [Citrus clementina]
 gb|ESR48398.1| hypothetical protein CICLE_v10003402mg, partial [Citrus clementina]
Length=480

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
              Y  ALKIAMQFFD+QKSGKLV+N+I WRGDSGLKDGK   L+LSKGMYDAGD +KFGF
Sbjct  9    HNYVAALKIAMQFFDIQKSGKLVNNQIKWRGDSGLKDGKEVDLELSKGMYDAGDAVKFGF  68

Query  574  PMAYTA  591
            P+A+TA
Sbjct  69   PLAFTA  74



>ref|XP_006656489.1| PREDICTED: endoglucanase 18-like [Oryza brachyantha]
Length=519

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 78/112 (70%), Gaps = 6/112 (5%)
 Frame = +1

Query  256  CGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKIAMQFF  435
            C WLLV+ + A    +  V V+ K+GG G   P      G PGAV  KY DAL +A+QFF
Sbjct  8    CCWLLVLALMALAVTAAVVFVRYKNGGQGFPFP------GVPGAVDHKYTDALGVALQFF  61

Query  436  DVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
             VQKSGKLV+N I WRGDS L DGK A LDLSKGMYDAGD MKFGFPMA+TA
Sbjct  62   QVQKSGKLVNNTIHWRGDSALDDGKEAGLDLSKGMYDAGDHMKFGFPMAFTA  113



>ref|XP_009624009.1| PREDICTED: endoglucanase 2-like [Nicotiana tomentosiformis]
Length=527

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY +AL IAMQFFD+QKSGKLV+NKI+WRGDS + DG   +LDL+KGMYDAGD +KFGFP
Sbjct  53   KYANALSIAMQFFDIQKSGKLVNNKIAWRGDSAMGDGSEVNLDLTKGMYDAGDHVKFGFP  112

Query  577  MAYTA  591
            MA+TA
Sbjct  113  MAFTA  117



>ref|XP_002300715.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE79988.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|AEO97188.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97215.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=523

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 82/118 (69%), Gaps = 5/118 (4%)
 Frame = +1

Query  241  SKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKI  420
            S  G C W LVV+  A +  +I   V+KK      + P    + GPPGA+ +KY DALKI
Sbjct  6    SSRGCCWWFLVVVTLALVYDAIVYTVQKKTEKSEGAAP----ITGPPGAIEKKYADALKI  61

Query  421  AMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
            AMQFFD+Q+SG+L   NK SWRGDS L DG  A LDLSKGMYDAGDLMKFGFPMA+TA
Sbjct  62   AMQFFDIQRSGELGYSNKFSWRGDSTLTDGSQAKLDLSKGMYDAGDLMKFGFPMAFTA  119



>gb|EAZ02358.1| hypothetical protein OsI_24462 [Oryza sativa Indica Group]
Length=518

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             KY DAL +A+QFF VQKSGKLV+N I WRGDS L DGK A +DLSKGMYDAGD MKFGF
Sbjct  48   HKYADALAVALQFFQVQKSGKLVNNTIHWRGDSALDDGKEAGIDLSKGMYDAGDHMKFGF  107

Query  574  PMAYTA  591
            PMA+TA
Sbjct  108  PMAFTA  113



>ref|XP_010530451.1| PREDICTED: endoglucanase 2-like [Tarenaya hassleriana]
Length=501

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            +Y DAL +A++FFDVQ+SGKLV N+ISWRGDSGL+DG+   +DLSKGMYDAGD +KFGFP
Sbjct  49   EYTDALSVALEFFDVQRSGKLVKNRISWRGDSGLRDGREEKVDLSKGMYDAGDHIKFGFP  108

Query  577  MAYTA  591
            MA+TA
Sbjct  109  MAFTA  113



>ref|NP_001058583.1| Os06g0715300 [Oryza sativa Japonica Group]
 sp|Q5Z9P8.1|GUN18_ORYSJ RecName: Full=Endoglucanase 18; AltName: Full=Endo-1,4-beta glucanase 
18 [Oryza sativa Japonica Group]
 dbj|BAD53575.1| putative endo-beta-1,4-D-glucanase [Oryza sativa Japonica Group]
 dbj|BAF20497.1| Os06g0715300 [Oryza sativa Japonica Group]
Length=518

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             KY DAL +A+QFF VQKSGKLV+N I WRGDS L DGK A +DLSKGMYDAGD MKFGF
Sbjct  48   HKYADALAVALQFFQVQKSGKLVNNTIHWRGDSALDDGKEAGIDLSKGMYDAGDHMKFGF  107

Query  574  PMAYTA  591
            PMA+TA
Sbjct  108  PMAFTA  113



>ref|XP_009803640.1| PREDICTED: endoglucanase 2-like [Nicotiana sylvestris]
Length=527

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 58/67 (87%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
              KY +AL IAM+FFDVQKSGKLV+NKI+WRGDS + DG  A+LDL+KGM+DAGD +KFG
Sbjct  51   VNKYANALSIAMRFFDVQKSGKLVNNKIAWRGDSAMGDGSEANLDLTKGMFDAGDHVKFG  110

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  111  FPMAFTA  117



>dbj|BAJ93299.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=531

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KYGDAL +A+QFF VQK+GKLVDN+I WRGDS L DGK A LDLSKG+YDAGD MKF FP
Sbjct  60   KYGDALGVALQFFQVQKAGKLVDNQIPWRGDSALTDGKEAKLDLSKGLYDAGDHMKFTFP  119

Query  577  MAYTA  591
            MA+TA
Sbjct  120  MAFTA  124



>gb|KHN00484.1| Endoglucanase 24 [Glycine soja]
Length=509

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 81/128 (63%), Gaps = 3/128 (2%)
 Frame = +1

Query  208  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  387
            K  +K  +K       C WL V I+A  + V+  + +  K   G S+ P+    P     
Sbjct  4    KVNDKEPNKKHYVSALCWWLTVSIIAVLVVVAGVLSLITKFKFGHSNSPEFTSHPTNV--  61

Query  388  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
              QKY  AL++A+QFFDVQKSGKL + ++ WRGDSGL+DG   +LDLSKGMYDAGD MKF
Sbjct  62   -VQKYASALELALQFFDVQKSGKLENKRVWWRGDSGLRDGSEENLDLSKGMYDAGDHMKF  120

Query  568  GFPMAYTA  591
            GFP+A+TA
Sbjct  121  GFPLAFTA  128



>ref|XP_004509346.1| PREDICTED: endoglucanase 10-like [Cicer arietinum]
Length=533

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY  +L++A+QFFDVQKSGK+ +N++ WRGDSGL+DG  A+LDLSKGMYDAGDL+KFGFP
Sbjct  62   KYASSLQLALQFFDVQKSGKVQNNRVWWRGDSGLRDGIEANLDLSKGMYDAGDLIKFGFP  121

Query  577  MAYTA  591
            MA+TA
Sbjct  122  MAFTA  126



>ref|XP_011028991.1| PREDICTED: endoglucanase 2-like [Populus euphratica]
Length=523

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 81/118 (69%), Gaps = 5/118 (4%)
 Frame = +1

Query  241  SKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKI  420
            S  G C W LVV+  A +  +I   V+KK      + P    + GPPGA+ +KY DALKI
Sbjct  6    SSRGCCWWFLVVVTLALVYDAIVYTVQKKTEESEGAAP----ITGPPGAIEKKYADALKI  61

Query  421  AMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
            AMQFFD+Q+S +L   NK SWRGDS L DG  A LDLSKGMYDAGDLMKFGFPMA+TA
Sbjct  62   AMQFFDIQRSAELGYCNKFSWRGDSALTDGSQAKLDLSKGMYDAGDLMKFGFPMAFTA  119



>ref|XP_011462352.1| PREDICTED: endoglucanase 2-like [Fragaria vesca subsp. vesca]
Length=531

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             Q Y DAL +A QFFD QKSGKLV N++ WRGDSGL+DG    LDLSKGMYDAGDL+KFG
Sbjct  58   VQNYSDALGLATQFFDAQKSGKLVVNRVGWRGDSGLRDGSEEGLDLSKGMYDAGDLIKFG  117

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  118  FPMAFTA  124



>gb|ACC63522.1| putative glucanase/cellulase [Hordeum vulgare subsp. vulgare]
Length=179

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 65/93 (70%), Gaps = 9/93 (10%)
 Frame = +1

Query  313  LVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDS  492
             V+ ++GGG    P         G+V  KY +AL +A+QFF VQKSGKLV  +I WRGDS
Sbjct  27   FVRNRNGGGDRPVP---------GSVDHKYAEALAVALQFFQVQKSGKLVKKEIPWRGDS  77

Query  493  GLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
             + DG+ A LDLS+GMYDAGD +KFGFPMA+TA
Sbjct  78   AVDDGQEAGLDLSRGMYDAGDHIKFGFPMAFTA  110



>ref|XP_003629333.1| Endoglucanase [Medicago truncatula]
 gb|AET03809.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=534

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY  +L++A+QFFDVQKSGK+ +N++ WRGDSGL+DG   +LDLSKG+YDAGDLMKFGFP
Sbjct  63   KYASSLQLALQFFDVQKSGKVQNNRVWWRGDSGLRDGSEENLDLSKGLYDAGDLMKFGFP  122

