BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF049M07

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783307.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    148   1e-41   Nicotiana sylvestris
ref|XP_004229612.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    148   3e-41   
ref|XP_009591907.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    147   5e-41   Nicotiana tomentosiformis
ref|XP_006345468.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    140   2e-38   Solanum tuberosum [potatoes]
ref|XP_008461273.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    130   1e-34   Cucumis melo [Oriental melon]
ref|XP_009773992.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    127   1e-33   Nicotiana sylvestris
ref|XP_004135919.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    126   2e-33   Cucumis sativus [cucumbers]
ref|XP_011087429.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    123   6e-32   Sesamum indicum [beniseed]
ref|XP_003546877.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    122   1e-31   Glycine max [soybeans]
ref|XP_009631181.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    121   2e-31   Nicotiana tomentosiformis
ref|XP_008231311.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    121   3e-31   Prunus mume [ume]
emb|CDP07749.1|  unnamed protein product                                121   7e-31   Coffea canephora [robusta coffee]
ref|XP_007218519.1|  hypothetical protein PRUPE_ppa012532mg             119   1e-30   Prunus persica
ref|XP_011093526.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    120   1e-30   Sesamum indicum [beniseed]
ref|XP_009365004.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    119   2e-30   
ref|XP_003633555.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    119   2e-30   Vitis vinifera
ref|XP_009365003.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    119   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_009365002.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    119   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_010106958.1|  Zinc finger A20 and AN1 domain-containing st...    118   6e-30   Morus notabilis
ref|XP_011025412.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    117   2e-29   Populus euphratica
ref|XP_009354712.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    116   2e-29   Pyrus x bretschneideri [bai li]
ref|XP_008375146.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    116   3e-29   Malus domestica [apple tree]
ref|XP_002314027.1|  zinc finger family protein                         115   5e-29   Populus trichocarpa [western balsam poplar]
ref|NP_001240258.1|  zinc finger A20 and AN1 domain-containing st...    115   6e-29   Glycine max [soybeans]
ref|XP_007052561.1|  Zinc finger A20 and AN1 domain-containing st...    115   1e-28   Theobroma cacao [chocolate]
gb|KDP43451.1|  hypothetical protein JCGZ_16738                         115   1e-28   Jatropha curcas
gb|KHN29214.1|  Zinc finger A20 and AN1 domain-containing stress-...    114   1e-28   Glycine soja [wild soybean]
ref|XP_004306522.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   1e-28   Fragaria vesca subsp. vesca
gb|EYU31355.1|  hypothetical protein MIMGU_mgv1a014767mg                114   2e-28   Erythranthe guttata [common monkey flower]
gb|EYU27075.1|  hypothetical protein MIMGU_mgv1a014771mg                113   4e-28   Erythranthe guttata [common monkey flower]
ref|XP_010557789.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   5e-28   Tarenaya hassleriana [spider flower]
ref|XP_010257261.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   6e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010279007.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   1e-27   Nelumbo nucifera [Indian lotus]
ref|XP_007149048.1|  hypothetical protein PHAVU_005G036400g             115   1e-27   Phaseolus vulgaris [French bean]
ref|XP_002298442.1|  zinc finger family protein                         112   1e-27   Populus trichocarpa [western balsam poplar]
gb|KJB25036.1|  hypothetical protein B456_004G173900                    112   2e-27   Gossypium raimondii
gb|KJB22229.1|  hypothetical protein B456_004G036200                    110   6e-27   Gossypium raimondii
ref|XP_006482901.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   8e-27   Citrus sinensis [apfelsine]
ref|XP_008461789.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   8e-27   Cucumis melo [Oriental melon]
ref|XP_010547246.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   9e-27   Tarenaya hassleriana [spider flower]
ref|XP_008349960.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   1e-26   
ref|XP_006438985.1|  hypothetical protein CICLE_v10032882mg             109   1e-26   Citrus clementina [clementine]
gb|AIJ00004.1|  zinc finger A20 and AN1 domain-containing stress-...    109   2e-26   Gossypium hirsutum [American cotton]
ref|XP_004499868.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   9e-26   Cicer arietinum [garbanzo]
ref|XP_004149600.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   9e-26   Cucumis sativus [cucumbers]
ref|XP_010067883.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   3e-25   Eucalyptus grandis [rose gum]
ref|XP_011025067.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    106   7e-25   Populus euphratica
ref|XP_010534277.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   3e-24   Tarenaya hassleriana [spider flower]
gb|ACR56827.1|  At3g12630-like protein                                  101   1e-23   Solanum hirtum
gb|ACR56824.1|  At3g12630-like protein                                  100   2e-23   Solanum hirtum
gb|ACR56825.1|  At3g12630-like protein                                99.8    4e-23   Solanum quitoense [lulo]
ref|XP_003599112.1|  Zinc finger A20 and AN1 domain-containing st...    100   5e-23   Medicago truncatula
emb|CDY52666.1|  BnaC01g38560D                                        98.2    2e-22   Brassica napus [oilseed rape]
ref|XP_006407313.1|  hypothetical protein EUTSA_v10021683mg           98.2    2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_009120462.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  97.8    2e-22   Brassica rapa
emb|CDY67538.1|  BnaUnng02260D                                        97.1    5e-22   Brassica napus [oilseed rape]
ref|XP_009146604.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  96.7    7e-22   Brassica rapa
emb|CDY08419.1|  BnaA05g26550D                                        96.7    9e-22   Brassica napus [oilseed rape]
ref|XP_006298707.1|  hypothetical protein CARUB_v10014801mg           96.3    1e-21   Capsella rubella
emb|CDX73811.1|  BnaA03g32360D                                        94.7    4e-21   
ref|XP_009135242.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  94.4    5e-21   Brassica rapa
gb|KFK38611.1|  hypothetical protein AALP_AA3G136800                  94.4    6e-21   Arabis alpina [alpine rockcress]
ref|XP_010913137.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.2    2e-20   Elaeis guineensis
ref|XP_010499267.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.2    2e-20   Camelina sativa [gold-of-pleasure]
emb|CDY00788.1|  BnaC03g37720D                                        92.4    3e-20   
ref|XP_010928494.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.4    3e-20   
ref|XP_010489793.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.9    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009391817.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.5    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008776561.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.7    3e-19   Phoenix dactylifera
ref|XP_008795709.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.4    2e-18   Phoenix dactylifera
ref|XP_002882783.1|  hypothetical protein ARALYDRAFT_478622           87.0    3e-18   
ref|XP_010497315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.3    7e-18   Camelina sativa [gold-of-pleasure]
ref|NP_566429.1|  E3 ligase SAP5                                      85.9    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465038.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    2e-17   
ref|XP_009418201.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  83.6    5e-17   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ45178.1|  hypothetical protein OsJ_29820                        83.2    9e-17   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063521.1|  Os09g0486500                                     82.4    2e-16   
gb|EAZ09556.1|  hypothetical protein OsI_31833                        81.3    5e-16   Oryza sativa Indica Group [Indian rice]
gb|EMT06701.1|  Zinc finger A20 and AN1 domain-containing stress-...  80.9    7e-16   
gb|ABK90631.1|  zinc finger protein                                   80.5    8e-16   Aeluropus littoralis
ref|XP_010928202.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  79.0    3e-15   Elaeis guineensis
dbj|BAK03526.1|  predicted protein                                    78.6    4e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008794968.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  78.6    4e-15   Phoenix dactylifera
dbj|BAJ88745.1|  predicted protein                                    78.6    4e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI24864.3|  unnamed protein product                              79.3    6e-15   Vitis vinifera
gb|EMT33843.1|  Zinc finger A20 and AN1 domain-containing stress-...  77.8    9e-15   
ref|XP_003557532.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  77.4    1e-14   Brachypodium distachyon [annual false brome]
ref|XP_010228315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  77.8    2e-14   
gb|AGQ04316.1|  SAP1                                                  76.3    3e-14   Oryza glumipatula
gb|AGQ04314.1|  SAP1                                                  76.3    3e-14   Oryza sativa f. spontanea
ref|XP_002460447.1|  hypothetical protein SORBIDRAFT_02g028240        76.3    3e-14   Sorghum bicolor [broomcorn]
gb|ADF80942.1|  zinc finger protein                                   75.9    4e-14   Phyllostachys praecox [zaozhu]
ref|XP_010925078.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  75.9    5e-14   Elaeis guineensis
ref|NP_001058985.1|  Os07g0168800                                     75.1    8e-14   
ref|XP_008808665.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  74.7    1e-13   Phoenix dactylifera
gb|ACL01101.1|  zinc finger protein                                   74.3    2e-13   Phyllostachys edulis [kikko-chiku]
gb|EPS60935.1|  induced stolon tip protein                            74.3    2e-13   Genlisea aurea
ref|XP_006660763.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  74.3    2e-13   Oryza brachyantha
ref|XP_008344433.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  73.2    3e-13   
gb|ADF80943.1|  zinc finger protein                                   73.2    4e-13   Phyllostachys vivax
ref|XP_010268591.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  72.8    5e-13   Nelumbo nucifera [Indian lotus]
gb|EEC76316.1|  hypothetical protein OsI_13859                        73.2    5e-13   Oryza sativa Indica Group [Indian rice]
gb|EEE60081.1|  hypothetical protein OsJ_12913                        73.2    6e-13   Oryza sativa Japonica Group [Japonica rice]
gb|AAR83854.1|  induced stolon tip protein                            70.5    1e-12   Capsicum annuum
ref|XP_002993103.1|  hypothetical protein SELMODRAFT_187216           72.0    1e-12   
gb|EMS47592.1|  Zinc finger A20 and AN1 domain-containing stress-...  72.4    1e-12   Triticum urartu
dbj|BAK01503.1|  predicted protein                                    71.6    2e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACM68451.1|  stress-associated protein 1                           69.7    2e-12   Solanum pennellii
gb|EMS48100.1|  Zinc finger A20 and AN1 domain-containing stress-...  72.8    2e-12   Triticum urartu
gb|EMT17725.1|  Zinc finger A20 and AN1 domain-containing stress-...  70.9    3e-12   
gb|EMT32776.1|  Zinc finger A20 and AN1 domain-containing stress-...  73.2    3e-12   
ref|XP_006657485.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  70.5    4e-12   Oryza brachyantha
dbj|BAJ94586.1|  predicted protein                                    70.1    4e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACM68446.1|  stress-associated protein 9                           70.1    4e-12   Solanum lycopersicum
ref|XP_004249448.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  70.1    5e-12   
ref|XP_002445913.1|  hypothetical protein SORBIDRAFT_07g027940        70.5    5e-12   Sorghum bicolor [broomcorn]
gb|AGQ04317.1|  SAP1                                                  69.7    5e-12   Oryza longistaminata [long-staminate rice]
gb|AGQ04315.1|  SAP1                                                  69.7    5e-12   Oryza rufipogon [common wild rice]
ref|XP_008344245.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  68.9    7e-12   
ref|XP_010257702.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  69.7    8e-12   Nelumbo nucifera [Indian lotus]
ref|XP_011094369.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  69.7    8e-12   Sesamum indicum [beniseed]
ref|NP_001051527.1|  Os03g0792900                                     69.3    1e-11   
gb|AGQ04319.1|  SAP1                                                  68.6    1e-11   Oryza meridionalis [Australian wild rice]
ref|XP_006487967.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.8    3e-11   Citrus sinensis [apfelsine]
ref|NP_001140650.1|  uncharacterized protein LOC100272725             67.8    4e-11   Zea mays [maize]
ref|XP_004510979.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.0    6e-11   Cicer arietinum [garbanzo]
ref|XP_006339126.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.0    6e-11   Solanum tuberosum [potatoes]
ref|XP_010031823.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  67.0    7e-11   Eucalyptus grandis [rose gum]
ref|NP_001275387.1|  zinc finger A20 and AN1 domain-containing st...  65.9    1e-10   Solanum tuberosum [potatoes]
ref|XP_009419155.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  65.9    1e-10   
gb|KDP35279.1|  hypothetical protein JCGZ_09438                       65.1    2e-10   Jatropha curcas
ref|XP_009412395.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  65.5    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412393.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  65.5    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001106263.1|  AN110                                            65.5    2e-10   
ref|XP_006345467.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  65.5    2e-10   Solanum tuberosum [potatoes]
ref|XP_006361216.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  65.1    3e-10   Solanum tuberosum [potatoes]
ref|XP_010531421.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  65.1    3e-10   Tarenaya hassleriana [spider flower]
ref|XP_010261028.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  65.1    3e-10   Nelumbo nucifera [Indian lotus]
gb|AGQ04323.1|  SAP1                                                  64.7    3e-10   Oryza punctata
ref|XP_004955567.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  64.7    4e-10   Setaria italica
gb|ABK21092.1|  unknown                                               64.7    4e-10   Picea sitchensis
ref|XP_003557802.2|  PREDICTED: zinc finger A20 and AN1 domain-co...  65.1    4e-10   
ref|XP_004228358.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  64.7    5e-10   
ref|XP_008795703.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  64.3    5e-10   Phoenix dactylifera
gb|ACM68454.1|  stress-associated protein 4                           64.3    5e-10   Solanum pennellii
ref|XP_004288126.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  64.3    5e-10   Fragaria vesca subsp. vesca
ref|XP_010228642.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.9    6e-10   
ref|XP_010555326.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.9    6e-10   Tarenaya hassleriana [spider flower]
ref|XP_009802017.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  63.9    6e-10   Nicotiana sylvestris
ref|XP_007206025.1|  hypothetical protein PRUPE_ppa012468mg           63.9    7e-10   Prunus persica