Query  577  MAYTA  591
            MA+TA
Sbjct  123  MAFTA  127



>gb|ABE02649.1| putative glucanase/cellulase [Hordeum vulgare subsp. vulgare]
 gb|ABE02656.1| putative glucanase/cellulase [Hordeum vulgare]
Length=179

 Score =   100 bits (250),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 65/93 (70%), Gaps = 9/93 (10%)
 Frame = +1

Query  313  LVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDS  492
             V+ ++GGG    P         G+V  KY +AL +A+QFF VQKSGKLV  +I WRGDS
Sbjct  27   FVRNRNGGGDRPVP---------GSVDHKYAEALAVALQFFQVQKSGKLVKKEIPWRGDS  77

Query  493  GLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
             + DG+ A LDLS+GMYDAGD +KFGFPMA+TA
Sbjct  78   AVDDGQEAGLDLSRGMYDAGDHIKFGFPMAFTA  110



>ref|XP_003578508.1| PREDICTED: endoglucanase 24 [Brachypodium distachyon]
Length=529

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KYGDAL IA+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKG+YDAGD MKF FP
Sbjct  58   KYGDALGIALQFFQVQKAGKLENNEIPWRGDSALDDGKEAKLDLSKGLYDAGDHMKFSFP  117

Query  577  MAYTA  591
            MA+TA
Sbjct  118  MAFTA  122



>ref|XP_006661478.1| PREDICTED: endoglucanase 24-like [Oryza brachyantha]
Length=498

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KYGDAL +A+QFF VQK+GKL +N+I WRGDS   DGK A LDLSKGMYDAGD MKF FP
Sbjct  27   KYGDALGVALQFFQVQKAGKLENNQIPWRGDSATDDGKQAGLDLSKGMYDAGDHMKFTFP  86

Query  577  MAYTA  591
            MA+TA
Sbjct  87   MAFTA  91



>ref|XP_007156152.1| hypothetical protein PHAVU_003G262600g [Phaseolus vulgaris]
 gb|ESW28146.1| hypothetical protein PHAVU_003G262600g [Phaseolus vulgaris]
Length=534

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
             QKY  AL++A+QFF VQKSGK+ + ++ WRGDSGL+DG  A LDLSKGMYDAGD +KFG
Sbjct  61   VQKYASALQLALQFFYVQKSGKVENQRVLWRGDSGLRDGSEADLDLSKGMYDAGDQIKFG  120

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  121  FPMAFTA  127



>dbj|BAK04397.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=519

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 65/93 (70%), Gaps = 9/93 (10%)
 Frame = +1

Query  313  LVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDS  492
             V+ ++GGG    P         G+V  KY +AL +A+QFF VQKSGKLV  +I WRGDS
Sbjct  27   FVRNRNGGGDRPVP---------GSVDHKYAEALAVALQFFQVQKSGKLVKKEIPWRGDS  77

Query  493  GLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
             + DG+ A LDLS+GMYDAGD +KFGFPMA+TA
Sbjct  78   AVDDGQEAGLDLSRGMYDAGDHIKFGFPMAFTA  110



>gb|KHN45917.1| Endoglucanase 2 [Glycine soja]
Length=570

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  424  MQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
            MQFFD+QKSGKLVDNKISWRG+S LKDG  A LDL+KGMYDAGD MKFGFPMA+TA
Sbjct  1    MQFFDIQKSGKLVDNKISWRGNSALKDGSQAKLDLTKGMYDAGDNMKFGFPMAFTA  56


 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  448  SGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
            +G+LVD+KISWRG+S LKDG  A LDLSKGMYDA D MKFGFPMA+ A
Sbjct  115  TGRLVDSKISWRGNSALKDGSQAKLDLSKGMYDARDNMKFGFPMAFMA  162



>emb|CDY44194.1| BnaC05g15510D [Brassica napus]
Length=1131

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 58/81 (72%), Gaps = 15/81 (19%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQK---------------SGKLVDNKISWRGDSGLKDGKSASLDL  528
            + Y DALKIAMQFFD+QK               +GKL +NKI+WRGDSGL+DG  A LDL
Sbjct  56   KNYADALKIAMQFFDIQKCKSSTLLAEHTHLTPAGKLENNKITWRGDSGLEDGSEAGLDL  115

Query  529  SKGMYDAGDLMKFGFPMAYTA  591
            SKG+YDAGD MKFG PMA+TA
Sbjct  116  SKGLYDAGDHMKFGLPMAFTA  136



>ref|XP_002439027.1| hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
 gb|EER90394.1| hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
Length=522

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY +AL +A++FF VQKSGKLV+N I WRGDS L+DG+ A LDLSKGMYDAGD MKFGF 
Sbjct  52   KYAEALAVALRFFQVQKSGKLVNNTIPWRGDSALRDGEDAKLDLSKGMYDAGDHMKFGFT  111

Query  577  MAYT  588
            +A+T
Sbjct  112  LAFT  115



>ref|XP_004966453.1| PREDICTED: endoglucanase 18-like [Setaria italica]
Length=521

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY +AL +A+QFF VQKSGKLV N+I WRGDS L DG+ A LDLSKGMYDAGD MKFGF 
Sbjct  51   KYAEALAVALQFFQVQKSGKLVRNEIPWRGDSALDDGEEAKLDLSKGMYDAGDHMKFGFT  110

Query  577  MAYT  588
            +A+T
Sbjct  111  LAFT  114



>ref|NP_001288527.1| uncharacterized protein LOC103626453 precursor [Zea mays]
 gb|AFW69494.1| hypothetical protein ZEAMMB73_138975 [Zea mays]
 gb|AGG19095.1| cellulase [Zea mays]
Length=521

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            KY +AL +A++FF VQKSGKLV+N I WRGDS L+DG+ A LDLS+GMYDAGD +KFGF 
Sbjct  51   KYAEALAVALRFFQVQKSGKLVNNTIPWRGDSALRDGEDAKLDLSRGMYDAGDHVKFGFT  110

Query  577  MAYT  588
            MA+T
Sbjct  111  MAFT  114



>ref|XP_002971269.1| hypothetical protein SELMODRAFT_94888 [Selaginella moellendorffii]
 gb|EFJ27867.1| hypothetical protein SELMODRAFT_94888 [Selaginella moellendorffii]
Length=561

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            KY + LKI++QFFD+QKSGKL  DN I WRGDS L DG  A +DLS GMYDAGD +KFGF
Sbjct  90   KYAEPLKISLQFFDIQKSGKLPPDNPIEWRGDSALSDGSDAHVDLSGGMYDAGDYIKFGF  149

Query  574  PMAYTA  591
            PMA+TA
Sbjct  150  PMAFTA  155



>ref|XP_002961546.1| hypothetical protein SELMODRAFT_77612 [Selaginella moellendorffii]
 gb|EFJ36806.1| hypothetical protein SELMODRAFT_77612 [Selaginella moellendorffii]
Length=562

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            KY + LKI++QFFD+QKSGKL  DN I WRGDS L DG  A +DLS GMYDAGD +KFGF
Sbjct  90   KYAEPLKISLQFFDIQKSGKLPPDNPIEWRGDSALSDGSDAHVDLSGGMYDAGDYIKFGF  149

Query  574  PMAYTA  591
            PMA+TA
Sbjct  150  PMAFTA  155



>gb|ABK24648.1| unknown [Picea sitchensis]
Length=532

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 79/126 (63%), Gaps = 8/126 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLv--vivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQ  396
            MG  ++S  GW  WLL   +         + +L  +KH     S    +PVPGPPGA++Q
Sbjct  1    MGAVAKSSKGWIWWLLSLGIAAFVVTAAVLTILHSRKH-----SHHHVSPVPGPPGAISQ  55

Query  397  KYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            KY  ALK+A+ FF +QK+GKL  DN I WRGDS L DG    +DLS GMYDAGD +KFG 
Sbjct  56   KYAQALKVALTFFPIQKAGKLPNDNPIPWRGDSALSDGNDVGVDLSGGMYDAGDHIKFGL  115

Query  574  PMAYTA  591
            PMA+TA
Sbjct  116  PMAFTA  121



>ref|XP_002978046.1| hypothetical protein SELMODRAFT_417952 [Selaginella moellendorffii]
 gb|EFJ20703.1| hypothetical protein SELMODRAFT_417952 [Selaginella moellendorffii]
Length=551

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
             +++   L++AM+F D QKSGKL  DN I WRGDS L DGK   LDLSKGM+DAGD +KF
Sbjct  69   VERFSKPLELAMRFLDAQKSGKLPKDNPIPWRGDSALLDGKDVGLDLSKGMFDAGDNVKF  128

Query  568  GFPMAYTA  591
            GFPMA+TA
Sbjct  129  GFPMAFTA  136



>ref|WP_036707429.1| hypothetical protein, partial [Paenibacillus graminis]
Length=211

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             Y +AL+ ++ F++ Q+SG L DN ++ WRGDSGL+DG  A  DL+ G YDAGD +KFGF
Sbjct  64   NYAEALQKSVYFYEAQRSGDLPDNNRVEWRGDSGLQDGADAGHDLTGGWYDAGDHVKFGF  123