ref|XP_010228638.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.5    8e-10   
emb|CDP10084.1|  unnamed protein product                              64.7    9e-10   Coffea canephora [robusta coffee]
ref|XP_006446073.1|  hypothetical protein CICLE_v10016944mg           63.5    1e-09   
gb|ACM68441.1|  stress-associated protein 4                           63.2    1e-09   Solanum lycopersicum
gb|KDO64800.1|  hypothetical protein CISIN_1g030300mg                 63.5    1e-09   Citrus sinensis [apfelsine]
ref|XP_007133828.1|  hypothetical protein PHAVU_011G212300g           62.8    1e-09   Phaseolus vulgaris [French bean]
ref|XP_004229614.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  63.2    1e-09   
gb|ACM68459.1|  stress-associated protein 9                           63.2    1e-09   Solanum pennellii
gb|AGQ04324.1|  SAP1                                                  62.8    1e-09   Oryza officinalis
ref|XP_009770817.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.8    2e-09   Nicotiana sylvestris
ref|XP_004951572.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.8    2e-09   Setaria italica
ref|XP_002513177.1|  zinc finger protein, putative                    62.4    2e-09   Ricinus communis
ref|XP_002285530.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.8    2e-09   Vitis vinifera
ref|XP_008786424.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.8    2e-09   Phoenix dactylifera
gb|ABK24386.1|  unknown                                               62.4    3e-09   Picea sitchensis
gb|EYU18025.1|  hypothetical protein MIMGU_mgv1a014524mg              62.4    3e-09   Erythranthe guttata [common monkey flower]
ref|XP_010928496.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.4    3e-09   Elaeis guineensis
ref|XP_010907320.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  62.0    3e-09   Elaeis guineensis
gb|EYU46282.1|  hypothetical protein MIMGU_mgv1a014897mg              62.0    4e-09   Erythranthe guttata [common monkey flower]
gb|ACM68453.1|  stress-associated protein 3                           62.0    4e-09   Solanum pennellii
ref|XP_002279037.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.6    4e-09   Vitis vinifera
ref|XP_003542858.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.2    4e-09   Glycine max [soybeans]
ref|XP_006424263.1|  hypothetical protein CICLE_v10029439mg           61.6    4e-09   Citrus clementina [clementine]
ref|XP_006410805.1|  hypothetical protein EUTSA_v10017322mg           61.6    4e-09   Eutrema salsugineum [saltwater cress]
ref|XP_009601977.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.6    4e-09   Nicotiana tomentosiformis
gb|AEZ53300.1|  zinc finger protein                                   61.6    5e-09   Festuca arundinacea [tall fescue]
gb|ACJ86086.1|  unknown                                               61.6    5e-09   Medicago truncatula
ref|XP_008461274.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.6    5e-09   Cucumis melo [Oriental melon]
ref|XP_007145644.1|  hypothetical protein PHAVU_007G256400g           61.6    5e-09   Phaseolus vulgaris [French bean]
gb|ACJ83925.1|  unknown                                               61.6    5e-09   Medicago truncatula
gb|ACM68440.1|  stress-associated protein 3                           61.6    5e-09   Solanum lycopersicum
ref|XP_010279014.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.6    5e-09   Nelumbo nucifera [Indian lotus]
gb|ABI31653.1|  zinc finger protein                                   61.6    5e-09   Camellia sinensis [black tea]
ref|NP_001058066.1|  Os06g0612800                                     61.2    6e-09   
gb|ACG26325.1|  zinc finger A20 and AN1 domains-containing protein    61.2    6e-09   Zea mays [maize]
ref|XP_009407895.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.2    6e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002282913.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  61.2    6e-09   Vitis vinifera
ref|XP_006381027.1|  hypothetical protein POPTR_0006s05520g           61.2    7e-09   Populus trichocarpa [western balsam poplar]
ref|XP_003606132.1|  Zinc finger A20 and AN1 domain-containing st...  60.8    8e-09   Medicago truncatula
ref|NP_001130325.1|  LOC100191419                                     60.8    8e-09   Zea mays [maize]
gb|ABK21043.1|  unknown                                               60.8    9e-09   Picea sitchensis
ref|XP_004135920.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.8    1e-08   
ref|XP_010271706.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.8    1e-08   Nelumbo nucifera [Indian lotus]
emb|CDP20483.1|  unnamed protein product                              60.5    1e-08   Coffea canephora [robusta coffee]
gb|AFK36400.1|  unknown                                               60.5    1e-08   Medicago truncatula
ref|XP_003627722.1|  Zinc finger A20 and AN1 domain-containing st...  60.5    1e-08   Medicago truncatula
ref|XP_010053387.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.5    1e-08   
ref|XP_002304765.2|  zinc finger family protein                       60.5    1e-08   
ref|XP_011080265.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.5    1e-08   Sesamum indicum [beniseed]
gb|ABK26062.1|  unknown                                               60.5    1e-08   Picea sitchensis
ref|XP_004158200.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.5    1e-08   
ref|XP_009418488.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.5    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP09861.1|  unnamed protein product                              60.5    1e-08   Coffea canephora [robusta coffee]
ref|XP_011078867.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.5    1e-08   Sesamum indicum [beniseed]
gb|ABK21003.1|  unknown                                               60.5    1e-08   Picea sitchensis
ref|NP_001288688.1|  zinc finger A20 and AN1 domain-containing st...  60.1    1e-08   Zea mays [maize]
gb|ABK25818.1|  unknown                                               60.1    2e-08   Picea sitchensis
ref|XP_011468813.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  59.7    2e-08   Fragaria vesca subsp. vesca
ref|XP_004306523.2|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.5    2e-08   Fragaria vesca subsp. vesca
ref|XP_004830573.1|  zinc finger protein, putative                    59.7    2e-08   Theileria equi strain WA
ref|XP_006597247.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  59.7    2e-08   
ref|XP_009365001.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  59.7    2e-08   Pyrus x bretschneideri [bai li]
gb|AAQ84334.1|  stress-associated protein 8                           59.7    2e-08   Oryza sativa Indica Group [Indian rice]
gb|ACF80251.1|  unknown                                               59.7    2e-08   Zea mays [maize]
ref|XP_006647019.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  60.5    3e-08   
ref|XP_008349975.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  59.3    3e-08   Malus domestica [apple tree]
gb|AAX14637.1|  zinc finger protein                                   59.3    3e-08   Zea mays [maize]
ref|XP_006842203.1|  hypothetical protein AMTR_s00078p00168800        59.3    3e-08   
ref|XP_007145317.1|  hypothetical protein PHAVU_007G228900g           59.3    3e-08   Phaseolus vulgaris [French bean]
ref|XP_010244455.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  59.3    3e-08   Nelumbo nucifera [Indian lotus]
ref|XP_002297783.1|  zinc finger family protein                       59.3    3e-08   Populus trichocarpa [western balsam poplar]
emb|CBI16408.3|  unnamed protein product                              58.9    3e-08   Vitis vinifera
ref|XP_010911243.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.9    3e-08   Elaeis guineensis
ref|XP_002323304.1|  hypothetical protein POPTR_0016s05220g           58.9    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010105325.1|  Zinc finger A20 and AN1 domain-containing st...  58.9    3e-08   Morus notabilis
ref|XP_010540147.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.9    3e-08   Tarenaya hassleriana [spider flower]
emb|CDP15398.1|  unnamed protein product                              58.9    4e-08   Coffea canephora [robusta coffee]
ref|XP_003633556.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.9    4e-08   Vitis vinifera
gb|ACJ84133.1|  unknown                                               58.9    4e-08   Medicago truncatula
ref|XP_010557404.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  58.9    4e-08   Tarenaya hassleriana [spider flower]
emb|CBI24865.3|  unnamed protein product                              58.5    4e-08   Vitis vinifera
ref|XP_002891622.1|  hypothetical protein ARALYDRAFT_474234           58.9    4e-08   
gb|AFW87479.1|  zinc finger protein1                                  58.9    4e-08   
ref|XP_010500691.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.9    5e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006656245.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.5    5e-08   Oryza brachyantha
ref|XP_007206046.1|  hypothetical protein PRUPE_ppa012588mg           58.5    5e-08   Prunus persica
ref|XP_011037831.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.5    5e-08   Populus euphratica
gb|EMS48637.1|  Zinc finger A20 and AN1 domain-containing stress-...  60.1    5e-08   Triticum urartu
ref|XP_009783306.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.5    6e-08   Nicotiana sylvestris
ref|XP_006354259.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.2    6e-08   Solanum tuberosum [potatoes]
gb|KDO50474.1|  hypothetical protein CISIN_1g030772mg                 58.2    6e-08   Citrus sinensis [apfelsine]
emb|CDP13127.1|  unnamed protein product                              58.2    7e-08   Coffea canephora [robusta coffee]
ref|XP_009770813.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.2    7e-08   Nicotiana sylvestris
gb|EEE56499.1|  hypothetical protein OsJ_05747                        58.2    7e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002975420.1|  hypothetical protein SELMODRAFT_150464           58.2    7e-08   
ref|XP_009589284.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  58.2    8e-08   Nicotiana tomentosiformis
ref|XP_007028890.1|  Zinc finger A20 and AN1 domain-containing st...  58.2    8e-08   
ref|XP_004506164.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  57.8    8e-08   Cicer arietinum [garbanzo]
dbj|BAO74165.1|  zinc finger protein                                  58.2    8e-08   Cucurbita pepo subsp. ovifera
ref|XP_010913090.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  57.8    8e-08   Elaeis guineensis
ref|XP_003547098.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  57.8    9e-08   Glycine max [soybeans]
ref|XP_004798521.1|  PREDICTED: AN1-type zinc finger protein 6        57.8    9e-08   
ref|XP_006427949.1|  hypothetical protein CICLE_v10026622mg           57.8    9e-08   
ref|NP_001046186.1|  Os02g0195600                                     57.8    9e-08   
ref|XP_004250869.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  57.8    1e-07   
dbj|BAO74167.1|  zinc finger protein                                  57.8    1e-07   Cucurbita pepo subsp. pepo [field pumpkin]
ref|XP_009589288.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  57.4    1e-07   Nicotiana tomentosiformis
ref|NP_565844.1|  zinc finger A20 and AN1 domain-containing stres...  57.4    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ACM68452.1|  stress-associated protein 2                           57.4    1e-07   Solanum pennellii
ref|XP_004951575.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  57.4    1e-07   Setaria italica
gb|KHN18756.1|  Zinc finger A20 and AN1 domain-containing stress-...  57.0    1e-07   Glycine soja [wild soybean]
dbj|BAO74168.1|  zinc finger protein                                  57.4    1e-07   Cucurbita pepo subsp. ovifera
emb|CBI29889.3|  unnamed protein product                              57.0    1e-07   Vitis vinifera
gb|ABK92973.1|  unknown                                               57.4    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_006850157.1|  hypothetical protein AMTR_s00022p00239310        57.0    2e-07   Amborella trichopoda
ref|XP_009145588.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  57.0    2e-07   Brassica rapa
ref|NP_001105248.1|  uncharacterized protein LOC542155                57.8    2e-07   
ref|XP_006851496.1|  hypothetical protein AMTR_s00040p00148670        57.4    2e-07   Amborella trichopoda
ref|XP_003597446.1|  Zinc finger A20 and AN1 domain-containing st...  57.0    2e-07   
ref|XP_011075194.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  57.0    2e-07   Sesamum indicum [beniseed]
ref|XP_010233975.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  57.0    2e-07   
ref|XP_002283050.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  57.0    2e-07   Vitis vinifera
ref|XP_009125231.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  57.0    2e-07   Brassica rapa
emb|CBI16411.3|  unnamed protein product                              56.6    2e-07   Vitis vinifera
ref|NP_001106260.1|  LOC100127534                                     57.0    2e-07   Zea mays [maize]
ref|XP_002285543.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  56.2    2e-07   Vitis vinifera
gb|ACT53874.1|  zinc finger protein                                   57.0    2e-07   Saccharum officinarum [noble cane]
ref|XP_002269276.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  56.6    2e-07   Vitis vinifera
ref|XP_006576194.1|  PREDICTED: uncharacterized protein LOC100527...  56.6    2e-07   
ref|XP_008779304.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.8    2e-07   
gb|AFW85155.1|  hypothetical protein ZEAMMB73_831859                  56.6    2e-07   
ref|XP_009411822.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  56.6    2e-07   
ref|XP_004148157.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  56.2    3e-07   
ref|XP_004594633.1|  PREDICTED: AN1-type zinc finger protein 6 is...  56.6    3e-07   
emb|CDX84135.1|  BnaC04g08970D                                        56.2    3e-07   
gb|KJB83686.1|  hypothetical protein B456_013G258400                  56.2    3e-07   
dbj|BAO74166.1|  zinc finger protein                                  56.6    3e-07   
ref|XP_002513466.1|  zinc finger protein, putative                    56.2    3e-07   
ref|XP_010494181.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  56.2    3e-07   
ref|XP_008783998.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  56.2    3e-07   
ref|XP_007052555.1|  Zinc finger A20 and AN1 domain-containing st...  56.2    4e-07   
ref|XP_007027699.1|  A20/AN1-like zinc finger family protein, put...  55.8    4e-07   
ref|XP_008231312.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  56.2    4e-07   
ref|XP_009402699.1|  PREDICTED: zinc finger AN1 domain-containing...  55.8    4e-07   
gb|ADJ67193.1|  hypothetical protein                                  55.8    4e-07   
ref|XP_004160892.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.8    4e-07   
ref|XP_004324566.1|  PREDICTED: AN1-type zinc finger protein 6-li...  56.2    4e-07   
ref|XP_007218502.1|  hypothetical protein PRUPE_ppa012373mg           55.8    4e-07   
gb|EYU20724.1|  hypothetical protein MIMGU_mgv1a015142mg              55.8    4e-07   
dbj|BAO74169.1|  zinc finger protein                                  55.8    4e-07   
emb|CDY13347.1|  BnaC06g14100D                                        55.8    5e-07   
ref|XP_011042076.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.8    5e-07   
ref|XP_006870970.1|  PREDICTED: AN1-type zinc finger protein 6 is...  55.8    5e-07   
ref|XP_004149261.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.5    5e-07   
ref|XP_009128643.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.8    5e-07   
ref|XP_009364301.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.8    5e-07   
ref|XP_010553481.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.8    5e-07   
ref|XP_008378255.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.8    5e-07   
gb|KDP43452.1|  hypothetical protein JCGZ_16739                       55.5    5e-07   
ref|XP_008812241.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.5    6e-07   
ref|NP_001229848.1|  AN1-type zinc finger protein 6 isoform d         55.8    6e-07   
ref|XP_008804805.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.5    6e-07   
ref|XP_003384459.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.5    6e-07   
ref|XP_006304261.1|  hypothetical protein CARUB_v10010492mg           55.5    6e-07   
ref|XP_007447131.1|  PREDICTED: AN1-type zinc finger protein 6 is...  55.5    7e-07   
ref|XP_001756532.1|  predicted protein                                55.5    7e-07   
ref|XP_010913940.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.5    7e-07   
gb|EPY73931.1|  AN1-type zinc finger protein 5                        54.7    8e-07   
ref|XP_009148741.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.1    8e-07   
ref|NP_001237386.1|  uncharacterized protein LOC100306347             55.1    8e-07   
dbj|BAJ86013.1|  predicted protein                                    55.5    8e-07   
emb|CDY66222.1|  BnaAnng21800D                                        55.1    8e-07   
ref|NP_180326.1|  zinc finger A20 and AN1 domain-containing stres...  55.1    8e-07   
ref|XP_008788284.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.1    8e-07   
ref|XP_004278382.1|  PREDICTED: AN1-type zinc finger protein 6 is...  55.1    9e-07   
ref|XP_003542595.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  55.1    9e-07   
gb|KHN07399.1|  Zinc finger A20 and AN1 domain-containing stress-...  55.1    9e-07   
ref|XP_009459927.1|  PREDICTED: AN1-type zinc finger protein 6-li...  55.1    9e-07   
ref|XP_010089512.1|  Zinc finger A20 and AN1 domain-containing st...  54.7    9e-07   
ref|XP_007028887.1|  Zinc finger A20 and AN1 domain-containing st...  55.1    1e-06   
ref|XP_010458672.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  54.7    1e-06   
ref|XP_006189680.1|  PREDICTED: AN1-type zinc finger protein 6 is...  55.1    1e-06   
ref|XP_011395908.1|  Zinc finger A20 and AN1 domain-containing st...  54.7    1e-06   
ref|XP_009143596.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  54.7    1e-06   
ref|XP_002312908.1|  zinc finger family protein                       54.3    1e-06   
gb|AFK93416.1|  stress-response protein                               54.7    1e-06   
ref|XP_004421951.1|  PREDICTED: AN1-type zinc finger protein 6 is...  54.7    1e-06   
ref|XP_001779169.1|  predicted protein                                54.7    1e-06   
ref|XP_004658309.1|  PREDICTED: AN1-type zinc finger protein 6 is...  54.7    1e-06   
ref|XP_004387551.1|  PREDICTED: AN1-type zinc finger protein 6 is...  54.7    1e-06   
ref|XP_009415054.1|  PREDICTED: zinc finger AN1 domain-containing...  54.3    1e-06   
emb|CCI10992.1|  unnamed protein product                              54.3    1e-06   
gb|KGN57296.1|  hypothetical protein Csa_3G177400                     54.3    1e-06   
ref|XP_008228954.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  54.3    2e-06   
ref|XP_009391886.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  54.3    2e-06   
emb|CDX73602.1|  BnaC08g24010D                                        54.3    2e-06   
ref|XP_004406082.1|  PREDICTED: AN1-type zinc finger protein 6-li...  54.3    2e-06   
gb|EPS61935.1|  hypothetical protein M569_12860                       53.9    2e-06   
ref|XP_007066909.1|  PREDICTED: AN1-type zinc finger protein 6 is...  54.3    2e-06   
ref|XP_011046278.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  54.3    2e-06   
ref|XP_006363713.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  53.9    2e-06   
ref|XP_009596933.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  53.9    2e-06   
gb|AIN39820.1|  hypothetical protein                                  53.9    2e-06   
ref|XP_005521625.1|  PREDICTED: AN1-type zinc finger protein 6 is...  54.3    2e-06   
ref|XP_004644513.1|  PREDICTED: AN1-type zinc finger protein 6 is...  54.3    2e-06   
gb|EMT02223.1|  Zinc finger A20 and AN1 domain-containing stress-...  53.5    2e-06   
ref|XP_008334127.1|  PREDICTED: AN1-type zinc finger protein 5-like   54.7    2e-06   
ref|XP_008159435.1|  PREDICTED: AN1-type zinc finger protein 6 is...  53.9    2e-06   
ref|NP_001106259.1|  AN12                                             53.5    2e-06   
ref|XP_009342739.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  53.5    2e-06   
emb|CDX67537.1|  BnaA07g15770D                                        53.5    3e-06   
gb|KHG11802.1|  Zinc finger A20 and AN1 domain-containing stress-...  53.5    3e-06   
gb|ADL36641.1|  C2H2L domain class transcription factor               53.5    3e-06   
ref|NP_001242495.1|  uncharacterized protein LOC100802969             53.9    3e-06   
ref|XP_009416648.1|  PREDICTED: zinc finger AN1 domain-containing...  53.5    3e-06   
ref|XP_006593451.1|  PREDICTED: uncharacterized protein LOC100802...  53.5    3e-06   
ref|XP_010515753.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  53.9    3e-06   
ref|XP_002466323.1|  hypothetical protein SORBIDRAFT_01g005640        53.9    3e-06   
ref|XP_006888306.1|  PREDICTED: AN1-type zinc finger protein 6 is...  53.5    3e-06   
ref|XP_003540534.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  53.1    3e-06   
ref|XP_009081982.1|  PREDICTED: AN1-type zinc finger protein 6-like   53.5    3e-06   
ref|XP_003554427.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  53.1    3e-06   
gb|ACM68443.1|  stress-associated protein 6                           53.1    3e-06   
ref|XP_007155611.1|  hypothetical protein PHAVU_003G216400g           53.1    4e-06   
ref|XP_010157333.1|  PREDICTED: AN1-type zinc finger protein 6 is...  53.5    4e-06   
ref|XP_010139451.1|  PREDICTED: AN1-type zinc finger protein 6 is...  53.1    4e-06   
gb|KCW90256.1|  hypothetical protein EUGRSUZ_A02408                   53.1    4e-06   
ref|XP_008935048.1|  PREDICTED: AN1-type zinc finger protein 6 is...  53.1    4e-06   
ref|XP_004738186.1|  PREDICTED: AN1-type zinc finger protein 6-li...  53.5    4e-06   
emb|CDX95378.1|  BnaC04g27800D                                        52.8    4e-06   
ref|XP_005077919.1|  PREDICTED: AN1-type zinc finger protein 6 is...  53.1    5e-06   
ref|XP_010325448.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  52.8    5e-06   
ref|XP_011044990.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  52.8    5e-06   
ref|XP_007950007.1|  PREDICTED: AN1-type zinc finger protein 6 is...  53.1    5e-06   
ref|XP_008462560.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  52.8    6e-06   
ref|XP_009799138.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  52.4    6e-06   
ref|XP_006660259.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  52.0    6e-06   
gb|EYU35469.1|  hypothetical protein MIMGU_mgv1a022466mg              52.4    6e-06   
ref|NP_194013.1|  A20/AN1-like zinc finger family protein             52.8    6e-06   
ref|XP_005974070.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.8    7e-06   
ref|XP_010538772.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  52.4    7e-06   
ref|XP_009385134.1|  PREDICTED: zinc finger AN1 domain-containing...  52.4    7e-06   
ref|XP_010195894.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.4    8e-06   
ref|XP_008782899.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  52.4    8e-06   
ref|XP_010174709.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.4    8e-06   
ref|XP_001771457.1|  predicted protein                                52.8    8e-06   
ref|XP_010045231.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  52.4    8e-06   
ref|XP_003784626.1|  PREDICTED: AN1-type zinc finger protein 6-li...  52.4    8e-06   
ref|XP_010018692.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.4    8e-06   
ref|XP_009416009.1|  PREDICTED: zinc finger AN1 domain-containing...  52.0    8e-06   
ref|XP_009701714.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.4    8e-06   
ref|XP_005148802.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.4    9e-06   
ref|XP_009584789.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.4    9e-06   
ref|NP_172706.1|  A20/AN1-like zinc finger family protein             52.4    9e-06   
gb|KJB51967.1|  hypothetical protein B456_008G240900                  52.4    9e-06   
ref|XP_005436662.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.4    9e-06   
ref|XP_006288770.1|  hypothetical protein CARUB_v10002091mg           52.4    9e-06   
ref|XP_009876598.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.4    9e-06   
ref|XP_004617671.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.4    1e-05   
gb|ABD65463.1|  DNA binding/zinc ion binding protein                  52.0    1e-05   
ref|NP_190848.1|  zinc finger A20 and AN1 domain-containing stres...  52.0    1e-05   
ref|XP_009507913.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.4    1e-05   
ref|XP_002528717.1|  zinc finger protein, putative                    52.0    1e-05   
dbj|BAJ90521.1|  predicted protein                                    52.0    1e-05   
ref|XP_005889816.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.4    1e-05   
dbj|GAM26264.1|  hypothetical protein SAMD00019534_094390             51.6    1e-05   
ref|NP_001237029.1|  uncharacterized protein LOC100527251             52.0    1e-05   
ref|XP_010189201.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.4    1e-05   
ref|XP_010558994.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  52.4    1e-05   
ref|XP_008490199.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.0    1e-05   
ref|XP_009393780.1|  PREDICTED: zinc finger AN1 domain-containing...  51.6    1e-05   
ref|XP_010286312.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.0    1e-05   
ref|XP_005708852.1|  zinc finger (AN1-like) family protein            52.4    1e-05   
emb|CDY16005.1|  BnaC08g41180D                                        51.6    1e-05   
ref|XP_004930543.1|  PREDICTED: AN1-type zinc finger protein 6-li...  52.0    1e-05   
gb|EFA78520.1|  putative zinc finger protein                          51.2    1e-05   
ref|XP_010510759.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  52.0    1e-05   
ref|XP_010676634.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  51.6    1e-05   
gb|KJB20838.1|  hypothetical protein B456_003G167800                  51.6    1e-05   
ref|XP_003434430.2|  PREDICTED: AN1-type zinc finger protein 6 is...  52.4    1e-05   
ref|XP_009976938.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.0    1e-05   
ref|XP_005419656.1|  PREDICTED: AN1-type zinc finger protein 6 is...  52.0    1e-05   
ref|NP_192941.1|  zinc finger A20 and AN1 domain-containing stres...  51.6    1e-05   
ref|XP_008923640.1|  PREDICTED: AN1-type zinc finger protein 6 is...  51.6    2e-05   
ref|NP_001232980.1|  uncharacterized protein LOC100168509             51.6    2e-05   
ref|XP_006391804.1|  hypothetical protein EUTSA_v10023731mg           51.6    2e-05   
ref|XP_009405572.1|  PREDICTED: zinc finger AN1 domain-containing...  51.2    2e-05   
gb|AAF79653.1|AC025416_27  F5O11.17                                   52.8    2e-05   
ref|XP_004973853.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  51.6    2e-05   
ref|XP_002603180.1|  hypothetical protein BRAFLDRAFT_226485           51.6    2e-05   
ref|XP_002787933.1|  zinc finger protein A20 domain-containing pr...  52.4    2e-05   
ref|XP_008780397.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  50.4    2e-05   
ref|XP_010302402.1|  PREDICTED: AN1-type zinc finger protein 6 is...  51.2    2e-05   
ref|XP_009385326.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  50.4    2e-05   
ref|XP_002768890.1|  zinc finger protein A20 domain-containing pr...  51.2    2e-05   
ref|XP_010529513.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  51.2    2e-05   
gb|EUB63028.1|  Zinc finger A20 and AN1 domain-containing stress-...  52.0    2e-05   
emb|CAG01434.1|  unnamed protein product                              53.1    2e-05   
emb|CDS28068.1|  zinc finger A20 and AN1 domain containing protein    52.0    3e-05   
ref|NP_001055132.1|  Os05g0299700                                     50.8    3e-05   
ref|XP_006365818.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  50.8    3e-05   
ref|XP_008458577.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  50.8    3e-05   
ref|XP_006396803.1|  hypothetical protein EUTSA_v10029014mg           50.8    3e-05   
ref|XP_009958821.1|  PREDICTED: AN1-type zinc finger protein 6-like   50.8    3e-05   
ref|XP_006481799.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  50.8    3e-05   
ref|NP_001106262.1|  AN18                                             50.8    3e-05   
ref|XP_010109094.1|  Zinc finger A20 and AN1 domain-containing st...  50.4    3e-05   
ref|XP_005427359.1|  PREDICTED: AN1-type zinc finger protein 6-li...  50.8    3e-05   
emb|CDP20562.1|  unnamed protein product                              50.4    3e-05   
gb|ABI23728.1|  stress-tolerance zinc finger protein                  50.8    3e-05   
ref|XP_004699786.1|  PREDICTED: AN1-type zinc finger protein 6 is...  50.8    3e-05   
ref|XP_006654239.1|  PREDICTED: zinc finger AN1 domain-containing...  50.8    3e-05   
ref|NP_001062181.1|  Os08g0504700                                     50.8    3e-05   
ref|XP_009114641.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  50.8    3e-05   
ref|XP_009942070.1|  PREDICTED: AN1-type zinc finger protein 6 is...  50.8    3e-05   
ref|XP_001770822.1|  predicted protein                                50.8    3e-05   
gb|KDO61115.1|  hypothetical protein CISIN_1g031015mg                 50.4    3e-05   
gb|ACN30544.1|  unknown                                               50.4    3e-05   
ref|XP_004017840.1|  PREDICTED: AN1-type zinc finger protein 6 is...  50.8    4e-05   
ref|XP_006430236.1|  hypothetical protein CICLE_v10012937mg           50.4    4e-05   
ref|NP_001106266.1|  LOC100127541                                     50.4    4e-05   
ref|XP_010109095.1|  Zinc finger A20 and AN1 domain-containing st...  50.1    4e-05   
ref|XP_004957171.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  50.4    4e-05   
ref|XP_009133075.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  50.1    4e-05   
ref|XP_008638302.1|  PREDICTED: AN1-type zinc finger protein 6 is...  50.4    4e-05   
ref|XP_004252868.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  50.1    4e-05   
gb|ACM68460.1|  stress-associated protein 10                          50.1    4e-05   
ref|XP_006108289.1|  PREDICTED: AN1-type zinc finger protein 6-li...  50.4    4e-05   
dbj|BAA36294.1|  PEM-6                                                50.8    4e-05   
ref|XP_010693357.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  49.7    4e-05   
ref|XP_005872744.1|  PREDICTED: AN1-type zinc finger protein 5-li...  50.8    5e-05   
ref|XP_008906118.1|  hypothetical protein PPTG_12173                  50.1    5e-05   
ref|XP_006219718.1|  PREDICTED: AN1-type zinc finger protein 5-li...  50.4    5e-05   
ref|XP_009082778.1|  PREDICTED: AN1-type zinc finger protein 6 is...  50.4    5e-05   
ref|XP_002892689.1|  hypothetical protein ARALYDRAFT_471394           50.1    5e-05   
ref|XP_005889815.1|  PREDICTED: AN1-type zinc finger protein 6 is...  50.4    5e-05   
gb|ABS72032.1|  putative AN1-like zinc finger protein                 48.5    6e-05   
ref|NP_001135100.1|  AN1-type zinc finger protein 5                   50.8    6e-05   
ref|XP_009560016.1|  PREDICTED: AN1-type zinc finger protein 6 is...  50.1    6e-05   
ref|XP_004324565.1|  PREDICTED: AN1-type zinc finger protein 6-li...  50.4    6e-05   
ref|XP_010876178.1|  PREDICTED: AN1-type zinc finger protein 5-like   50.4    6e-05   
ref|XP_003431370.1|  PREDICTED: AN1-type zinc finger protein 6        50.4    6e-05   
ref|XP_004986196.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  50.1    7e-05   
ref|XP_003574738.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  49.7    7e-05   
ref|XP_008804197.1|  PREDICTED: zinc finger AN1 domain-containing...  49.3    7e-05   
ref|XP_005729526.1|  PREDICTED: AN1-type zinc finger protein 5-li...  50.4    7e-05   
ref|XP_009860635.1|  PREDICTED: AN1-type zinc finger protein 5 is...  50.4    7e-05   
ref|NP_001229846.1|  AN1-type zinc finger protein 6 isoform b         50.1    7e-05   
ref|XP_004594631.1|  PREDICTED: AN1-type zinc finger protein 6 is...  50.1    7e-05   
emb|CEF66902.1|  Zinc finger, AN1-type domain and Zinc finger, A2...  50.4    8e-05   