Query  574  PMAYTA  591
            PMAYTA
Sbjct  124  PMAYTA  129



>pdb|1JS4|A Chain A, EndoEXOCELLULASE:CELLOBIOSE FROM THERMOMONOSPORA
 pdb|1JS4|B Chain B, EndoEXOCELLULASE:CELLOBIOSE FROM THERMOMONOSPORA
 pdb|4TF4|A Chain A, EndoEXOCELLULASE:CELLOPENTAOSE FROM THERMOMONOSPORA
 pdb|4TF4|B Chain B, EndoEXOCELLULASE:CELLOPENTAOSE FROM THERMOMONOSPORA
 pdb|3TF4|A Chain A, EndoEXOCELLULASE:CELLOTRIOSE FROM THERMOMONOSPORA
 pdb|3TF4|B Chain B, EndoEXOCELLULASE:CELLOTRIOSE FROM THERMOMONOSPORA
 pdb|1TF4|A Chain A, EndoEXOCELLULASE FROM THERMOMONOSPORA
 pdb|1TF4|B Chain B, EndoEXOCELLULASE FROM THERMOMONOSPORA
Length=605

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y +AL+ +M F++ Q+SGKL +N ++SWRGDSGL DG    LDL+ G YDAGD +KFGFP
Sbjct  6    YAEALQKSMFFYEAQRSGKLPENNRVSWRGDSGLNDGADVGLDLTGGWYDAGDHVKFGFP  65

Query  577  MAYTA  591
            MA+TA
Sbjct  66   MAFTA  70



>gb|KFK37261.1| hypothetical protein AALP_AA4G234600 [Arabis alpina]
Length=688

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL  ++ +F+ Q+SGKL ++ ++ WRGDS L+DG  A +DL+ G YDAGD MKFGFP
Sbjct  227  YGEALTKSLLYFEAQRSGKLPLNQRVDWRGDSALRDGSDAHIDLTGGYYDAGDNMKFGFP  286

Query  577  MAYT  588
            MA+T
Sbjct  287  MAFT  290



>ref|WP_033300787.1| endoglucanase [Streptomyces atroolivaceus]
Length=773

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ ++ F+D Q+SG+L  DN++SWRGDSG+ DGK   LDL+ G YDAGD +KFG P
Sbjct  32   YGEALQKSLFFYDAQRSGELPEDNRVSWRGDSGMDDGKDVGLDLTGGWYDAGDHVKFGLP  91

Query  577  MAYTA  591
            MAY+A
Sbjct  92   MAYSA  96



>ref|WP_018105029.1| MULTISPECIES: hypothetical protein [Streptomyces]
Length=790

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ ++ F++ Q+SGKL D N++SWRGDS L DGK A LDL+ G YDAGD +KFG P
Sbjct  51   YGEALQKSVLFYEAQQSGKLPDTNRVSWRGDSALDDGKDAGLDLTGGWYDAGDHVKFGLP  110

Query  577  MAYTA  591
            MAY+A
Sbjct  111  MAYSA  115



>ref|XP_006826915.1| hypothetical protein AMTR_s00010p00165730 [Amborella trichopoda]
 gb|ERM94152.1| hypothetical protein AMTR_s00010p00165730 [Amborella trichopoda]
Length=485

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            +  YGDALK  + FF+ Q+SGKL  N +++WR DS LKDG +A +DL+ G YDAGD +KF
Sbjct  21   SHDYGDALKKCITFFEGQRSGKLPSNQRLTWRRDSALKDGSAAHVDLTGGYYDAGDNVKF  80

Query  568  GFPMAYTA  591
            GFPMA+TA
Sbjct  81   GFPMAFTA  88



>ref|XP_001772307.1| predicted protein [Physcomitrella patens]
 gb|EDQ62778.1| predicted protein [Physcomitrella patens]
Length=629

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YGDAL  A+++F+ Q+SG+L   +++SWRGDSGL DG+   LDLS G YDAGD +KFG P
Sbjct  29   YGDALDKAVKYFEAQRSGRLPPGHRVSWRGDSGLHDGQQEGLDLSGGYYDAGDNVKFGLP  88

Query  577  MAYT  588
            MAYT
Sbjct  89   MAYT  92



>gb|ADX41578.1| Cel9A [synthetic construct]
Length=835

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y +AL+ +M F++ Q+SGKL +N ++SWRGDSGL DG    LDL+ G YDAGD +KFGFP
Sbjct  7    YAEALQKSMFFYEAQRSGKLPENNRVSWRGDSGLNDGADVGLDLTGGWYDAGDHVKFGFP  66

Query  577  MAYTA  591
            MA+TA
Sbjct  67   MAFTA  71



>ref|WP_011292599.1| endoglucanase [Thermobifida fusca]
 sp|P26221.2|GUN4_THEFU RecName: Full=Endoglucanase E-4; AltName: Full=Cellulase E-4; 
AltName: Full=Cellulase E4; AltName: Full=Endo-1,4-beta-glucanase 
E-4; Flags: Precursor [Thermobifida fusca]
 gb|AAB42155.1| beta-1,4-endoglucanase precursor [Thermobifida fusca YX]
 gb|AAZ56209.1| endoglucanase. Glycosyl Hydrolase family 9 [Thermobifida fusca 
YX]
 gb|EOR70746.1| endoglucanase [Thermobifida fusca TM51]
Length=880

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y +AL+ +M F++ Q+SGKL +N ++SWRGDSGL DG    LDL+ G YDAGD +KFGFP
Sbjct  52   YAEALQKSMFFYEAQRSGKLPENNRVSWRGDSGLNDGADVGLDLTGGWYDAGDHVKFGFP  111

Query  577  MAYTA  591
            MA+TA
Sbjct  112  MAFTA  116



>ref|WP_013732376.1| endoglucanase [Verrucosispora maris]
 gb|AEB43708.1| glycoside hydrolase family 9 [Verrucosispora maris AB-18-032]
Length=972

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +1

Query  334  GGGSSEPDaapvpgppgavTQKYGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGK  510
              G + P +        A    Y +AL+ ++ F++ Q+SGKL D N++SWRGDSGL+DG 
Sbjct  44   AAGVAAPTSGDASTSAAAPAFNYAEALQKSLLFYEAQQSGKLPDWNRVSWRGDSGLRDGS  103

Query  511  SASLDLSKGMYDAGDLMKFGFPMAYT  588
               +DL+ G YDAGD +KFGFPMA+T
Sbjct  104  DVGIDLTGGWYDAGDHVKFGFPMAFT  129



>ref|XP_002881963.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58222.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=490

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            +  YG+AL+ ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  31   STNYGEALRNSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHIDLTGGYYDAGDNMKF  90

Query  568  GFPMAYT  588
            GFP+A+T
Sbjct  91   GFPLAFT  97



>ref|XP_002966695.1| hypothetical protein SELMODRAFT_144066 [Selaginella moellendorffii]
 gb|EFJ32722.1| hypothetical protein SELMODRAFT_144066 [Selaginella moellendorffii]
Length=472

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = +1

Query  424  MQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
            M+F D QKSGKL  DN I WRGDS L DGK   LDLSKGM+DAGD +KFGFPMA+TA
Sbjct  1    MRFLDAQKSGKLPKDNPIPWRGDSALLDGKDVGLDLSKGMFDAGDNVKFGFPMAFTA  57



>ref|WP_030488613.1| endoglucanase [Micromonospora chokoriensis]
Length=967

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            T  Y +AL+ ++ F++ Q+SG+L D N++SWRGDS L DG SA +DL+ G YDAGD +KF
Sbjct  56   TYNYAEALQKSLLFYEAQQSGRLPDWNRVSWRGDSALTDGASAGVDLTGGWYDAGDHVKF  115

Query  568  GFPMAYTA  591
            GFPMA++A
Sbjct  116  GFPMAFSA  123



>gb|AAV50042.1| cellulase [Saccharum hybrid cultivar Pindar]
Length=84

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +1

Query  448  SGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
            SGKL +N+I WRGDS L DGK A LDLSKGMYDAGD MKF FPMA+TA
Sbjct  1    SGKLENNQIPWRGDSALTDGKEAGLDLSKGMYDAGDHMKFTFPMAFTA  48



>ref|WP_037655280.1| endoglucanase [Streptomyces achromogenes]
Length=779

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 39/64 (61%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ ++ F+D Q+SGKL D N++SWRGDS L DGK A LDL+ G YDAGD +KFG P
Sbjct  34   YGEALQKSLWFYDAQRSGKLPDDNRVSWRGDSALDDGKDAGLDLTGGWYDAGDHVKFGLP  93

Query  577  MAYT  588
            MA++
Sbjct  94   MAFS  97



>ref|WP_030336140.1| endoglucanase [Micromonospora parva]
Length=967

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 38/68 (56%), Positives = 53/68 (78%), Gaps = 1/68 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            T  Y +AL+ ++ F++ Q+SG+L D N++SWRGDS L DG SA +DL+ G YDAGD +KF
Sbjct  56   TYNYAEALQKSLLFYEAQQSGRLPDWNRVSWRGDSALTDGASAGVDLTGGWYDAGDHVKF  115

Query  568  GFPMAYTA  591
            GFPMA++A
Sbjct  116  GFPMAFSA  123



>ref|WP_018552941.1| hypothetical protein [Streptomyces sp. ATexAB-D23]
Length=800

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ ++ F++ Q+SGKL D N++SWRGDS L DGK A LDL+ G YDAGD +KFG P
Sbjct  55   YGEALQKSVLFYEAQQSGKLPDTNRVSWRGDSALDDGKDAGLDLTGGWYDAGDHVKFGLP  114

Query  577  MAYTA  591
            MA++A
Sbjct  115  MAFSA  119



>gb|AHL27899.1| cellulase [uncultured bacterium]
Length=782

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ A+ F+D Q+SG+L   N+++WRGDSGL DG    LDL+ G YDAGD +KFGFP
Sbjct  31   YGEALQKAIWFYDAQRSGRLPAGNRVNWRGDSGLNDGADVGLDLTGGWYDAGDHVKFGFP  90

Query  577  MAYT  588
            MA++
Sbjct  91   MAFS  94



>ref|WP_033435023.1| endoglucanase, partial [Saccharothrix syringae]
Length=738

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ ++ F+D Q+SGKL  DN+++WRGDS L+DG+ A LDLS G YDAGD +KFG P
Sbjct  38   YGEALQKSIWFYDAQRSGKLPADNRVNWRGDSALRDGQDAGLDLSGGFYDAGDHVKFGLP  97

Query  577  MAYT  588
             A T
Sbjct  98   FAAT  101



>ref|WP_037701830.1| endoglucanase [Streptomyces lavenduligriseus]
Length=776

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ ++ F+D Q+SGKL D N++SWRGDS L DGK   LDL+ G YDAGD +KFG P
Sbjct  33   YGEALQKSLWFYDAQRSGKLPDGNRVSWRGDSALGDGKDVGLDLTGGWYDAGDHVKFGLP  92

Query  577  MAYTA  591
            MA++A
Sbjct  93   MAFSA  97



>ref|NP_181982.1| glycosyl hydrolase 9B9 [Arabidopsis thaliana]
 sp|O64889.1|GUN12_ARATH RecName: Full=Endoglucanase 12; AltName: Full=Endo-1,4-beta glucanase 
12; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27456.1| putative cellulase [Arabidopsis thaliana]
 gb|AAM14965.1| putative cellulase [Arabidopsis thaliana]
 gb|AEC10436.1| glycosyl hydrolase 9B9 [Arabidopsis thaliana]
Length=491

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            +  Y +AL+ ++ +F+ Q+SGKL  N K++WRGDS LKDG  A +DL+ G YDAGD MKF
Sbjct  31   STNYAEALQKSLLYFEAQRSGKLPPNQKVTWRGDSALKDGSDAHIDLTGGYYDAGDNMKF  90

Query  568  GFPMAYT  588
            GFP+A+T
Sbjct  91   GFPLAFT  97



>ref|XP_006413937.1| hypothetical protein EUTSA_v10027553mg [Eutrema salsugineum]
 gb|ESQ55390.1| hypothetical protein EUTSA_v10027553mg [Eutrema salsugineum]
Length=494

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            +  YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  31   STNYGEALTNSLLYFEAQRSGKLPSNQRVNWRGDSALRDGSDAHIDLTGGYYDAGDNMKF  90

Query  568  GFPMAYT  588
            GFP+A+T
Sbjct  91   GFPLAFT  97



>emb|CDX74667.1| BnaA05g04130D [Brassica napus]
Length=433

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKFGF
Sbjct  31   NYGEALTKSLLYFEAQRSGKLPPNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKFGF  90

Query  574  PMAYT  588
            PMA+T
Sbjct  91   PMAFT  95



>ref|WP_026418585.1| glycosyl hydrolase family 9 [Actinoalloteichus cyanogriseus]
Length=499

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             YG+AL+ ++ F+D Q+SG L  DN++SWRGDS + DG    LDLS G YDAGD +KFGF
Sbjct  45   NYGEALQKSIWFYDAQRSGVLPADNRVSWRGDSAVDDGSDVGLDLSGGFYDAGDHVKFGF  104

Query  574  PMAYT  588
            P AYT
Sbjct  105  PFAYT  109



>ref|WP_016698150.1| hypothetical protein [Actinoalloteichus spitiensis]
Length=499

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             YG+AL+ ++ F+D Q+SG L  DN++SWRGDS + DG    LDLS G YDAGD +KFGF
Sbjct  45   NYGEALQKSIWFYDAQRSGVLPADNRVSWRGDSAVDDGSDVGLDLSGGFYDAGDHVKFGF  104

Query  574  PMAYT  588
            P AYT
Sbjct  105  PFAYT  109



>emb|CDX74664.1| BnaA05g04100D [Brassica napus]
Length=489

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKFGF
Sbjct  31   NYGEALTKSLLYFEAQRSGKLPPNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKFGF  90

Query  574  PMAYT  588
            PMA+T
Sbjct  91   PMAFT  95



>ref|XP_009143042.1| PREDICTED: endoglucanase 14-like [Brassica rapa]
Length=489

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKFGF
Sbjct  31   NYGEALTKSLLYFEAQRSGKLPPNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKFGF  90

Query  574  PMAYT  588
            PMA+T
Sbjct  91   PMAFT  95



>ref|NP_181983.1| glycosyl hydrolase 9B10 [Arabidopsis thaliana]
 sp|O64890.1|GUN13_ARATH RecName: Full=Endoglucanase 13; AltName: Full=Endo-1,4-beta glucanase 
13; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27457.1| putative glucanase [Arabidopsis thaliana]
 gb|AAM14964.1| putative glucanase [Arabidopsis thaliana]
 gb|AEC10437.1| glycosyl hydrolase 9B10 [Arabidopsis thaliana]
Length=490

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            +  Y +ALK ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  31   STNYAEALKNSLLYFEAQRSGKLPPNQRVTWRGDSALRDGSDAHIDLTGGYYDAGDNMKF  90

Query  568  GFPMAYT  588
            GFP+A+T
Sbjct  91   GFPLAFT  97



>ref|WP_039835859.1| endoglucanase, partial [Paenibacillus sonchi]
Length=188

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             Y +AL+ ++ F++ Q+SG+L DN ++ WRGDSGL+DG     DL+ G YDAGD +KFG 
Sbjct  41   NYAEALQKSIYFYEAQRSGELPDNNRVEWRGDSGLQDGADVGHDLTGGWYDAGDHVKFGL  100

Query  574  PMAYTA  591
            PMAYTA
Sbjct  101  PMAYTA  106



>ref|WP_026214358.1| endoglucanase [Nonomuraea coxensis]
Length=860

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ ++ F++ Q+SG L   N++SWRGDSGL DGK A LDL+ G YDAGD +KFG P
Sbjct  56   YGEALQKSLWFYEAQQSGDLPAWNRVSWRGDSGLNDGKDAGLDLTGGWYDAGDHVKFGLP  115

Query  577  MAYTA  591
            MAY+A
Sbjct  116  MAYSA  120



>ref|WP_007457075.1| endoglucanase [Micromonospora lupini]
 emb|CCH16859.1| Extracellular cellulase B [Micromonospora lupini str. Lupac 08]
Length=964

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y +AL+ ++ F++ Q+SGKL D N++SWRGDS L DG  A LDL+ G YDAGD +KFGFP
Sbjct  56   YAEALQKSLLFYEAQQSGKLPDWNRVSWRGDSALTDGAGAGLDLTGGWYDAGDHVKFGFP  115

Query  577  MAYTA  591
            MA++A
Sbjct  116  MAFSA  120



>gb|ABC70312.1| endo-1,4-beta-glucanase precursor [Glycine max]
Length=114

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 48/68 (71%), Gaps = 1/68 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            T  Y DAL  ++ FF+ Q+SGKL  N ++SWR DSGL DG +  +DL  G YDAGD +KF
Sbjct  36   THNYRDALTKSIIFFEGQRSGKLPSNQRMSWRRDSGLSDGSAMHVDLVGGYYDAGDNVKF  95

Query  568  GFPMAYTA  591
            GFPMA+T 
Sbjct  96   GFPMAFTT  103



>ref|NP_181984.1| glycosyl hydrolase 9B11 [Arabidopsis thaliana]
 sp|Q8S8Q4.2|GUN14_ARATH RecName: Full=Endoglucanase 14; AltName: Full=Endo-1,4-beta glucanase 
14; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27458.1| putative glucanase [Arabidopsis thaliana]
 dbj|BAD43652.1| putative glucanase [Arabidopsis thaliana]
 gb|AEC10438.1| glycosyl hydrolase 9B11 [Arabidopsis thaliana]
Length=491

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 51/66 (77%), Gaps = 1/66 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            ++ YGDAL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  31   SRNYGDALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHVDLTGGYYDAGDNMKF  90

Query  568  GFPMAY  585
            GFP+A+
Sbjct  91   GFPLAF  96



>emb|CDY47674.1| BnaC04g03850D [Brassica napus]
Length=493

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            ++ YG+AL   + +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  33   SRHYGEALTKTLLYFEAQRSGKLPSNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKF  92

Query  568  GFPMAYT  588
            GFP+A+T
Sbjct  93   GFPLAFT  99



>ref|XP_009143046.1| PREDICTED: endoglucanase 14-like [Brassica rapa]
Length=493

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            ++ YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  33   SRHYGEALTKSLFYFEAQRSGKLPSNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKF  92