>ref|XP_009783307.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Nicotiana sylvestris]
Length=180

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 104/146 (71%), Gaps = 12/146 (8%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaa-------gsss  222
            MAQ+T KEETEFK VPETITLCVNNCGVTGNPA NNMCQKCF+ATTAA          S+
Sbjct  1    MAQRTEKEETEFKAVPETITLCVNNCGVTGNPATNNMCQKCFNATTAATSTSASSPTGSA  60

Query  223  aaIHHKFGEKQPRSG-FRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKR  399
              I HKF EK  RS    R S  R+SP+ K   +RT     + +  +E++ +   PPAKR
Sbjct  61   VTIPHKFAEKLARSERSARFSSLRSSPERKSDLERT----SQHLTVKEDKLKESEPPAKR  116

Query  400  EVNRCSGCRRKVGLTGFRCRCGELFC  477
            EVNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  117  EVNRCSGCRRKVGLTGFRCRCGELFC  142



>ref|XP_004229612.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Solanum lycopersicum]
 gb|ABD57310.1| stress-associated protein 1 [Solanum lycopersicum]
Length=188

 Score =   148 bits (373),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 103/150 (69%), Gaps = 12/150 (8%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFs-------attaaagsss  222
            MAQ+T KEETEFK VPETITLC+NNCGVTGNPA NNMCQKCF+        ++++   +S
Sbjct  1    MAQRTEKEETEFKAVPETITLCINNCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGTS  60

Query  223  aaIHHKFGEKQPRS-GFRRLSPERTSPDLKRREDRTVAR----GEKTVeeeeeeeeNRSP  387
              I H F EK  RS    R S  R+SPD K   DR        G+  + +EE++ +   P
Sbjct  61   VTIPHNFAEKLVRSEKSARFSSLRSSPDRKSDLDRMSQDLKKVGDTMMVKEEDQLKASLP  120

Query  388  PAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            PAKREVNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  121  PAKREVNRCSGCRRKVGLTGFRCRCGELFC  150



>ref|XP_009591907.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Nicotiana tomentosiformis]
Length=180

 Score =   147 bits (370),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 99/151 (66%), Gaps = 22/151 (15%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaa-------gsss  222
            MAQ+T KEETEFK VPETITLCVNNCGVTGNPA NNMCQKCF+ATTAA          S 
Sbjct  1    MAQRTEKEETEFKAVPETITLCVNNCGVTGNPATNNMCQKCFNATTAATSTSASSPTGSV  60

Query  223  aaIHHKFGEKQPRS------GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRS  384
              I HKF EK  RS         R SPER S DL+R       + +K         +   
Sbjct  61   VTIPHKFAEKLARSERSARFSLLRSSPERKS-DLERTSQHLTVKEDKM--------KESV  111

Query  385  PPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            PPAKREVNRCSGCRRKVGLTGFRCRCG+LFC
Sbjct  112  PPAKREVNRCSGCRRKVGLTGFRCRCGDLFC  142



>ref|XP_006345468.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Solanum tuberosum]
Length=187

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 104/150 (69%), Gaps = 13/150 (9%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsss-------  222
            MAQ+T KEETEFK VPETITLC+N CGVTGNPA NNMCQKCF+ATTAA  +SS       
Sbjct  1    MAQRTEKEETEFKAVPETITLCIN-CGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSA  59

Query  223  aaIHHKFGEKQPRS-GFRRLSPERTSPDLKRREDRTVAR----GEKTVeeeeeeeeNRSP  387
              I HKF EK  RS    R S  R+ PD K   DR        G+  + +EE++ +   P
Sbjct  60   VTIPHKFAEKLVRSEKSARFSSLRSLPDRKSDLDRMSQDLKKVGDWMMVKEEDQLKESLP  119

Query  388  PAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            PAKREVNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  120  PAKREVNRCSGCRRKVGLTGFRCRCGELFC  149



>ref|XP_008461273.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Cucumis melo]
Length=159

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 96/139 (69%), Gaps = 19/139 (14%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+T KEETEFKV PETITLCVNNCG+TGNPA NNMCQKCF+ATT  A      +  KF
Sbjct  1    MAQRTEKEETEFKV-PETITLCVNNCGLTGNPATNNMCQKCFNATTTTAS-----MAMKF  54

Query  244  -GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
             GEK PRS   R SPE+          R V+   + +   +  + + S  AKREVNRCSG
Sbjct  55   SGEKSPRSTISR-SPEKF---------RFVSESRRIITAADRPKPDES--AKREVNRCSG  102

Query  421  CRRKVGLTGFRCRCGELFC  477
            CR++VGLTGFRCRCG+LFC
Sbjct  103  CRKRVGLTGFRCRCGDLFC  121



>ref|XP_009773992.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=158

 Score =   127 bits (319),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 89/139 (64%), Gaps = 20/139 (14%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPE-TITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHK  240
            MAQ+T KEETE+KVV E TITLCV NCGV GNPA NNMCQ C ++T+A++   +    HK
Sbjct  1    MAQRTEKEETEYKVVHEKTITLCVKNCGVIGNPATNNMCQNCSNSTSASSSKVAYP--HK  58

Query  241  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
            F     RS         TS DLK   DR V   +K         +    PAKREVNRCSG
Sbjct  59   FANILTRS---------TSSDLKNYVDRAVKDDDKV--------KESVSPAKREVNRCSG  101

Query  421  CRRKVGLTGFRCRCGELFC  477
            CRRKVGLTGFRCRCGELFC
Sbjct  102  CRRKVGLTGFRCRCGELFC  120



>ref|XP_004135919.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 ref|XP_004158204.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 gb|KGN45146.1| hypothetical protein Csa_7G428830 [Cucumis sativus]
Length=159

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 96/139 (69%), Gaps = 19/139 (14%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+T KEETEFKV PETITLCVNNCG+TGNP  NNMCQKCF+ATTA A      +  KF
Sbjct  1    MAQRTEKEETEFKV-PETITLCVNNCGLTGNPTTNNMCQKCFNATTATAS-----MAIKF  54

Query  244  -GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
             GEK PRS   R SPE+          R V+   + +   +  + + S  AKREVNRCSG
Sbjct  55   SGEKSPRSTTSR-SPEKF---------RFVSESRRIITAADRPKPDES--AKREVNRCSG  102

Query  421  CRRKVGLTGFRCRCGELFC  477
            CR++VGLTGFRCRCG+LFC
Sbjct  103  CRKRVGLTGFRCRCGDLFC  121



>ref|XP_011087429.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Sesamum indicum]
Length=170

 Score =   123 bits (308),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 92/146 (63%), Gaps = 22/146 (15%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagss--------  219
            MAQKT KEETEFKVVPETI+LCVN CGV GN AANN+CQKCF+ TTA+  +S        
Sbjct  1    MAQKTEKEETEFKVVPETISLCVN-CGVAGNSAANNLCQKCFNTTTASTAASAAATSPGG  59

Query  220  saaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKR  399
            +  +++ F EK  RS     SPER         D  +   E             +PP KR
Sbjct  60   AKHVNNVFVEKSFRS--ITCSPERKFDSADTSGDLKIEAAEV-----------EAPPVKR  106

Query  400  EVNRCSGCRRKVGLTGFRCRCGELFC  477
            +VNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  107  QVNRCSGCRRKVGLTGFRCRCGELFC  132



>ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Glycine max]
Length=161

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 85/138 (62%), Gaps = 15/138 (11%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQKT KEET+FKV PETITLCVNNCGVTGNPA NNMCQKCF+A+TA    +        
Sbjct  1    MAQKTEKEETDFKV-PETITLCVNNCGVTGNPATNNMCQKCFTASTATTSGA--------  51

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
                   G    SP   S    R + R+       V +    ++     AKR VNRCSGC
Sbjct  52   ------GGAGIASPATRSGVSARPQKRSFPEEPSPVADPPSSDQTTPSEAKRVVNRCSGC  105

Query  424  RRKVGLTGFRCRCGELFC  477
            RRKVGLTGFRCRCGELFC
Sbjct  106  RRKVGLTGFRCRCGELFC  123



>ref|XP_009631181.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=156

 Score =   121 bits (304),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 87/140 (62%), Gaps = 24/140 (17%)
 Frame = +1

Query  64   MAQKTGKEETEF-KVVPE-TITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH  237
            MAQ+T KEETE+ KVV E T+TLCV +CGV GNPA NNMCQ CF+A+++          H
Sbjct  1    MAQRTEKEETEYNKVVREKTLTLCVKSCGVIGNPATNNMCQNCFNASSSKVA-----YPH  55

Query  238  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  417
            KF     RS         TS DLK+  DR V   +K  E           PAK EVNRCS
Sbjct  56   KFANILTRS---------TSSDLKKYVDRAVKDDDKAKESV--------SPAKSEVNRCS  98

Query  418  GCRRKVGLTGFRCRCGELFC  477
            GCRRK+GLTGFRCRCGELFC
Sbjct  99   GCRRKLGLTGFRCRCGELFC  118



>ref|XP_008231311.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Prunus mume]
Length=165

 Score =   121 bits (303),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 96/141 (68%), Gaps = 18/141 (13%)
 Frame = +1

Query  61   RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaa-IHH  237
            +MAQ+T KEETEFKV PET+T CVNNCGVTGNP+ NNMCQKCF+A++A   ++S++ +  
Sbjct  3    KMAQRTEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNASSATTTATSSSAVTL  61

Query  238  KF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  414
            KF GEK PRS     S E  +   +R     +AR +++               +R VNRC
Sbjct  62   KFSGEKSPRSS--SFSFEAPAEITRRTTASEIARSDESAN-------------RRVVNRC  106

Query  415  SGCRRKVGLTGFRCRCGELFC  477
            SGCRRKVGLTGFRCRCGELFC
Sbjct  107  SGCRRKVGLTGFRCRCGELFC  127



>emb|CDP07749.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   121 bits (303),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 95/152 (63%), Gaps = 15/152 (10%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH--  237
            MAQKT KEETEFKVVPETIT CVNNCGVTGNPA NNMCQKCF+AT++A+ SSS++     
Sbjct  1    MAQKTEKEETEFKVVPETITPCVNNCGVTGNPATNNMCQKCFNATSSASTSSSSSSSSST  60

Query  238  ------------KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNR  381
                        KFGEK PRS   +      + DL     R +    K            
Sbjct  61   SSSVTSSVAGAIKFGEKSPRSSSSKRLSPERTTDLAEIR-RDLKEEVKEASSAHATAPAT  119

Query  382  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            +   KREVNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  120  AAAVKREVNRCSGCRRKVGLTGFRCRCGELFC  151



>ref|XP_007218519.1| hypothetical protein PRUPE_ppa012532mg [Prunus persica]
 gb|EMJ19718.1| hypothetical protein PRUPE_ppa012532mg [Prunus persica]
Length=165

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 95/141 (67%), Gaps = 18/141 (13%)
 Frame = +1

Query  61   RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaa-IHH  237
            +MAQ+  KEETEFKV PET+T CVNNCGVTGNP+ NNMCQKCF+A++A   ++S++ +  
Sbjct  3    KMAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNASSATTTATSSSAVTL  61

Query  238  KF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  414
            KF GEK PRS     S E  +   +R     +AR +++               +R VNRC
Sbjct  62   KFSGEKSPRSS--SFSFEAPAEITRRTTASEIARSDESAN-------------RRVVNRC  106

Query  415  SGCRRKVGLTGFRCRCGELFC  477
            SGCRRKVGLTGFRCRCGELFC
Sbjct  107  SGCRRKVGLTGFRCRCGELFC  127



>ref|XP_011093526.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Sesamum indicum]
Length=177

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 88/155 (57%), Gaps = 33/155 (21%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+T KEETEFKVVPETITLCV  CGV GN A NN+CQ C+S   AA+ S+        
Sbjct  1    MAQRTEKEETEFKVVPETITLCVK-CGVAGNSATNNLCQTCYSTPAAASTSAVGTPAASA  59

Query  244  GEKQPRSGF-----------------RRLSPERTSPDLKRREDRTVARGEKTVeeeeeee  372
            G  +P++                   R L+   TS DLK+    T               
Sbjct  60   GGPKPKNHVFVGKSFRSSSSTRSSLERSLNMSETSGDLKKEASETA--------------  105

Query  373  eNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
             + +PP KREVNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  106  -DVAPPVKREVNRCSGCRRKVGLTGFRCRCGELFC  139



>ref|XP_009365004.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X3 [Pyrus x bretschneideri]
Length=167

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 95/142 (67%), Gaps = 18/142 (13%)
 Frame = +1

Query  61   RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH-  237
            +MAQ+  KEETEFKV PET+T CVNNCGVTGNP+ NNMCQKCF+A +AAA ++S++    
Sbjct  3    KMAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAATSSSSAAI  61

Query  238  -KF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  411
             KF  EK PRS     + E   P  ++     +AR ++T             P +R VNR
Sbjct  62   LKFSAEKSPRSS-SSFNFEAAPPPCRKTTASEIARSDET-------------PNRRVVNR  107

Query  412  CSGCRRKVGLTGFRCRCGELFC  477
            CSGCRRKVGLTGFRCRCGELFC
Sbjct  108  CSGCRRKVGLTGFRCRCGELFC  129



>ref|XP_003633555.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Vitis vinifera]
Length=172

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 90/143 (63%), Gaps = 14/143 (10%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaI---H  234
            MAQKT KEETEFKV PET+ LCVNNCG TGNPA NNMCQKCFSA+ +AA +++A      
Sbjct  1    MAQKTEKEETEFKV-PETLALCVNNCGFTGNPATNNMCQKCFSASASAAAAAAAGALKSS  59

Query  235  HKF--GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  408
            HK   G    RS   R SPER     +   DRT        +             KREVN
Sbjct  60   HKVSGGAADARSSSAR-SPERMDSLAETSLDRTK-------DAASAAAVEEVGKVKREVN  111

Query  409  RCSGCRRKVGLTGFRCRCGELFC  477
            RCSGCRRKVGLTGFRCRCG+LFC
Sbjct  112  RCSGCRRKVGLTGFRCRCGDLFC  134



>ref|XP_009365003.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X2 [Pyrus x bretschneideri]
Length=168

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 95/143 (66%), Gaps = 19/143 (13%)
 Frame = +1