Query  568  GFPMAYT  588
            GFP+A+T
Sbjct  93   GFPLAFT  99



>ref|XP_008232281.1| PREDICTED: endoglucanase 14-like [Prunus mume]
Length=292

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YGDAL  ++ +++ Q+SGKL  N ++ WRGDSGLKDG  A +DL  G YDAGD +KFGFP
Sbjct  28   YGDALTKSLLYYEAQRSGKLPPNQRVQWRGDSGLKDGSDAGVDLVGGYYDAGDNVKFGFP  87

Query  577  MAYT  588
            MA+T
Sbjct  88   MAFT  91



>emb|CDX74668.1| BnaA05g04140D [Brassica napus]
Length=493

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            ++ YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  33   SRHYGEALTKSLFYFEAQRSGKLPSNQRVNWRGDSALRDGSDAHVDLTGGYYDAGDNMKF  92

Query  568  GFPMAYT  588
            GFP+A+T
Sbjct  93   GFPLAFT  99



>ref|WP_015942124.1| endoglucanase [Chloroflexus aggregans]
 gb|ACL26277.1| glycoside hydrolase family 9 [Chloroflexus aggregans DSM 9485]
Length=794

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ ++ F+++Q+SG+L  DN++ WRGDSGL DG    +DL+ G YDAGD +KFGFP
Sbjct  32   YGEALQKSIFFYEIQRSGRLPPDNRVRWRGDSGLNDGADVGIDLTGGWYDAGDHVKFGFP  91

Query  577  MAYTA  591
            MA +A
Sbjct  92   MAASA  96



>ref|XP_002881965.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58224.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKFGF
Sbjct  35   NYGEALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHIDLTGGYYDAGDNMKFGF  94

Query  574  PMAYT  588
            P+A+T
Sbjct  95   PLAFT  99



>gb|EYU26800.1| hypothetical protein MIMGU_mgv1a019325mg [Erythranthe guttata]
Length=474

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            +++YG+AL  ++ F++ Q+SGKL  D ++ WRGDS L DGK+  +DL  G YDAGD +KF
Sbjct  23   SREYGEALTKSLLFYEAQRSGKLPPDQRVQWRGDSALHDGKTGGIDLVGGYYDAGDNVKF  82

Query  568  GFPMAYTA  591
            GFPMAYT 
Sbjct  83   GFPMAYTV  90



>gb|EMT32027.1| Endoglucanase 24 [Aegilops tauschii]
Length=504

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  448  SGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
            +GKLVDN+I WRGDS L DGK A LDLSKG+YDAGD MKF FPMA+TA
Sbjct  13   AGKLVDNQIPWRGDSALNDGKEAKLDLSKGLYDAGDHMKFTFPMAFTA  60



>dbj|BAF01119.1| putative glucanase [Arabidopsis thaliana]
Length=404

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             YG+AL  ++ +F+ Q+SGKL +D ++ WRGDS L+DG  A +DL+ G YDAGD MKFGF
Sbjct  29   NYGEALTKSLLYFEAQRSGKLPLDQRVIWRGDSALRDGSDAHVDLTGGYYDAGDNMKFGF  88

Query  574  PMAYT  588
            P+A+T
Sbjct  89   PLAFT  93



>gb|EAZ24519.1| hypothetical protein OsJ_08281 [Oryza sativa Japonica Group]
Length=508

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
              YGDAL  ++ FF+ Q+SG+L  D ++ WR DSGL DG +AS+DL+ G YDAGD +KFG
Sbjct  35   HDYGDALHKSILFFEGQRSGRLPPDQRLRWRRDSGLHDGAAASVDLTGGYYDAGDNVKFG  94

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  95   FPMAFTA  101



>ref|XP_011085126.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 14-like [Sesamum 
indicum]
Length=489

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            T  YG AL  ++ F++ Q+SGKL  N +I WRGDS L DGKSA +DL  G YDAGD +KF
Sbjct  26   TVDYGAALTKSLLFYEAQRSGKLPPNQRIRWRGDSALSDGKSARIDLVGGYYDAGDNVKF  85

Query  568  GFPMAYTA  591
            GFPMA+T 
Sbjct  86   GFPMAFTV  93



>gb|AEH04391.1| endo-beta-1,4-glucanase [Thermobifida halotolerans]
Length=964

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y +AL+ +M F++ Q+SG L D N++SWRGDSGL DG    LDL+ G YDAGD +KFGFP
Sbjct  52   YAEALQKSMFFYEAQRSGALPDDNRVSWRGDSGLTDGADVGLDLTGGWYDAGDHVKFGFP  111

Query  577  MAYT  588
            MA+T
Sbjct  112  MAFT  115



>ref|NP_001048033.1| Os02g0733300 [Oryza sativa Japonica Group]
 sp|Q6Z2J3.1|GUN6_ORYSJ RecName: Full=Endoglucanase 6; AltName: Full=Endo-1,4-beta glucanase 
6; AltName: Full=OsCel9E; Flags: Precursor [Oryza sativa 
Japonica Group]
 dbj|BAD16147.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 dbj|BAF09947.1| Os02g0733300 [Oryza sativa Japonica Group]
 dbj|BAG94917.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97254.1| unnamed protein product [Oryza sativa Japonica Group]
Length=508

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
              YGDAL  ++ FF+ Q+SG+L  D ++ WR DSGL DG +AS+DL+ G YDAGD +KFG
Sbjct  35   HDYGDALHKSILFFEGQRSGRLPPDQRLRWRRDSGLHDGAAASVDLTGGYYDAGDNVKFG  94

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  95   FPMAFTA  101



>ref|XP_006829372.1| hypothetical protein AMTR_s02175p00005920, partial [Amborella 
trichopoda]
 gb|ERM96788.1| hypothetical protein AMTR_s02175p00005920, partial [Amborella 
trichopoda]
Length=240

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  451  GKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYT  588
            GKL +N ISWRGDS L DGK  +LDLSKGMYDAGD MKFGFPMA+T
Sbjct  1    GKLHNNPISWRGDSALDDGKEVTLDLSKGMYDAGDHMKFGFPMAFT  46



>ref|XP_007220712.1| hypothetical protein PRUPE_ppa021556mg, partial [Prunus persica]
 gb|EMJ21911.1| hypothetical protein PRUPE_ppa021556mg, partial [Prunus persica]
Length=463

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YGDAL  ++ +++ Q+SGKL  N ++ WRGDSGLKDG  A +DL  G YDAGD +KFGFP
Sbjct  6    YGDALTKSLLYYEAQRSGKLPPNQRVQWRGDSGLKDGSDAGVDLVGGYYDAGDNVKFGFP  65

Query  577  MAYT  588
            MA+T
Sbjct  66   MAFT  69



>ref|WP_027622694.1| endoglucanase [[Clostridium] clariflavum]
Length=732

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ ++ F+++Q+SG+L +N +++WRGDSGL DG  A LDL+ G YDAGD +KF  P
Sbjct  31   YGEALQKSIIFYEMQRSGRLPENNRVNWRGDSGLNDGADAGLDLTGGWYDAGDNVKFNLP  90

Query  577  MAYTA  591
            MAYTA
Sbjct  91   MAYTA  95



>ref|WP_014254351.1| endoglucanase [[Clostridium] clariflavum]
 gb|AEV67733.1| Cellulose binding domain-containing protein,dockerin-like protein 
[ [[Clostridium] clariflavum DSM 19732]
Length=732

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ ++ F+++Q+SG+L +N +++WRGDSGL DG  A LDL+ G YDAGD +KF  P
Sbjct  31   YGEALQKSIIFYEMQRSGRLPENNRVNWRGDSGLNDGADAGLDLTGGWYDAGDNVKFNLP  90

Query  577  MAYTA  591
            MAYTA
Sbjct  91   MAYTA  95



>ref|WP_036732328.1| endoglucanase [Paenibacillus sp. FSL R7-277]
 gb|ETT58992.1| hypothetical protein C173_30016 [Paenibacillus sp. FSL R7-277]
Length=911

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y +AL+ ++ F++ Q+SG+L  DN++ WRGDSGL+DG     DL+ G YDAGD +KFGFP
Sbjct  42   YAEALQKSIYFYEAQRSGELPADNRVEWRGDSGLQDGADVGHDLTGGWYDAGDHVKFGFP  101

Query  577  MAYTA  591
            MAYTA
Sbjct  102  MAYTA  106



>ref|WP_036690521.1| endoglucanase [Paenibacillus sp. FSL R7-269]
 gb|ETT56334.1| hypothetical protein C162_01504 [Paenibacillus sp. FSL R7-269]
Length=911

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y +AL+ ++ F++ Q+SG+L  DN++ WRGDSGL+DG     DL+ G YDAGD +KFGFP
Sbjct  42   YAEALQKSIYFYEAQRSGELPADNRVEWRGDSGLQDGADVGHDLTGGWYDAGDHVKFGFP  101

Query  577  MAYTA  591
            MAYTA
Sbjct  102  MAYTA  106



>gb|ADZ85350.1| Cellulase [Clostridium lentocellum DSM 5427]
Length=1131

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YGDA + A+ F++ QKSG L DN + +WRGDSGLKDG    LDL+ G YDAGD +KF  P
Sbjct  40   YGDAFQKALMFYEFQKSGDLPDNQRNNWRGDSGLKDGADVGLDLTGGWYDAGDHVKFNLP  99

Query  577  MAYTA  591
            M+YT+
Sbjct  100  MSYTS  104



>ref|NP_181985.1| glycosyl hydrolase 9B12  [Arabidopsis thaliana]
 sp|O80497.1|GUN15_ARATH RecName: Full=Endoglucanase 15; AltName: Full=Endo-1,4-beta glucanase 
15; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27459.1| putative glucanase [Arabidopsis thaliana]
 gb|AEC10439.1| glycosyl hydrolase 9B12 [Arabidopsis thaliana]
Length=492

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             YG+AL  ++ +F+ Q+SGKL +D ++ WRGDS L+DG  A +DL+ G YDAGD MKFGF
Sbjct  33   NYGEALTKSLLYFEAQRSGKLPLDQRVIWRGDSALRDGSDAHVDLTGGYYDAGDNMKFGF  92

Query  574  PMAYT  588
            P+A+T
Sbjct  93   PLAFT  97



>ref|XP_009049941.1| hypothetical protein LOTGIDRAFT_113537 [Lottia gigantea]
 gb|ESO99454.1| hypothetical protein LOTGIDRAFT_113537 [Lottia gigantea]
Length=580

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             Y D L+ ++ F++ Q+SGKL  +N+I WRGDSGLKDG    +DL+ G YDAGD +KFGF
Sbjct  153  NYDDVLRKSILFYEAQRSGKLPANNRIPWRGDSGLKDGSDVGVDLTGGWYDAGDHVKFGF  212

Query  574  PMAYT  588
            PMAY+
Sbjct  213  PMAYS  217



>ref|XP_008232258.1| PREDICTED: endoglucanase 14-like [Prunus mume]
Length=485

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YGDAL  ++ +++ Q+SGKL  N ++ WRGDSGLKDG  A +DL  G YDAGD +KFGFP
Sbjct  28   YGDALTKSLLYYEAQRSGKLPPNQRVQWRGDSGLKDGSDAGVDLVGGYYDAGDNVKFGFP  87

Query  577  MAYT  588
            MA+T
Sbjct  88   MAFT  91



>gb|KGM14108.1| endoglucanase [Cellulomonas bogoriensis 69B4 = DSM 16987]
Length=800

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ +M F++ Q+SG L  DN++SWRGDS L DG    +DL+ G YDAGD +KFGFP
Sbjct  43   YGEALQKSMFFYEAQRSGPLPEDNRVSWRGDSALDDGSDVGVDLTGGWYDAGDHVKFGFP  102

Query  577  MAYTA  591
            MA+TA
Sbjct  103  MAFTA  107



>gb|AIQ70583.1| endoglucanase [Paenibacillus graminis]
Length=911

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y +AL+ ++ F++ Q+SG L DN ++ WRGDSGL+DG  A  DL+ G YDAGD +KFGFP
Sbjct  42   YAEALQKSVYFYEAQRSGDLPDNNRVEWRGDSGLQDGADAGHDLTGGWYDAGDHVKFGFP  101

Query  577  MAYTA  591
            MAYTA
Sbjct  102  MAYTA  106



>ref|WP_042268322.1| endoglucanase [Paenibacillus graminis]
Length=890

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y +AL+ ++ F++ Q+SG L DN ++ WRGDSGL+DG  A  DL+ G YDAGD +KFGFP
Sbjct  21   YAEALQKSVYFYEAQRSGDLPDNNRVEWRGDSGLQDGADAGHDLTGGWYDAGDHVKFGFP  80

Query  577  MAYTA  591
            MAYTA
Sbjct  81   MAYTA  85



>ref|WP_035057437.1| endoglucanase [Cellulomonas bogoriensis]
Length=790

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ +M F++ Q+SG L  DN++SWRGDS L DG    +DL+ G YDAGD +KFGFP
Sbjct  33   YGEALQKSMFFYEAQRSGPLPEDNRVSWRGDSALDDGSDVGVDLTGGWYDAGDHVKFGFP  92

Query  577  MAYTA  591
            MA+TA
Sbjct  93   MAFTA  97



>ref|XP_009064976.1| hypothetical protein LOTGIDRAFT_132347 [Lottia gigantea]
 gb|ESO84370.1| hypothetical protein LOTGIDRAFT_132347 [Lottia gigantea]
Length=600

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y D L+ ++ F++ Q+SGKL  +N+I WRGDSGL+DG    LDL+ G YDAGD +KFGFP
Sbjct  175  YDDILRKSILFYEAQRSGKLPGNNRIPWRGDSGLEDGSDVGLDLTGGWYDAGDHVKFGFP  234

Query  577  MAYT  588
            MAY+
Sbjct  235  MAYS  238



>ref|XP_006390849.1| hypothetical protein EUTSA_v10018439mg [Eutrema salsugineum]
 gb|ESQ28135.1| hypothetical protein EUTSA_v10018439mg [Eutrema salsugineum]
Length=499

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
              Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L+DG SA +DLS G YDAGD MKFG
Sbjct  34   HDYRDALRKSIMFFEGQRSGKLPPDQRLRWRRDSALRDGSSAGVDLSGGYYDAGDNMKFG  93

Query  571  FPMAYTA  591
            FPMA+T 
Sbjct  94   FPMAFTT  100



>ref|WP_030479897.1| endoglucanase [Lentzea albidocapillata]
Length=888

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ ++ F+D Q+SGKL   N++SWRGDS L+DG  A LDLS G YDAGD +KFG P
Sbjct  40   YGEALQKSVWFYDAQRSGKLPAGNRVSWRGDSALRDGSDAGLDLSGGFYDAGDHVKFGLP  99

Query  577  MAYT  588
             A++
Sbjct  100  FAFS  103



>ref|WP_035096198.1| hypothetical protein, partial [Aquimarina megaterium]
Length=614

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ ++ F++VQ+SGKL D N++SWR DS + DG   + DL+ G YDAGD +KFGFP
Sbjct  6    YGEALQKSIFFYEVQQSGKLPDWNRVSWRDDSAINDGSGVNKDLTGGWYDAGDHVKFGFP  65

Query  577  MAYTA  591
            MAY+A
Sbjct  66   MAYSA  70



>gb|AFW73285.1| hypothetical protein ZEAMMB73_816336 [Zea mays]
Length=312

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
              YGDAL   + FF+ Q+SG+L  D ++ WR DSGL DG +A +DL+ G YDAGD +KFG
Sbjct  34   HDYGDALHKCILFFEGQRSGRLPPDQRLRWRRDSGLHDGAAAGVDLTGGYYDAGDNVKFG  93

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  94   FPMAFTA  100



>ref|WP_036944358.1| endoglucanase, partial [Pseudobacteroides cellulosolvens]
Length=653

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+  + F++ Q+SGKL DN + +WRGDSG+ DG  + LDL+ G YDAGD +KF  P
Sbjct  38   YGEALQKGIMFYEFQRSGKLPDNMRTNWRGDSGMTDGADSGLDLTGGWYDAGDHVKFNLP  97

Query  577  MAYTA  591
            MAYTA
Sbjct  98   MAYTA  102



>ref|XP_002131623.1| PREDICTED: endoglucanase 22 [Ciona intestinalis]
Length=934

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 1/68 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            T  + + L  ++ F++ Q+SG L  +N+I WRGDSGLKDG   S+DL+ G YDAGD +KF
Sbjct  490  TYDFNEVLHKSILFYEAQRSGPLPQNNRIPWRGDSGLKDGCDQSIDLTGGWYDAGDNIKF  549

Query  568  GFPMAYTA  591
            GFPMAY+A
Sbjct  550  GFPMAYSA  557



>ref|WP_014256118.1| cellulose 1,4-beta-cellobiosidase [[Clostridium] clariflavum]
 gb|AEV69573.1| Cellulose binding domain-containing protein [ [[Clostridium] 
clariflavum DSM 19732]
Length=1541

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN--KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            YG+AL+ A+ F+D Q+SGKL     +++WRGDSGL DGK   LDL+ G YDAGD +KF  
Sbjct  735  YGEALQKAIFFYDCQRSGKLSSTVLRLNWRGDSGLNDGKDVGLDLTGGFYDAGDHVKFNL  794

Query  574  PMAYT  588
            PMAYT
Sbjct  795  PMAYT  799



>gb|EDX71299.1| Glycosyl hydrolase family 9 [Coleofasciculus chthonoplastes PCC 
7420]
Length=658

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+ L+ A+ F+DVQ+SGKL  +N++ WRGDS L DG    +DL+ G YDAGD +KFGFP
Sbjct  49   YGEVLQKAVYFYDVQRSGKLPANNRVEWRGDSALTDGADNGIDLTGGWYDAGDHLKFGFP  108

Query  577  MA  582
            MA
Sbjct  109  MA  110



>ref|WP_027621856.1| cellulose 1,4-beta-cellobiosidase [[Clostridium] clariflavum]
Length=1541

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN--KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
            YG+AL+ A+ F+D Q+SGKL     +++WRGDSGL DGK   LDL+ G YDAGD +KF  
Sbjct  735  YGEALQKAIFFYDCQRSGKLSSTVLRLNWRGDSGLNDGKDVGLDLTGGFYDAGDHVKFNL  794

Query  574  PMAYT  588
            PMAYT
Sbjct  795  PMAYT  799



>ref|WP_043841865.1| hypothetical protein, partial [Roseivivax atlanticus]
Length=438