Query  61   RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH-  237
            +MAQ+  KEETEFKV PET+T CVNNCGVTGNP+ NNMCQKCF+A +AAA ++S++    
Sbjct  3    KMAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAATSSSSSAA  61

Query  238  --KF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  408
              KF  EK PRS     + E   P  ++     +AR ++T             P +R VN
Sbjct  62   ILKFSAEKSPRSS-SSFNFEAAPPPCRKTTASEIARSDET-------------PNRRVVN  107

Query  409  RCSGCRRKVGLTGFRCRCGELFC  477
            RCSGCRRKVGLTGFRCRCGELFC
Sbjct  108  RCSGCRRKVGLTGFRCRCGELFC  130



>ref|XP_009365002.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X1 [Pyrus x bretschneideri]
Length=168

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 95/143 (66%), Gaps = 19/143 (13%)
 Frame = +1

Query  61   RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH-  237
            +MAQ+  KEETEFKV PET+T CVNNCGVTGNP+ NNMCQKCF+A +AAA +++++    
Sbjct  3    KMAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAAAAATSSSSAA  61

Query  238  --KF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  408
              KF  EK PRS     + E   P  ++     +AR ++T             P +R VN
Sbjct  62   ILKFSAEKSPRSS-SSFNFEAAPPPCRKTTASEIARSDET-------------PNRRVVN  107

Query  409  RCSGCRRKVGLTGFRCRCGELFC  477
            RCSGCRRKVGLTGFRCRCGELFC
Sbjct  108  RCSGCRRKVGLTGFRCRCGELFC  130



>ref|XP_010106958.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Morus notabilis]
 gb|EXC12840.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Morus notabilis]
Length=172

 Score =   118 bits (295),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 91/139 (65%), Gaps = 6/139 (4%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH-K  240
            MAQ+T KEETEFKV PE ITLCVNNCGV GNPA NNMCQ CF+ATT  A +S++   + K
Sbjct  1    MAQRTEKEETEFKV-PEKITLCVNNCGVIGNPATNNMCQNCFNATTTTAAASTSTTANLK  59

Query  241  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
            F  ++  S     S   T     RR         KT  +    EE+ + PAKR VNRCSG
Sbjct  60   FSGEKSSSSAISSSSRPTD----RRSASPAENSRKTTADSARSEEDEAVPAKRVVNRCSG  115

Query  421  CRRKVGLTGFRCRCGELFC  477
            CRRKVGLTGFRCRCGELFC
Sbjct  116  CRRKVGLTGFRCRCGELFC  134



>ref|XP_011025412.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
 ref|XP_011007335.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
Length=179

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 89/158 (56%), Gaps = 37/158 (23%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsa----------------  195
            MAQ+  KEETEFKV PET+T C+NNCGVTGNPA NNMCQKCF+A                
Sbjct  1    MAQRAEKEETEFKV-PETLTSCINNCGVTGNPATNNMCQKCFNATTSTSNSSSSSTATSM  59

Query  196  --ttaaagsssaaIHHKFGEKQPRSGFRR--LSPERTSPDLKRREDRTVARGEKTVeeee  363
                 A   S+  I    GEK  RS   R  +   + SP+    ++R+ A          
Sbjct  60   TFAATATSVSNNEILKFTGEKSARSSISRSLVKDPQKSPEKASDKERSCA----------  109

Query  364  eeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
                  S  AK+EVNRCSGCRR+VGLTGFRCRCGELFC
Sbjct  110  ------SHVAKKEVNRCSGCRRRVGLTGFRCRCGELFC  141



>ref|XP_009354712.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Pyrus x bretschneideri]
Length=165

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 94/142 (66%), Gaps = 19/142 (13%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH--  237
            MAQ+  KEETEFKV PET+T CVNNCGVTGNP+ NNMCQKCF+A +AAA +SS++     
Sbjct  1    MAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAATTSSSSSSAAI  59

Query  238  -KF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  411
             KF  EK PRS     S E  +   ++     +AR +++             P +R VNR
Sbjct  60   LKFSAEKSPRST-SSFSFEAQAETFRKTTALEIARSDES-------------PNRRVVNR  105

Query  412  CSGCRRKVGLTGFRCRCGELFC  477
            CSGCRRKVGLTGFRCRCG+LFC
Sbjct  106  CSGCRRKVGLTGFRCRCGDLFC  127



>ref|XP_008375146.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
Length=165

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 93/142 (65%), Gaps = 19/142 (13%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH--  237
            MAQ+  KEETEFKV PET+T CVNNCGVTGNP+ NNMCQKCF+A +AAA +SS++     
Sbjct  1    MAQRAEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCFNAASAAATTSSSSSSAAI  59

Query  238  -KF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  411
             KF  EK PRS     S E      ++     +AR +++             P +R VNR
Sbjct  60   LKFSAEKSPRST-SSFSFEAPVETFRKTTASEIARSDES-------------PNRRVVNR  105

Query  412  CSGCRRKVGLTGFRCRCGELFC  477
            CSGCRRKVGLTGFRCRCGELFC
Sbjct  106  CSGCRRKVGLTGFRCRCGELFC  127



>ref|XP_002314027.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE87982.1| zinc finger family protein [Populus trichocarpa]
Length=179

 Score =   115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 88/158 (56%), Gaps = 37/158 (23%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsa----------------  195
            MAQ+  KEETEFKV PET+T C+NNCGVTGNPA NNMCQKCF+A                
Sbjct  1    MAQRAEKEETEFKV-PETLTSCINNCGVTGNPATNNMCQKCFNASTSTSNSSSSSTATSM  59

Query  196  --ttaaagsssaaIHHKFGEKQPRSGFRR--LSPERTSPDLKRREDRTVARGEKTVeeee  363
                 A   S+  I    GEK  RS   R  +   + SP+    ++R+ A          
Sbjct  60   TFAATATSVSNNEILKFTGEKSARSSISRSLVKDPQKSPETASDKERSCAY---------  110

Query  364  eeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
                     AK+EVNRCSGCRR+VGLTGFRCRCGELFC
Sbjct  111  -------HVAKKEVNRCSGCRRRVGLTGFRCRCGELFC  141



>ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
5-like [Glycine max]
 gb|ADK25058.1| AN1-like transcription factor [Glycine max]
Length=164

 Score =   115 bits (288),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 86/138 (62%), Gaps = 12/138 (9%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQKT KEET+FKV PETITLCVNNCGVTGNPA NNMCQKCF+A T +  ++S A     
Sbjct  1    MAQKTEKEETDFKV-PETITLCVNNCGVTGNPATNNMCQKCFTAFTTSTATTSGAGGAGI  59

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
                 RSG      +R+ P+         +  + T              AKR VNRCSGC
Sbjct  60   ASPATRSGISARPLKRSFPEEPSPPADPPSSDQTT-----------PSEAKRVVNRCSGC  108

Query  424  RRKVGLTGFRCRCGELFC  477
            RRKVGLTGFRCRCGELFC
Sbjct  109  RRKVGLTGFRCRCGELFC  126



>ref|XP_007052561.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5, putative [Theobroma cacao]
 gb|EOX96718.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5, putative [Theobroma cacao]
Length=192

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 96/162 (59%), Gaps = 32/162 (20%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH--  237
            MAQ+T KEETEFKV PET+TLC+NNCGVTGNPA NNMCQKCF+ATTA   SSS++     
Sbjct  1    MAQRTEKEETEFKV-PETLTLCINNCGVTGNPATNNMCQKCFNATTATPSSSSSSSSSAT  59

Query  238  ----------------KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeee  369
                            KF + Q      R +P R+    + R D +      TV      
Sbjct  60   SPSATGGAIAGGASIPKFSDDQS----SRSTPSRSQ---QNRSDSSPPTTAATVTNSRTT  112

Query  370  eeNRS---PPA---KREVNRCSGCRRKVGLTGFRCRCGELFC  477
              NRS   P A   K+ VNRCSGCR++VGLTGFRCRCGELFC
Sbjct  113  AWNRSGNDPAAAAEKKVVNRCSGCRKRVGLTGFRCRCGELFC  154



>gb|KDP43451.1| hypothetical protein JCGZ_16738 [Jatropha curcas]
Length=185

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 95/148 (64%), Gaps = 11/148 (7%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQKT KEETEFKV PET+TLCVNNCG TGNPA NNMCQKCF+ATT+ + S++       
Sbjct  1    MAQKTEKEETEFKV-PETLTLCVNNCGFTGNPATNNMCQKCFNATTSTSNSATVTAAVPA  59

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRT----------VARGEKTVeeeeeeeeNRSPPA  393
                  +     +   +  ++ R+  R+          + +  + V+   + E++ +  A
Sbjct  60   NTTSTTTTTSSAAVVSSGSEILRKSPRSSLSRSPIRDPLRQTNQKVQTSTDREKSDAAVA  119

Query  394  KREVNRCSGCRRKVGLTGFRCRCGELFC  477
            +REVNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  120  RREVNRCSGCRRKVGLTGFRCRCGELFC  147



>gb|KHN29214.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Glycine soja]
Length=136

 Score =   114 bits (284),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 80/138 (58%), Gaps = 40/138 (29%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQKT KEET+FKV PETITLCVNNCGVTGNPA NNMCQKCF+A+TA    +  A     
Sbjct  1    MAQKTEKEETDFKV-PETITLCVNNCGVTGNPATNNMCQKCFTASTATTSGAGGA---GI  56

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
                 RSG        T+P                              AKR VNRCSGC
Sbjct  57   ASPATRSG--------TTPS----------------------------EAKRVVNRCSGC  80

Query  424  RRKVGLTGFRCRCGELFC  477
            RRKVGLTGFRCRCGELFC
Sbjct  81   RRKVGLTGFRCRCGELFC  98



>ref|XP_004306522.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Fragaria vesca subsp. vesca]
Length=170

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 88/146 (60%), Gaps = 22/146 (15%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIH---  234
            MAQ+T KEETEFKV P+T+T CVNNCGVTGNPA NNMCQKCF+ATT+   + + A     
Sbjct  1    MAQRTEKEETEFKV-PDTLTHCVNNCGVTGNPATNNMCQKCFNATTSTPTTVATATTSST  59

Query  235  ----HKF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKR  399
                 KF GEK PRS   R     +    K        R E++               +R
Sbjct  60   TAAVFKFSGEKVPRSSSFRFDAPPSETIRKAAASAESTRSEES-------------SMRR  106

Query  400  EVNRCSGCRRKVGLTGFRCRCGELFC  477
             VNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  107  VVNRCSGCRRKVGLTGFRCRCGELFC  132



>gb|EYU31355.1| hypothetical protein MIMGU_mgv1a014767mg [Erythranthe guttata]
Length=179

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 92/150 (61%), Gaps = 21/150 (14%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHK-  240
            MAQKTG EETEFKVVPE+I LCV  CGV GN AANN+CQKCFS+TTA A +S+ A     
Sbjct  1    MAQKTGNEETEFKVVPESIALCV-KCGVPGNSAANNLCQKCFSSTTAEASTSAVAAAPAS  59

Query  241  -----------FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSP  387
                       FGEK  RS     S      +L      TV   EK          + +P
Sbjct  60   SSGGAKPKSLVFGEKSFRSRSSTRSSPERRLNLP----VTVLDLEKN----PSAVADAAP  111

Query  388  PAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            PAKREVNRC+GCRRKVGLTGFRCRCGELFC
Sbjct  112  PAKREVNRCTGCRRKVGLTGFRCRCGELFC  141



>gb|EYU27075.1| hypothetical protein MIMGU_mgv1a014771mg [Erythranthe guttata]
Length=178

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 93/155 (60%), Gaps = 32/155 (21%)
 Frame = +1

Query  64   MAQKTGKEETEF-KVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssa-----  225
            MAQKT KEETE+ KVVPETI+LCV  CGV GN A NN+C  CF++T  AA +++A     
Sbjct  1    MAQKTEKEETEYSKVVPETISLCVK-CGVAGNCATNNLCHTCFNSTAPAAAAAAAAAAGG  59

Query  226  ----aIHHKFGEKQPRSGF-------RRLSPERTSPDLKRREDRTVARGEKTVeeeeeee  372
                A  H F EK  RS         +R+ P  TS DL++ +D   A             
Sbjct  60   DKLPAASHVFVEKSFRSSSSVRLLPEKRIIPAETSRDLRKLDDSPAAEA-----------  108

Query  373  eNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
               + P KREVNRCSGCRRKVGLTGFRCRCG+LFC
Sbjct  109  ---ALPLKREVNRCSGCRRKVGLTGFRCRCGDLFC  140



>ref|XP_010557789.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=175

 Score =   113 bits (282),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 89/144 (62%), Gaps = 13/144 (9%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsatt--aaagsssaaIHH  237
            MAQ+T KEETE KV P+T+TLCVNNCGVTGNPA NNMCQKCF+ATT  A +   SAA  +
Sbjct  1    MAQRTEKEETEVKV-PDTLTLCVNNCGVTGNPATNNMCQKCFNATTASAVSSPPSAAAAN  59

Query  238  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPA----KREV  405
                     G     P R S  L+   DR+     K +        NR   A    K+ V
Sbjct  60   NNNNSVKDGGLIAKKPARCSA-LRSSSDRSGLSAAKVI-----ISRNRGNDAVEEEKKIV  113

Query  406  NRCSGCRRKVGLTGFRCRCGELFC  477
            NRCSGCRRKVGLTGFRCRCGELFC
Sbjct  114  NRCSGCRRKVGLTGFRCRCGELFC  137



>ref|XP_010257261.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nelumbo nucifera]
Length=163

 Score =   112 bits (281),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 86/139 (62%), Gaps = 15/139 (11%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  KEETEFKV PET+TLC+NNCG  GNP  NNMCQ CF A+             KF
Sbjct  1    MAQRE-KEETEFKV-PETLTLCINNCGFPGNPTTNNMCQNCFKASAGVLTPL------KF  52

Query  244  -GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
             G+ +PRS   R SPER+    +    R V + + T   E       S   +REVNRCSG
Sbjct  53   SGKDKPRSSSVR-SPERSDRPAEPEILREVTKRDTTAAAEVT-----SSVVRREVNRCSG  106

Query  421  CRRKVGLTGFRCRCGELFC  477
            CRRKVGLTGFRCRCG+LFC
Sbjct  107  CRRKVGLTGFRCRCGDLFC  125



>ref|XP_010279007.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nelumbo nucifera]
Length=164

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 86/139 (62%), Gaps = 14/139 (10%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  KEETEFKV PET+TLC+NNCG  GNP  NNMCQ CF A+             KF
Sbjct  1    MAQRE-KEETEFKV-PETLTLCINNCGFPGNPTTNNMCQNCFKASAGVLTPL------KF  52

Query  244  -GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
             G+ +PRS   R SPER+    + R  + V + + T   E           KREVNRCSG
Sbjct  53   SGKDKPRSSSVR-SPERSDRPAETRIFKEVTKRDTTAASEAASAA----VVKREVNRCSG  107

Query  421  CRRKVGLTGFRCRCGELFC  477
            CRRKVGLTGFRCRCGELFC
Sbjct  108  CRRKVGLTGFRCRCGELFC  126



>ref|XP_007149048.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris]
 gb|ESW21042.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris]
Length=301

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 89/146 (61%), Gaps = 12/146 (8%)
 Frame = +1

Query  40   LVVFLVLRMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagss  219
            L +F    MAQKT  EETEFKV PETITLCVNNCGVTGNPA NNMCQ CF+A TA+  ++
Sbjct  130  LTLFSSSSMAQKTENEETEFKV-PETITLCVNNCGVTGNPATNNMCQNCFTAFTASTATT  188

Query  220  saaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKR  399
            S+A          RS               R + R+      +  +    ++N    AKR
Sbjct  189  SSAASAGISSPSARSVAS-----------ARPQKRSFPEEPSSAADPPSSDQNAPSEAKR  237

Query  400  EVNRCSGCRRKVGLTGFRCRCGELFC  477
             VNRCSGCRRKVGLTGFRCRCG+LFC
Sbjct  238  VVNRCSGCRRKVGLTGFRCRCGDLFC  263



>ref|XP_002298442.1| zinc finger family protein [Populus trichocarpa]
 gb|ABK94884.1| unknown [Populus trichocarpa]
 gb|EEE83247.1| zinc finger family protein [Populus trichocarpa]
Length=181

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 94/158 (59%), Gaps = 35/158 (22%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaags---------  216
            MAQ+T KEETE KV PE +TLC+NNCGVTGNPA NNMCQKCF+A+T+ +           
Sbjct  1    MAQRTEKEETECKV-PENLTLCINNCGVTGNPATNNMCQKCFNASTSTSNPSSSTTTTTT  59

Query  217  -----------ssaaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeee  363
                       S+  I     EK  RS   R SP +      +R+ +T +  E++     
Sbjct  60   TITFAATTNGVSTNEILKFTSEKSLRSSISR-SPAKD----HQRQPKTASDKERS-----  109

Query  364  eeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
                + S  AK+EVNRCSGCRR+VGLTGFRCRCGELFC
Sbjct  110  ----DSSSVAKKEVNRCSGCRRRVGLTGFRCRCGELFC  143



>gb|KJB25036.1| hypothetical protein B456_004G173900 [Gossypium raimondii]
Length=180

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 87/145 (60%), Gaps = 10/145 (7%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCF----sattaaagsssaaI  231
            MAQ+T KEETEFKV PET+TLCVNNCGVTGNPA NNMCQKCF    +AT++++ S++   
Sbjct  1    MAQRTEKEETEFKV-PETLTLCVNNCGVTGNPATNNMCQKCFSATTAATSSSSSSTNNTA  59

Query  232  HHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRS---PPAKRE  402
                 +K  RS   R    R+  D                        NRS      K+ 
Sbjct  60   TSATDDKSSRSTPTRSQDNRS--DSAPPTTAATTATATATTNSPMTASNRSGYDTAEKKS  117

Query  403  VNRCSGCRRKVGLTGFRCRCGELFC  477
            VNRCSGCR++VGLTGFRCRCGELFC
Sbjct  118  VNRCSGCRKRVGLTGFRCRCGELFC  142



>gb|KJB22229.1| hypothetical protein B456_004G036200 [Gossypium raimondii]
Length=173

 Score =   110 bits (275),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 85/138 (62%), Gaps = 3/138 (2%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+T KEETEFKV PET+TLCVN+CGV GNPA NNMCQ CF+ATT  + ++  +     
Sbjct  1    MAQRTEKEETEFKV-PETLTLCVNDCGVIGNPATNNMCQNCFNATTPKSTAAVVSSSTGG  59

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
                  S   + S   TS  + +R D +  +    V       +      K+ VNRCSGC
Sbjct  60   ASSGGVSILNQRST--TSRSINKRSDLSPPKTTTFVRSSGSRYDPEPGTEKKVVNRCSGC  117

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGFRCRCGELFC
Sbjct  118  RKRVGLTGFRCRCGELFC  135



>ref|XP_006482901.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Citrus sinensis]
 gb|KDO36542.1| hypothetical protein CISIN_1g030404mg [Citrus sinensis]
Length=178

 Score =   110 bits (274),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 90/145 (62%), Gaps = 12/145 (8%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQKT KEETEFKV PET+TLCVNNCG TGNPA NNMCQKCF+AT     S+ A      
Sbjct  1    MAQKTEKEETEFKV-PETLTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGSSTGG  59

Query  244  GEKQPRS-GFRRLSPE---RTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPA---KRE  402
            G          + S E   R+ P +  R   + A G  T  + +E  + R   A   KR 
Sbjct  60   GGGGGSGVAIIKFSSEKSLRSRPII--RSGSSDAAG--TTGQNQELTDRREKEANVEKRV  115

Query  403  VNRCSGCRRKVGLTGFRCRCGELFC  477
            VNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  116  VNRCSGCRRKVGLTGFRCRCGELFC  140



>ref|XP_008461789.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis melo]
Length=169

 Score =   109 bits (273),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 89/142 (63%), Gaps = 15/142 (11%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+T KEETE KV PETITLCVNNCG TGNP  NNMCQKCF+ATTA A +++ +  +  
Sbjct  1    MAQRTEKEETELKV-PETITLCVNNCGFTGNPTTNNMCQKCFNATTATATTTATSSSNTG  59

Query  244  GEKQPR-SGFRRLSPERTSP---DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  411
                 + SG + L     SP   D  R   R ++           +       AKR+VNR
Sbjct  60   ISSSRKLSGEKSLRSRSRSPVLMDSVRDNSRNMS----------MDRFKSEESAKRQVNR  109

Query  412  CSGCRRKVGLTGFRCRCGELFC  477
            CSGCR++VGLTGFRCRCGELFC
Sbjct  110  CSGCRKRVGLTGFRCRCGELFC  131



>ref|XP_010547246.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=179

 Score =   110 bits (274),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 87/160 (54%), Gaps = 41/160 (26%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsatta-------------  204
            MAQ+T KEETEFKV PET+TLCVNNCGVTGNPA NNMCQKCF+ATTA             
Sbjct  1    MAQRTEKEETEFKV-PETLTLCVNNCGVTGNPATNNMCQKCFNATTASSSSSSVSSIAGA  59

Query  205  ---aagsssaaIHHKFGEKQPR-SGFRRLSPERT--SP---DLKRREDRTVARGEKTVee  357
                             +K  R S  R LS +R+  SP    + R  +  V   EK    
Sbjct  60   NNVVKEGGVGVGGGPISKKTARSSALRSLSKDRSDLSPVKVIIGRNRESDVTEVEKI---  116

Query  358  eeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
                           VNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  117  ---------------VNRCSGCRRKVGLTGFRCRCGELFC  141



>ref|XP_008349960.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
 ref|XP_008349986.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
Length=169

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 95/144 (66%), Gaps = 20/144 (14%)
 Frame = +1

Query  61   RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH-  237
            +MAQ+T KEETEFKV PET+T CVNNCGVTGNP+ NNMCQKC +A +AAA +++++    
Sbjct  3    KMAQRTEKEETEFKV-PETLTHCVNNCGVTGNPSTNNMCQKCXNAASAAAAAATSSSSSA  61

Query  238  ---KF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV  405
               KF  EK PRS     S E  +   ++     +AR ++T             P +R V
Sbjct  62   AILKFSAEKSPRSS-SSFSFEAAAETCRKTTASEIARSDET-------------PNRRVV  107

Query  406  NRCSGCRRKVGLTGFRCRCGELFC  477
            NRCSGCRRKVGLTGFRCRCGELFC
Sbjct  108  NRCSGCRRKVGLTGFRCRCGELFC  131



>ref|XP_006438985.1| hypothetical protein CICLE_v10032882mg [Citrus clementina]
 gb|ESR52225.1| hypothetical protein CICLE_v10032882mg [Citrus clementina]
Length=179

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 91/146 (62%), Gaps = 13/146 (9%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQKT KEETEFKV PET+TLCVNNCG TGNPA NNMCQKCF+AT     S+ A      
Sbjct  1    MAQKTEKEETEFKV-PETLTLCVNNCGFTGNPATNNMCQKCFNATATTTASAVAGSSTSG  59

Query  244  GEKQPRS--GFRRLSPE---RTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPA---KR  399
            G     S     + S E   R+ P +  R   + A G  T  + +E  + R   A   KR
Sbjct  60   GGGGGGSGVAIIKFSSEKSLRSRPII--RSGSSDAAG--TTGQNQELTDRREKEANVEKR  115

Query  400  EVNRCSGCRRKVGLTGFRCRCGELFC  477
             VNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  116  VVNRCSGCRRKVGLTGFRCRCGELFC  141



>gb|AIJ00004.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
1 [Gossypium hirsutum]
Length=180

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 88/147 (60%), Gaps = 14/147 (10%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCF------sattaaagsssa  225
            MAQ+T KEETEFKV PET+TLCVNNCGVTGNPA NNMCQKCF      +++++++ S++ 
Sbjct  1    MAQRTEKEETEFKV-PETLTLCVNNCGVTGNPATNNMCQKCFSATTAATSSSSSSSSTNN  59

Query  226  aIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRS---PPAK  396
                   +K  RS   R    R+          T      +         NRS      K
Sbjct  60   TATSATDDKSSRSTPTRSQDNRSDSAPPTTAATTATATTNS----PMTASNRSGYDTAEK  115

Query  397  REVNRCSGCRRKVGLTGFRCRCGELFC  477
            + VNRCSGCR++VGLTGFRCRCGELFC
Sbjct  116  KSVNRCSGCRKRVGLTGFRCRCGELFC  142



>ref|XP_004499868.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cicer arietinum]
Length=165

 Score =   107 bits (266),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 87/144 (60%), Gaps = 23/144 (16%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVT--GNPAANNMCQKCFsattaaagsssaaIHH  237
            MAQ+T  EETEFKV PETIT+C+NNCGVT  GN A NNMCQ CF+A+TA   S+      
Sbjct  1    MAQRTENEETEFKV-PETITVCINNCGVTVTGNAATNNMCQNCFTASTATTSSTVG----  55

Query  238  KFGEKQPRSGFRRL----SPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV  405
                +  RSG   +    SP+R+ P+         +  + T+             AKR V
Sbjct  56   -ISSQSSRSGVISVNSVRSPKRSLPEESSEITDRNSSDQTTI-----------SEAKRVV  103

Query  406  NRCSGCRRKVGLTGFRCRCGELFC  477
            +RCSGCRRKVGLTGFRCRCG+LFC
Sbjct  104  SRCSGCRRKVGLTGFRCRCGDLFC  127



>ref|XP_004149600.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 ref|XP_004173024.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 gb|KGN58601.1| hypothetical protein Csa_3G697940 [Cucumis sativus]
Length=169

 Score =   107 bits (266),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 88/142 (62%), Gaps = 15/142 (11%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+T KEETE KV PETITLCVNNCG TGNP  NNMCQKCF+ATTA A +++ +  +  
Sbjct  1    MAQRTEKEETELKV-PETITLCVNNCGFTGNPTTNNMCQKCFNATTATATTTATSSSNTG  59

Query  244  GEKQPR-SGFRRLSPERTSP---DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  411
                 + SG +       SP   D  R   R ++           +       AKR+VNR
Sbjct  60   ISSSRKLSGEKSSRSRSRSPVLMDSVRDSSRNIS----------MDRFKSEESAKRQVNR  109

Query  412  CSGCRRKVGLTGFRCRCGELFC  477
            CSGCR++VGLTGFRCRCGELFC
Sbjct  110  CSGCRKRVGLTGFRCRCGELFC  131



>ref|XP_010067883.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Eucalyptus grandis]
 gb|KCW66121.1| hypothetical protein EUGRSUZ_G03392 [Eucalyptus grandis]
Length=190

 Score =   106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 92/162 (57%), Gaps = 34/162 (21%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH--  237
            MAQ+T KEETEFKV PE +TLCVNNCG  GNPA NNMCQKCF+A+++++ SS+       
Sbjct  1    MAQRTEKEETEFKV-PEALTLCVNNCGFAGNPATNNMCQKCFNASSSSSSSSTTTSTTAS  59

Query  238  ---------------------KF-GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTV  351
                                 KF  E+  RSG    SP+R+   +      T A    + 
Sbjct  60   TASSAPTTSSSAGLTGGPSVLKFSAERIHRSGPFSRSPDRSGLAMGMIRRDTGASPPSST  119

Query  352  eeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
                      S  A+REVNRCSGCR++VGLTGFRCRCGELFC
Sbjct  120  ---------ESNSARREVNRCSGCRKRVGLTGFRCRCGELFC  152



>ref|XP_011025067.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
Length=249

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 92/148 (62%), Gaps = 11/148 (7%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+T KEETE KV PE +TLC+NNCGVTGNPA NNMCQKCF+A+T+ +  SS   +   
Sbjct  65   MAQRTEKEETECKV-PENLTLCINNCGVTGNPATNNMCQKCFNASTSTSNPSSTTSNTTA  123

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVA----------RGEKTVeeeeeeeeNRSPPA  393
                  +     +   T+  LK   ++++             ++     ++E  + S  A
Sbjct  124  ATTTTITFAATTNGVSTNEILKFTSEKSLRSSISRSLAKDHQKQPKTASDKERSDSSSVA  183

Query  394  KREVNRCSGCRRKVGLTGFRCRCGELFC  477
            K+EVNRCSGCRR+VGLTGFRCRCGELFC
Sbjct  184  KKEVNRCSGCRRRVGLTGFRCRCGELFC  211



>ref|XP_010534277.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=189

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 87/166 (52%), Gaps = 43/166 (26%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFs-----------------  192
            MAQ+T  EETEFKV PET+TLCVNNCGVTGNPA NNMCQKCF+                 
Sbjct  1    MAQRTENEETEFKV-PETLTLCVNNCGVTGNPANNNMCQKCFNATTATSSSSSAAASASA  59

Query  193  -----------attaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARG  339
                       +     G+    +     +K  RS   R S +R+ P L +    T+ R 
Sbjct  60   SSLPSAAATSASNGVKDGAFGLGVGGPISKKSLRSSAIR-SSDRSGPYLAK---VTIIRN  115

Query  340  EKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
             ++               K+ VNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  116  RES----------DGTEEKKIVNRCSGCRRKVGLTGFRCRCGELFC  151