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDNK-ISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ +MQF+  Q SG L DN  ISWRGDS L DG     DL+ G YDAGD +KFG P
Sbjct  2    YGEALEHSMQFYYAQYSGDLPDNHPISWRGDSALTDGAEVGRDLTGGWYDAGDHVKFGLP  61

Query  577  MAYTA  591
            MAYTA
Sbjct  62   MAYTA  66



>ref|NP_001288415.1| endoglucanase 4-like [Zea mays]
 gb|AFW69905.1| hypothetical protein ZEAMMB73_402804 [Zea mays]
 gb|AGG19099.1| cellulase [Zea mays]
Length=523

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             Y DAL  A+ FF+ Q+SGKL    +++WRGDSGL DG +A LDL+ G YDAGD +KFG 
Sbjct  42   NYADALDKALLFFEAQRSGKLPPGQRVTWRGDSGLTDGSAAGLDLAGGYYDAGDNVKFGL  101

Query  574  PMAYT  588
            PMA+T
Sbjct  102  PMAFT  106



>ref|WP_039787404.1| endoglucanase [Paenibacillus riograndensis]
Length=890

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y +AL+ ++ F++ Q+SG+L DN ++ WRGDSGL+DG     DL+ G YDAGD +KFGFP
Sbjct  21   YAEALQKSIYFYETQRSGELPDNNRVEWRGDSGLQDGADVGHDLTGGWYDAGDHVKFGFP  80

Query  577  MAYTA  591
            MAYTA
Sbjct  81   MAYTA  85



>ref|WP_044210906.1| endoglucanase [Coleofasciculus chthonoplastes]
Length=629

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+ L+ A+ F+DVQ+SGKL  +N++ WRGDS L DG    +DL+ G YDAGD +KFGFP
Sbjct  20   YGEVLQKAVYFYDVQRSGKLPANNRVEWRGDSALTDGADNGIDLTGGWYDAGDHLKFGFP  79

Query  577  MA  582
            MA
Sbjct  80   MA  81



>ref|XP_004953832.1| PREDICTED: endoglucanase 6-like [Setaria italica]
Length=502

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
              YGDAL   + FF+ Q+SG+L  D ++ WR DSGL DG +A +DL+ G YDAGD +KFG
Sbjct  30   HDYGDALHKCILFFEGQRSGRLPPDQRVRWRRDSGLHDGAAAGVDLTGGYYDAGDNVKFG  89

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  90   FPMAFTA  96



>ref|XP_009771552.1| PREDICTED: endoglucanase 13-like [Nicotiana sylvestris]
Length=486

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG AL  ++ +F+ Q+SGKL  N ++ WRGDS L DGK A +DL+ G YDAGD +KFGFP
Sbjct  26   YGTALTKSLLYFEAQRSGKLPPNQRVQWRGDSALNDGKDAGIDLTGGYYDAGDNVKFGFP  85

Query  577  MAYTA  591
            MA+T 
Sbjct  86   MAFTV  90



>ref|XP_010413050.1| PREDICTED: endoglucanase 14-like [Camelina sativa]
Length=479

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL  ++ +F+ Q+SGKL  N +++WRG+S L+DG    +DL+ G YDAGD MKFGFP
Sbjct  22   YGEALTKSLLYFEAQRSGKLPPNQRVTWRGNSALRDGSDVHVDLTGGYYDAGDNMKFGFP  81

Query  577  MAYT  588
            MA+T
Sbjct  82   MAFT  85



>gb|EMT07479.1| Endoglucanase 18 [Aegilops tauschii]
Length=108

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +1

Query  448  SGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFPMAYTA  591
            +GKLV N+I WRGDS + DG+ A LDLS+GMYDAGD +KFGFP+A+TA
Sbjct  6    AGKLVKNQIPWRGDSAVDDGQEAGLDLSRGMYDAGDHIKFGFPLAFTA  53



>ref|XP_006294088.1| hypothetical protein CARUB_v10023082mg [Capsella rubella]
 gb|EOA26986.1| hypothetical protein CARUB_v10023082mg [Capsella rubella]
Length=494

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DLS G YDAGD +KFGF
Sbjct  35   NYGEALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGFDAHIDLSGGYYDAGDNVKFGF  94

Query  574  PMAYT  588
            P+A+T
Sbjct  95   PLAFT  99



>ref|XP_010512853.1| PREDICTED: endoglucanase 14 [Camelina sativa]
Length=491

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG    +DL+ G YDAGD MKFGFP
Sbjct  34   YGEALTKSLLYFEAQRSGKLPPNQRVTWRGDSALRDGSDVHVDLTGGYYDAGDNMKFGFP  93

Query  577  MAYT  588
            +A+T
Sbjct  94   LAFT  97



>ref|XP_006649019.1| PREDICTED: endoglucanase 6-like [Oryza brachyantha]
Length=453

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
              YGDAL  ++ FF+ Q+SG+L  D ++ WR DSGL DG +A +DL+ G YDAGD +KFG
Sbjct  37   HDYGDALHKSILFFEGQRSGRLPPDQRLRWRRDSGLHDGAAAGVDLTGGYYDAGDNVKFG  96

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  97   FPMAFTA  103



>ref|XP_002881964.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58223.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 50/66 (76%), Gaps = 1/66 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            +  YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD MKF
Sbjct  31   STNYGEALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHVDLTGGYYDAGDNMKF  90

Query  568  GFPMAY  585
            GFP+A+
Sbjct  91   GFPLAF  96



>ref|XP_006843620.1| hypothetical protein AMTR_s00007p00146230 [Amborella trichopoda]
 gb|ERN05295.1| hypothetical protein AMTR_s00007p00146230 [Amborella trichopoda]
Length=209

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL  ++ +F+ Q+SGKL    ++ WRGDS L DG S  +DL+ G YDAGD MKFGFP
Sbjct  27   YGEALDKSLLYFEAQRSGKLPTSQRVLWRGDSALSDGHSVGVDLTGGYYDAGDNMKFGFP  86

Query  577  MAYTA  591
            MA+T 
Sbjct  87   MAFTV  91



>gb|AGO86843.1| endo-1,4-beta-glucanase [Bacillus pumilus]
Length=659

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y +AL+ +M F++ Q+SG+L + N+++WRGDSGL+DGK    DL+ G YDAGD +KFG P
Sbjct  49   YVEALQKSMLFYEAQRSGRLPESNRLNWRGDSGLEDGKDVGHDLTGGWYDAGDHVKFGLP  108

Query  577  MAYTA  591
            MAY+A
Sbjct  109  MAYSA  113



>gb|EMT11687.1| Endoglucanase 6 [Aegilops tauschii]
Length=457

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YGDAL  ++ FF+ Q+SG+L  D ++ WR DSGL DG +A +DL+ G YDAGD +KFGFP
Sbjct  25   YGDALHKSILFFEGQRSGRLPPDQRLRWRRDSGLHDGAAAGVDLTGGYYDAGDNVKFGFP  84

Query  577  MAYTA  591
            MA+TA
Sbjct  85   MAFTA  89



>sp|Q5YLG1.1|GUNA_BACPU RecName: Full=Endoglucanase A; AltName: Full=Endo-1,4-beta-glucanase 
A [Bacillus pumilus]
 gb|AAQ91573.1| endoglucanase A precursor [Bacillus pumilus]
Length=659

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y + L+ +M F++ Q+SG+L + N+++WRGDSGLKDGK    DL+ G YDAGD +KFG P
Sbjct  49   YVEVLQKSMLFYEAQRSGRLPESNRLNWRGDSGLKDGKDVGHDLTGGWYDAGDHVKFGLP  108

Query  577  MAYTA  591
            MAY+A
Sbjct  109  MAYSA  113



>ref|WP_036329993.1| endoglucanase [Microbispora sp. ATCC PTA-5024]
 gb|ETK32597.1| endoglucanase [Microbispora sp. ATCC PTA-5024]
Length=795

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ ++ F++ Q+SGKL   N++SWRGDSGL DGK   LDL+ G YDAGD +KFG P
Sbjct  30   YGEALQKSLFFYEAQQSGKLPSTNRVSWRGDSGLNDGKDVGLDLTGGWYDAGDHVKFGLP  89

Query  577  MAYT  588
            MA++
Sbjct  90   MAFS  93



>ref|XP_009115552.1| PREDICTED: endoglucanase 4 [Brassica rapa]
 emb|CDY21424.1| BnaA09g30030D [Brassica napus]
Length=494

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
              Y DALK ++ FF+ Q+SGKL  D ++ WR DSGL+DG SA +DL+ G YDAGD +KFG
Sbjct  32   HDYRDALKKSILFFEGQRSGKLPPDQRLKWRRDSGLRDGSSAGVDLTGGYYDAGDNVKFG  91

Query  571  FPMAYTA  591
            FPMA+T 
Sbjct  92   FPMAFTT  98



>gb|ABC70311.1| endo-1,4-beta-glucanase precursor [Glycine max]
Length=114

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
            T  Y DAL  ++ FF+ Q+ GKL  N ++SWR DSGL DG +  +DL  G YDAGD +KF
Sbjct  36   THNYRDALTKSIIFFEGQRLGKLPSNQRMSWRRDSGLSDGSAMHVDLVGGYYDAGDNVKF  95