>gb|ACR56827.1| At3g12630-like protein, partial [Solanum hirtum]
Length=151

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 81/124 (65%), Gaps = 17/124 (14%)
 Frame = +1

Query  133  NNCGVTGNPAANNMCQKCFsattaaagsssa-------aIHHKFGEKQPRS-GFRRLSPE  288
            +NCGVTGNPA NNMCQKCF+ATTAA  +SS+        I  KF EK  RS    R S  
Sbjct  4    HNCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSLL  63

Query  289  RTSP-DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCG  465
            R+S  DLK+  DRT    ++  E          PPAKREVNRCSGCRRKVGLTGFRCRCG
Sbjct  64   RSSSQDLKKVGDRTXKEEDQLKESL--------PPAKREVNRCSGCRRKVGLTGFRCRCG  115

Query  466  ELFC  477
            ELFC
Sbjct  116  ELFC  119



>gb|ACR56824.1| At3g12630-like protein, partial [Solanum hirtum]
Length=147

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 80/123 (65%), Gaps = 17/123 (14%)
 Frame = +1

Query  136  NCGVTGNPAANNMCQKCFsattaaagsssa-------aIHHKFGEKQPRS-GFRRLSPER  291
            NCGVTGNPA NNMCQKCF+ATTAA  +SS+        I  KF EK  RS    R S  R
Sbjct  1    NCGVTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSLLR  60

Query  292  TSP-DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  468
            +S  DLK+  DR V   ++  E          PPAKREVNRCSGCRRKVGLTGFRCRCGE
Sbjct  61   SSSQDLKKVGDRKVKEEDQLKESL--------PPAKREVNRCSGCRRKVGLTGFRCRCGE  112

Query  469  LFC  477
            LFC
Sbjct  113  LFC  115



>gb|ACR56825.1| At3g12630-like protein, partial [Solanum quitoense]
 gb|ACR56826.1| At3g12630-like protein, partial [Solanum quitoense]
Length=150

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 81/125 (65%), Gaps = 17/125 (14%)
 Frame = +1

Query  130  VNNCGVTGNPAANNMCQKCFsattaaagsssa-------aIHHKFGEKQPRS-GFRRLSP  285
             +NCG TGNPA NNMCQKCF+ATTAA  +SS+        I  KF EK  RS    R S 
Sbjct  2    AHNCGFTGNPATNNMCQKCFNATTAATSTSSSSPTGSAVTIPQKFAEKLARSEKSARFSL  61

Query  286  ERTSP-DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRC  462
             R+S  DLK+  DRTV   ++  E          PPAKREV+RCSGCRRKVGLTGFRCRC
Sbjct  62   LRSSSQDLKKVGDRTVKEEDQLKESL--------PPAKREVSRCSGCRRKVGLTGFRCRC  113

Query  463  GELFC  477
            GELFC
Sbjct  114  GELFC  118



>ref|XP_003599112.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
 gb|AES69363.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
 gb|AFK37674.1| unknown [Medicago truncatula]
Length=163

 Score =   100 bits (248),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 76/145 (52%), Gaps = 27/145 (19%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPET-------ITLCVNNCGVTGNPAANNMCQKCFsattaaagsss  222
            MAQ+T  EETEFKVV ET       I LC+ NCGV GNP+ NNMCQ CF+A+T     SS
Sbjct  1    MAQRTENEETEFKVVSETLQQTTTIINLCIKNCGVVGNPSTNNMCQNCFTASTTILPPSS  60

Query  223  aaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE  402
            +         +  S         T  DL           EKTV              KR 
Sbjct  61   SRSVRSPKRSRQESSSSSEEEGSTDHDLV---------DEKTV-----------SEVKRV  100

Query  403  VNRCSGCRRKVGLTGFRCRCGELFC  477
            V+RCSGCRRKVGL GFRCRCGELFC
Sbjct  101  VSRCSGCRRKVGLAGFRCRCGELFC  125



>emb|CDY52666.1| BnaC01g38560D [Brassica napus]
Length=155

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 85/141 (60%), Gaps = 27/141 (19%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITL---CVNNCGVTGNPAANNMCQKCFsattaaagsssaaIH  234
            MAQ+T KEETEFKV+    T    C NNCGVT NPA NNMCQKCF+A+ AAAG  S +I 
Sbjct  1    MAQRTEKEETEFKVLETLTTTPTLCSNNCGVTANPATNNMCQKCFNASVAAAGVDSTSIL  60

Query  235  HKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  414
                ++  RS   R +P +    ++ RE   V R ++T                  +NRC
Sbjct  61   ----KRSARSVNLRSTPAKVV--IRPREIDPVKRDQQT------------------INRC  96

Query  415  SGCRRKVGLTGFRCRCGELFC  477
            SGCR+KVGLTGFRCRCG+LFC
Sbjct  97   SGCRKKVGLTGFRCRCGDLFC  117



>ref|XP_006407313.1| hypothetical protein EUTSA_v10021683mg [Eutrema salsugineum]
 gb|ESQ48766.1| hypothetical protein EUTSA_v10021683mg [Eutrema salsugineum]
Length=158

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 86/144 (60%), Gaps = 30/144 (21%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPE------TITLCVNNCGVTGNPAANNMCQKCFsattaaagsssa  225
            MAQ+T KEETE KV+        T TLC NNCGVT NPA NNMCQKCF+A+ AAAG  S 
Sbjct  1    MAQRTEKEETEVKVLESLATTTTTPTLCSNNCGVTANPATNNMCQKCFNASVAAAGVESG  60

Query  226  aIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV  405
            ++     ++  RS   R +P +    ++ RE   V R ++T                  V
Sbjct  61   SML----KRSARSVNLRSTPAKVV--IRSREIDPVKRDQQT------------------V  96

Query  406  NRCSGCRRKVGLTGFRCRCGELFC  477
            NRCSGCR+KVGLTGFRCRCG+LFC
Sbjct  97   NRCSGCRKKVGLTGFRCRCGDLFC  120



>ref|XP_009120462.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Brassica rapa]
 emb|CDY50536.1| BnaA01g30440D [Brassica napus]
Length=156

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 85/142 (60%), Gaps = 28/142 (20%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITL----CVNNCGVTGNPAANNMCQKCFsattaaagsssaaI  231
            MAQ+T KEETEFKV+    T     C NNCGVT NPA NNMCQKCF+A+ AAAG  S +I
Sbjct  1    MAQRTEKEETEFKVLETLTTTTPTLCSNNCGVTANPATNNMCQKCFNASVAAAGVDSTSI  60

Query  232  HHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  411
                 ++  RS   R +P +    ++ RE   V R ++T                  +NR
Sbjct  61   L----KRSARSVNLRSTPAKVV--IRPREIDPVKRDQQT------------------INR  96

Query  412  CSGCRRKVGLTGFRCRCGELFC  477
            CSGCR+KVGLTGFRCRCG+LFC
Sbjct  97   CSGCRKKVGLTGFRCRCGDLFC  118



>emb|CDY67538.1| BnaUnng02260D [Brassica napus]
Length=159

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 86/145 (59%), Gaps = 31/145 (21%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPE-------TITLCVNNCGVTGNPAANNMCQKCFsattaaagsss  222
            MAQ+T KEETEFKV+         T TLC NNCGVT NPA NNMCQKCF+A+ AAAG  S
Sbjct  1    MAQRTEKEETEFKVLESLTTPATATTTLCSNNCGVTANPATNNMCQKCFNASIAAAGVDS  60

Query  223  aaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE  402
             +      ++  RS   R +P +    ++ RE   V R ++T                  
Sbjct  61   GSTL----KRASRSVNLRPTPAKVV--IRPREIDPVKRDQQT------------------  96

Query  403  VNRCSGCRRKVGLTGFRCRCGELFC  477
            VNRCSGCR+KVGLTGFRCRCG+LFC
Sbjct  97   VNRCSGCRKKVGLTGFRCRCGDLFC  121



>ref|XP_009146604.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Brassica rapa]
Length=159

 Score = 96.7 bits (239),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 84/145 (58%), Gaps = 31/145 (21%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITL-------CVNNCGVTGNPAANNMCQKCFsattaaagsss  222
            MAQ+T KEETEFKV+    T        C NNCGVT NPA NNMCQKCF+A+ AAAG  S
Sbjct  1    MAQRTEKEETEFKVLETLTTPATATTTLCSNNCGVTANPATNNMCQKCFNASIAAAGVDS  60

Query  223  aaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE  402
             +      ++  RS   R SP +    ++ RE   V R ++T                  
Sbjct  61   GST----SKRASRSVNLRPSPAKVV--IRPREIDPVKRDQQT------------------  96

Query  403  VNRCSGCRRKVGLTGFRCRCGELFC  477
            VNRCSGCR+KVGLTGFRCRCG+LFC
Sbjct  97   VNRCSGCRKKVGLTGFRCRCGDLFC  121



>emb|CDY08419.1| BnaA05g26550D [Brassica napus]
Length=159

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 84/145 (58%), Gaps = 31/145 (21%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITL-------CVNNCGVTGNPAANNMCQKCFsattaaagsss  222
            MAQ+T KEETEFKV+    T        C NNCGVT NPA NNMCQKCF+A+ AAAG  S
Sbjct  1    MAQRTEKEETEFKVLETLTTPATATTTLCSNNCGVTANPATNNMCQKCFNASIAAAGVDS  60

Query  223  aaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE  402
             +      ++  RS   R SP +    ++ RE   V R ++T                  
Sbjct  61   GST----SKRASRSVNLRPSPAKVV--IRPREIDPVKRDQQT------------------  96

Query  403  VNRCSGCRRKVGLTGFRCRCGELFC  477
            VNRCSGCR+KVGLTGFRCRCG+LFC
Sbjct  97   VNRCSGCRKKVGLTGFRCRCGDLFC  121



>ref|XP_006298707.1| hypothetical protein CARUB_v10014801mg [Capsella rubella]
 gb|EOA31605.1| hypothetical protein CARUB_v10014801mg [Capsella rubella]
Length=163

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 81/145 (56%), Gaps = 27/145 (19%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCV------NNCGVTGNPAANNMCQKCFsattaaagsssa  225
            MAQ+T KEETEFKV+    T         NNCGVT NPA NNMCQKCF+A+  +A +S  
Sbjct  1    MAQRTEKEETEFKVLETLTTTTAATLLCTNNCGVTANPATNNMCQKCFNASLVSAATSGV  60

Query  226  aIHH-KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE  402
             +      ++  RS   R SP +    ++ RE   V R ++ V                 
Sbjct  61   VVDTGSILKRSARSVNLRSSPAKVV--IRPREMDAVKRDQQVV-----------------  101

Query  403  VNRCSGCRRKVGLTGFRCRCGELFC  477
             NRCSGCR+KVGLTGFRCRCGELFC
Sbjct  102  -NRCSGCRKKVGLTGFRCRCGELFC  125



>emb|CDX73811.1| BnaA03g32360D [Brassica napus]
Length=159

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 81/144 (56%), Gaps = 30/144 (21%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITL------CVNNCGVTGNPAANNMCQKCFsattaaagsssa  225
            MAQ+T KEETEFKVV ET+        C NNCGVT +P+ NNMCQKCF+A+ +    +  
Sbjct  1    MAQRTEKEETEFKVVLETLPTTTTPTLCSNNCGVTASPSTNNMCQKCFNASVSGIDPT--  58

Query  226  aIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV  405
                   ++  RS   R +P R    ++ RE   V R                   ++ V
Sbjct  59   ----PIVKRSARSVSLRSTPARAV--IRPRETDPVKRDHH----------------QQTV  96

Query  406  NRCSGCRRKVGLTGFRCRCGELFC  477
            NRCSGCR+KVGLTGFRCRCG+LFC
Sbjct  97   NRCSGCRKKVGLTGFRCRCGDLFC  120



>ref|XP_009135242.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Brassica rapa]
Length=159

 Score = 94.4 bits (233),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 81/144 (56%), Gaps = 30/144 (21%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITL------CVNNCGVTGNPAANNMCQKCFsattaaagsssa  225
            MAQ+T KEETEFKVV ET+        C NNCGVT +P+ NNMCQKCF+A+ +    +  
Sbjct  1    MAQRTEKEETEFKVVLETLPTTTTPTLCSNNCGVTASPSTNNMCQKCFNASVSGIDPT--  58

Query  226  aIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV  405
                   ++  RS   R +P R    ++ RE   V R                   ++ +
Sbjct  59   ----PIVKRSARSVSLRSTPARAV--IRPRETDPVKRDHH----------------QQTI  96

Query  406  NRCSGCRRKVGLTGFRCRCGELFC  477
            NRCSGCR+KVGLTGFRCRCG+LFC
Sbjct  97   NRCSGCRKKVGLTGFRCRCGDLFC  120



>gb|KFK38611.1| hypothetical protein AALP_AA3G136800 [Arabis alpina]
Length=160

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 83/146 (57%), Gaps = 32/146 (22%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCV-------NNCGVTGNPAANNMCQKCFsattaaagsss  222
            MAQ+T KEETEFKV+    +          NNCGVT NPA NNMCQKCF+A+ A A + S
Sbjct  1    MAQRTEKEETEFKVLETLSSSTATTTTLCSNNCGVTANPATNNMCQKCFNASIAVASADS  60

Query  223  aaIHHKFGEKQPRSGFRRLSPERTSPDLKRRE-DRTVARGEKTVeeeeeeeeNRSPPAKR  399
             +I     ++  RS    L   +T   ++ RE D +V R ++                  
Sbjct  61   GSIL----KRSARSV--NLRSSQTKVVIRNREIDSSVKRDQQI-----------------  97

Query  400  EVNRCSGCRRKVGLTGFRCRCGELFC  477
             VNRCSGCR+KVGLTGFRCRCG+LFC
Sbjct  98   -VNRCSGCRKKVGLTGFRCRCGDLFC  122



>ref|XP_010913137.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Elaeis guineensis]
Length=158

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 78/138 (57%), Gaps = 18/138 (13%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+    E E +V PET TLCVNNCG  GNPA NNMCQ CF A   A+ SS  +     
Sbjct  1    MAQR----EKELQV-PETRTLCVNNCGFYGNPATNNMCQACFQAAGFASSSSPPSCS---  52

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
            G ++PRS   RL      PD      R    G             R  PA R+VNRC+GC
Sbjct  53   GHEKPRSAPFRL------PDPAAEGGRGRVEGPAAKAVAAA---TRLAPA-RQVNRCAGC  102

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGFRCRCGELFC
Sbjct  103  RKRVGLTGFRCRCGELFC  120



>ref|XP_010499267.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Camelina sativa]
Length=166