Query  568  GFPMAYTA  591
            GFPMA+T 
Sbjct  96   GFPMAFTT  103



>ref|XP_008809411.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 17-like [Phoenix 
dactylifera]
Length=498

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
              Y DAL+ ++ FF+ Q+SGKL  D ++SWR DS L DG +A +DL+ G YDAGD +KFG
Sbjct  27   HDYSDALRKSILFFEGQRSGKLPSDQRLSWRRDSALHDGAAARVDLTGGYYDAGDNVKFG  86

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  87   FPMAFTA  93



>dbj|BAJ85886.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=516

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
              YGDAL  ++ FF+ Q+SG+L  D ++ WR DSGL DG +A +DL+ G YDAGD +KFG
Sbjct  42   HDYGDALHKSILFFEGQRSGRLPPDQRLRWRRDSGLHDGAAAGVDLTGGYYDAGDNVKFG  101

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  102  FPMAFTA  108



>ref|WP_029387306.1| endoglucanase [Streptomyces leeuwenhoekii]
Length=771

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ ++ F++ Q+SG+L D N++ WRGDS L DGK   LDL+ G YDAGD +KFG P
Sbjct  23   YGEALQKSLFFYEAQQSGELPDTNRVGWRGDSALDDGKDVGLDLTGGWYDAGDHVKFGLP  82

Query  577  MAYTA  591
            MAY+A
Sbjct  83   MAYSA  87



>ref|XP_002454331.1| hypothetical protein SORBIDRAFT_04g028790 [Sorghum bicolor]
 gb|EES07307.1| hypothetical protein SORBIDRAFT_04g028790 [Sorghum bicolor]
Length=504

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
              YGDAL   + FF+ Q+SG+L  D ++ WR DSGL DG +A +DL+ G YDAGD +KFG
Sbjct  32   HDYGDALHKCILFFEGQRSGRLPPDQRLRWRRDSGLHDGAAAGVDLTGGYYDAGDNVKFG  91

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  92   FPMAFTA  98



>ref|XP_004301501.1| PREDICTED: endoglucanase 5 [Fragaria vesca subsp. vesca]
Length=625

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL  ++ FF+ Q+SGKL  N ++ WRGDSGLKDG +  +DL  G YDAGD +KFG P
Sbjct  33   YGEALDKSLLFFEAQRSGKLPPNQRVKWRGDSGLKDGLAQGVDLVGGYYDAGDHVKFGLP  92

Query  577  MAYT  588
            MA+T
Sbjct  93   MAFT  96



>gb|ACY72380.1| cellulose hydrolase [Bacillus licheniformis]
Length=646

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/67 (52%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
              Y + L+ ++ F++ Q+SG+L +N +++WRGDSGL+DGK   LDL+ G YDAGD +KFG
Sbjct  33   HNYAELLQKSLLFYEAQRSGRLPENSRLNWRGDSGLEDGKDVGLDLTGGWYDAGDHVKFG  92

Query  571  FPMAYTA  591
             PMAY+A
Sbjct  93   LPMAYSA  99



>ref|WP_039876266.1| endoglucanase [Paenibacillus sp. FSL R7-0273]
 gb|AIQ48864.1| endoglucanase [Paenibacillus sp. FSL R7-0273]
Length=912

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y +AL+ ++ F++ Q+SGKL +N ++ WRGDSG+ DG  A  DL+ G YDAGD +KFGFP
Sbjct  40   YAEALQKSIYFYETQRSGKLPENNRVEWRGDSGMLDGADAGHDLTGGWYDAGDHVKFGFP  99

Query  577  MAYTA  591
            MAYTA
Sbjct  100  MAYTA  104



>ref|NP_001234323.1| endo-1,4-beta-D-glucanase precursor [Solanum lycopersicum]
 emb|CAA72133.1| endo-1,4-beta-D-glucanase [Solanum lycopersicum]
Length=479

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y DAL+ ++ FF+ Q+SGKL  N ++SWRG+SGL+DG  A +DLS G YDAGD +KF FP
Sbjct  20   YRDALEKSILFFEGQRSGKLPPNQRLSWRGNSGLQDGSLAKVDLSGGYYDAGDNVKFNFP  79

Query  577  MAYTA  591
            MAYT 
Sbjct  80   MAYTT  84



>gb|ETW14522.1| cellobiohydrolase A (1,4-beta-cellobiosidase A) [Roseivivax atlanticus]
Length=803

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 40/65 (62%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDNK-ISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG+AL+ +MQF+  Q SG L DN  ISWRGDS L DG     DL+ G YDAGD +KFG P
Sbjct  361  YGEALEHSMQFYYAQYSGDLPDNHPISWRGDSALTDGAEVGRDLTGGWYDAGDHVKFGLP  420

Query  577  MAYTA  591
            MAYTA
Sbjct  421  MAYTA  425



>ref|XP_006343479.1| PREDICTED: endoglucanase 3-like [Solanum tuberosum]
Length=482

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y DAL+ ++ FF+ Q+SGKL  N ++SWRG+SGL+DG  A +DLS G YDAGD +KF FP
Sbjct  23   YRDALEKSILFFEGQRSGKLPPNQRLSWRGNSGLQDGSLAKVDLSGGYYDAGDNVKFNFP  82

Query  577  MAYTA  591
            MAYT 
Sbjct  83   MAYTT  87



>ref|XP_001775325.1| predicted protein [Physcomitrella patens]
 gb|EDQ59795.1| predicted protein [Physcomitrella patens]
Length=608

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 1/63 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            Y  ALK+A++FFD QKSG L   N ISWR  SGL DG+ A ++L+ G YDAGD +KFGFP
Sbjct  106  YTIALKMALKFFDAQKSGHLPPSNNISWRSHSGLNDGRDAGVNLTGGYYDAGDNIKFGFP  165

Query  577  MAY  585
             AY
Sbjct  166  AAY  168



>gb|AAD28258.1|AF128404_1 cellulase homolog [Nicotiana alata]
Length=481

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGFP  576
            YG AL  ++ +F+ Q+SGKL  N ++ WRGDS L DGK A +DL+ G YDAGD +KFGFP
Sbjct  26   YGIALTKSLLYFEAQRSGKLPPNQRVQWRGDSALNDGKDAGIDLTGGYYDAGDNVKFGFP  85

Query  577  MAYTA  591
            MA+T 
Sbjct  86   MAFTV  90



>ref|NP_001131617.2| endoglucanase 1 precursor [Zea mays]
 gb|ACF80108.2| unknown [Zea mays]
 gb|AFW73284.1| endoglucanase 1 [Zea mays]
Length=506

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
              YGDAL   + FF+ Q+SG+L  D ++ WR DSGL DG +A +DL+ G YDAGD +KFG
Sbjct  34   HDYGDALHKCILFFEGQRSGRLPPDQRLRWRRDSGLHDGAAAGVDLTGGYYDAGDNVKFG  93

Query  571  FPMAYTA  591
            FPMA+TA
Sbjct  94   FPMAFTA  100



>emb|CDP00818.1| unnamed protein product [Coffea canephora]
Length=500

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
            Q Y DALK ++ FF+ Q+SG+L  D ++ WR DS L DG SA +DL+ G YDAGD +KFG
Sbjct  38   QNYHDALKKSILFFEGQRSGELPPDQRVRWRKDSALHDGASAGVDLTGGYYDAGDNIKFG  97

Query  571  FPMAYT  588
            FPMA+T
Sbjct  98   FPMAFT  103



>ref|XP_002451429.1| hypothetical protein SORBIDRAFT_04g001960 [Sorghum bicolor]
 gb|EES04405.1| hypothetical protein SORBIDRAFT_04g001960 [Sorghum bicolor]
 emb|CAZ96044.1| endoglucanase 4 precursor [Sorghum bicolor]
Length=514

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 48/67 (72%), Gaps = 3/67 (4%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVD---NKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKF  567
             Y DAL  A+ FF+ Q+SGKL      +++WRGDSGL DG +A +DLS G YDAGD +KF
Sbjct  37   NYADALDKALLFFEAQRSGKLPPRPLQRVTWRGDSGLSDGSAAGVDLSGGYYDAGDNVKF  96

Query  568  GFPMAYT  588
            G PMA+T
Sbjct  97   GLPMAFT  103



>ref|XP_009105740.1| PREDICTED: endoglucanase 8 [Brassica rapa]
 emb|CDX96271.1| BnaA07g28820D [Brassica napus]
Length=499

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFG  570
              Y DAL+ ++ FF+ Q+SGKL  D ++ WR DS L+DG SA +DLS G YDAGD +KFG
Sbjct  34   HDYRDALRKSIMFFEGQRSGKLPPDQRLRWRRDSALRDGSSAGVDLSGGYYDAGDNVKFG  93

Query  571  FPMAYT  588
            FPMA+T
Sbjct  94   FPMAFT  99



>ref|WP_043179538.1| endoglucanase, partial [Streptomyces sp. NRRL F-5123]
Length=831

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGDLMKFGF  573
             Y +AL+ +M F++ Q+SGKL  DN+++WRGDS L DG  A LDL+ G +DAGD +KFGF
Sbjct  3    NYAEALQDSMLFYESQRSGKLPADNRVTWRGDSDLTDGADAGLDLTGGYHDAGDEVKFGF  62

Query  574  PMAYT  588
            PMA++
Sbjct  63   PMAFS  67



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160