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 78/148 (53%), Gaps = 30/148 (20%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCV----------NNCGVTGNPAANNMCQKCFsattaaag  213
            MAQ+T KEETEFKV+    T             NNCGVT NPA NNMCQKCF+A+  + G
Sbjct  1    MAQRTEKEETEFKVLETLTTTTTPTTTAATLCTNNCGVTANPATNNMCQKCFNASLVSTG  60

Query  214  sssaaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPA  393
                       ++  RS   R SP +    ++ RE   V R ++ V              
Sbjct  61   VVVVDSGSSVLKRPARSVNLRSSPAKVV--IRPREIDAVKRDQQIV--------------  104

Query  394  KREVNRCSGCRRKVGLTGFRCRCGELFC  477
                NRCSGCR+KVGLTGFRCRCG+LFC
Sbjct  105  ----NRCSGCRKKVGLTGFRCRCGDLFC  128



>emb|CDY00788.1| BnaC03g37720D [Brassica napus]
Length=155

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 77/143 (54%), Gaps = 32/143 (22%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITL-----CVNNCGVTGNPAANNMCQKCFsattaaagsssaa  228
            MAQ+T KEETEFKV+    T      C NNCGVT +P+ NNMCQKCF+A           
Sbjct  1    MAQRTEKEETEFKVLETLTTTTTPTLCSNNCGVTASPSTNNMCQKCFNAGIDPT------  54

Query  229  IHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  408
                  ++  RS   R +P + +  ++ RE   V R                   ++ VN
Sbjct  55   ---PIAKRSARSVSLRSTPAKAA--IRPRETDPVKRDHH----------------QQTVN  93

Query  409  RCSGCRRKVGLTGFRCRCGELFC  477
            RCSGCR+KVGLTGFRCRCG+LFC
Sbjct  94   RCSGCRKKVGLTGFRCRCGDLFC  116



>ref|XP_010928494.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Elaeis guineensis]
Length=161

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 76/138 (55%), Gaps = 15/138 (11%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+    E E +V PET+TLCVNNCG  GNPA NNMCQ CF A    + S  +    + 
Sbjct  1    MAQR----EKELQV-PETLTLCVNNCGFYGNPATNNMCQACFQAAGFTSPSPPS----RS  51

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
            G ++P S     +P R SPD      R  A       +           + R VNRC+GC
Sbjct  52   GHEKPSS-----TPTR-SPDPAVEAGRGGAESPAAKTDAATAAAAVGVASARRVNRCAGC  105

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGFRCRCG LFC
Sbjct  106  RKRVGLTGFRCRCGNLFC  123



>ref|XP_010489793.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=152

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 80/149 (54%), Gaps = 31/149 (21%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCV----------NNCGVTGNPAANNMCQKCFsattaaag  213
            MAQ+T KEETEFKV+    T             NNCGVT NPA NNMCQKCF+A+  +A 
Sbjct  1    MAQRTEKEETEFKVLETLTTTTTPTTTAATLCTNNCGVTANPATNNMCQKCFNASLVSAT  60

Query  214  sssaaIHHKFG-EKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPP  390
            +S          ++  RS   R SP +    ++ RE   V R ++               
Sbjct  61   ASVVVDSGSSVLKRSARSVNLRSSPAKVV--IRPREIDAVKRDQQI--------------  104

Query  391  AKREVNRCSGCRRKVGLTGFRCRCGELFC  477
                VNRCSGCR+KVGLTGFRCRCG+LFC
Sbjct  105  ----VNRCSGCRKKVGLTGFRCRCGDLFC  129



>ref|XP_009391817.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Musa acuminata subsp. malaccensis]
Length=155

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 75/138 (54%), Gaps = 21/138 (15%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  KEE +    PET+TLCVNNCG  GNPA NNMCQ CF A+T AA  +  +     
Sbjct  1    MAQRE-KEEAKLHA-PETLTLCVNNCGFPGNPATNNMCQSCFQASTIAASPAPHSC----  54

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
                PRS     SPER +      E+R     E                  R+V+RC  C
Sbjct  55   ---SPRSALPIRSPERAA------EERDARTSEAPAAAVSAPA------PARQVSRCFSC  99

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGFRCRCG+LFC
Sbjct  100  RKRVGLTGFRCRCGDLFC  117



>ref|XP_008776561.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Phoenix dactylifera]
Length=160

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 80/138 (58%), Gaps = 16/138 (12%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+    E E +V PET TLCVNNCG  GNPA NNMCQ CF A   AA SS  +     
Sbjct  1    MAQR----EKELQV-PETRTLCVNNCGFYGNPATNNMCQACFQAAGFAAPSSPPSCSS--  53

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
              ++PRS     +P R SPD         ARG     +        +  AKR VNRC+GC
Sbjct  54   -HEKPRS-----APAR-SPDPAAEGGWGEARGPPAKPDAAAAAAGVT-LAKR-VNRCAGC  104

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGFRCRCGELFC
Sbjct  105  RKRVGLTGFRCRCGELFC  122



>ref|XP_008795709.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Phoenix dactylifera]
 ref|XP_008778992.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Phoenix dactylifera]
Length=157

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 73/138 (53%), Gaps = 19/138 (14%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+    E E +V PET+TLCVNNCG  GNPA NNMCQ CF A   A+ S  +   H  
Sbjct  1    MAQR----EKELQV-PETLTLCVNNCGFYGNPATNNMCQACFQAAGFASPSPPSRSSH--  53

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
             EK   +  R L P   +            R        + +         R V+RC+GC
Sbjct  54   -EKASSAPARSLDPAAEA-----------GREGAEGPAGKADAAAAVVSPARRVSRCAGC  101

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGFRCRCG+LFC
Sbjct  102  RKRVGLTGFRCRCGKLFC  119



>ref|XP_002882783.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59042.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. 
lyrata]
Length=160

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 76/143 (53%), Gaps = 26/143 (18%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNC-----GVTGNPAANNMCQKCFsattaaagsssaa  228
            MAQ+T KEETEFKV+    T           GVT NPA NNMCQKCF+A+  +A +    
Sbjct  1    MAQRTEKEETEFKVLDTLTTTTTTTLCTNNCGVTANPATNNMCQKCFNASLVSAAAGVVE  60

Query  229  IHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  408
                  ++  RS   R SP +    ++ RE   V R ++                   VN
Sbjct  61   -SGSILKRSARSVNLRSSPAKVV--IRTREIDAVKRDQQI------------------VN  99

Query  409  RCSGCRRKVGLTGFRCRCGELFC  477
            RCSGCR+KVGLTGFRCRCGELFC
Sbjct  100  RCSGCRKKVGLTGFRCRCGELFC  122



>ref|XP_010497315.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=170

 Score = 86.3 bits (212),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 79/152 (52%), Gaps = 34/152 (22%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCV----------NNCGVTGNPAA-NNMCQKCFsattaaa  210
            MAQ+T KEETEFKV+    T             NNCGVT NPA  NNMCQKCF+A+  +A
Sbjct  1    MAQRTEKEETEFKVLETLTTTTTPTTTAATLCTNNCGVTANPATNNNMCQKCFNASLVSA  60

Query  211  gsssaaIHHKFGEKQPRSGFRRLSPERTSPD---LKRREDRTVARGEKTVeeeeeeeeNR  381
             +    +         RS   R    R+SP    ++ RE   V R ++            
Sbjct  61   TTGVVVVDSGSSSVLKRSA--RSVNLRSSPAKVVIRPREIDAVKRDQQI-----------  107

Query  382  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
                   VNRCSGCR+KVGLTGFRCRCG+LFC
Sbjct  108  -------VNRCSGCRKKVGLTGFRCRCGDLFC  132



>ref|NP_566429.1| E3 ligase SAP5 [Arabidopsis thaliana]
 sp|Q9LHJ8.1|SAP5_ARATH RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 5; Short=AtSAP5 [Arabidopsis thaliana]
 gb|AAG51008.1|AC069474_7 unknown protein; 15087-14605 [Arabidopsis thaliana]
 dbj|BAB02254.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM61324.1| unknown [Arabidopsis thaliana]
 gb|AAP88348.1| At3g12630 [Arabidopsis thaliana]
 dbj|BAF00270.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75226.1| E3 ligase SAP5 [Arabidopsis thaliana]
Length=160

 Score = 85.9 bits (211),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 78/142 (55%), Gaps = 24/142 (17%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNC----GVTGNPAANNMCQKCFsattaaagsssaaI  231
            MAQ+T KEETEFKV+    T     C    GVT NPA NNMCQKCF+A+  +A +     
Sbjct  1    MAQRTEKEETEFKVLETLTTTTTTLCTNNCGVTANPATNNMCQKCFNASLVSAAAGVVE-  59

Query  232  HHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  411
                 ++  RS   R SP +    ++ RE   V + ++ +                 VNR
Sbjct  60   SGSILKRSARSVNLRSSPAKVV--IRPREIDAVKKRDQQI-----------------VNR  100

Query  412  CSGCRRKVGLTGFRCRCGELFC  477
            CSGCR+KVGLTGFRCRCGELFC
Sbjct  101  CSGCRKKVGLTGFRCRCGELFC  122



>ref|XP_010465038.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=213

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 79/152 (52%), Gaps = 34/152 (22%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCV----------NNCGVTGNPAA-NNMCQKCFsattaaa  210
            MAQ+T KEETEFKV+    T             NNCGVT NPA  NNMCQKCF+A+  +A
Sbjct  44   MAQRTEKEETEFKVLETLTTTTTPTTTAATLCTNNCGVTANPATNNNMCQKCFNASLVSA  103

Query  211  gsssaaIHHKFGEKQPRSGFRRLSPERTSPD---LKRREDRTVARGEKTVeeeeeeeeNR  381
             +    +         RS   R    R+SP    ++ RE   V R ++            
Sbjct  104  TTGVVVVDSGSSSVLKRSA--RSVNLRSSPAKVVIRPREIDPVKRDQQI-----------  150

Query  382  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
                   VNRCSGCR+KVGLTGFRCRCGELFC
Sbjct  151  -------VNRCSGCRKKVGLTGFRCRCGELFC  175



>ref|XP_009418201.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Musa acuminata subsp. malaccensis]
Length=155

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 76/139 (55%), Gaps = 23/139 (17%)
 Frame = +1

Query  64   MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHK  240
            MAQ+   EE E ++   E++ LC+NNCG  G+PA NNMCQ CF A+ AAA SS       
Sbjct  1    MAQR---EEKEMELHAHESLALCINNCGFPGDPATNNMCQTCFQASPAAASSSL------  51

Query  241  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
                 PRS  RR +P   SPD     DR   +G  T                R+VNRC  
Sbjct  52   -----PRSCSRRSAPSIRSPDPA---DRAEEQGAPTAALASPAPA-----PARKVNRCLS  98

Query  421  CRRKVGLTGFRCRCGELFC  477
            CR++VG TGFRCRCGELFC
Sbjct  99   CRKRVGFTGFRCRCGELFC  117



>gb|EAZ45178.1| hypothetical protein OsJ_29820 [Oryza sativa Japonica Group]
Length=164

 Score = 83.2 bits (204),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 68/138 (49%), Gaps = 12/138 (9%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  K++   ++    ITLC N+CG  GNPA  N+CQ CF A TA   S S+      
Sbjct  1    MAQRDKKDQEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAATAFTSSPSSLSSPVL  60

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
             ++ PR     + P+   P         +A     V +               VNRCS C
Sbjct  61   DKQPPRPAAPLVEPQAPLPPPVEEMASALATAPAPVAKTSA------------VNRCSRC  108

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGFRCRCG LFC
Sbjct  109  RKRVGLTGFRCRCGHLFC  126



>ref|NP_001063521.1| Os09g0486500 [Oryza sativa Japonica Group]
 sp|A2Z2J6.1|SAP1_ORYSI RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 1; Short=OsSAP1; AltName: Full=Multiple 
stress-responsive zinc finger protein ISAP1; Short=OsiSAP1 
[Oryza sativa Indica Group]
 sp|A3C039.2|SAP1_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 1; Short=OsSAP1; AltName: Full=Multiple 
stress-responsive zinc finger protein ISAP1; Short=OsiSAP1 
[Oryza sativa Japonica Group]
 gb|AAF74344.1|AF140722_1 multiple stress-responsive zinc-finger protein [Oryza sativa 
Indica Group]
 gb|AAN15744.1| multiple stress-associated zinc-finger protein [Oryza sativa 
Indica Group]
 dbj|BAF25435.1| Os09g0486500 [Oryza sativa Japonica Group]
 gb|EAZ09557.1| hypothetical protein OsI_31835 [Oryza sativa Indica Group]
 gb|ABQ12733.1| Zn-finger protein [Oryza sativa Indica Group]
 gb|ABR26098.1| multiple stress-responsive zinc-finger protein isap1 [Oryza sativa 
Indica Group]
 dbj|BAG87708.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91792.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97589.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99795.1| unnamed protein product [Oryza sativa Japonica Group]
Length=164

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 69/138 (50%), Gaps = 12/138 (9%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  K++   ++    ITLC N+CG  GNPA  N+CQ CF A TA+  S S+      
Sbjct  1    MAQRDKKDQEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVL  60

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
             ++ PR     + P+   P         +A     V +               VNRCS C
Sbjct  61   DKQPPRPAAPLVEPQAPLPPPVEEMASALATAPAPVAKTSA------------VNRCSRC  108

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGFRCRCG LFC
Sbjct  109  RKRVGLTGFRCRCGHLFC  126



>gb|EAZ09556.1| hypothetical protein OsI_31833 [Oryza sativa Indica Group]
Length=164

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 68/138 (49%), Gaps = 12/138 (9%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ   K++   ++    ITLC N+CG  GNPA  N+CQ CF A TA+  S S+      
Sbjct  1    MAQGDKKDQEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVL  60

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
             ++ PR     + P+   P         +A     V +               VNRCS C
Sbjct  61   DKQPPRPAAPLVEPQAPLPPPVEEMASALATAPAPVAKTSA------------VNRCSRC  108

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGFRCRCG LFC
Sbjct  109  RKRVGLTGFRCRCGHLFC  126



>gb|EMT06701.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
1 [Aegilops tauschii]
Length=165

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 69/140 (49%), Gaps = 15/140 (11%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  K+E   ++    ITLC N+CG  GNPA  N+CQ CF A  A+   SS++     
Sbjct  1    MAQRDHKQEEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAGPASTSPSSSSSSSSS  60

Query  244  --GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  417
              G   P     R  P     +L R         E               PA+  VNRCS
Sbjct  61   LPGVSAPTPVIDRPRPAPLEAELARPAVDLAPATEAK-------------PARTSVNRCS  107

Query  418  GCRRKVGLTGFRCRCGELFC  477
             CR++VGLTGFRCRCG++FC
Sbjct  108  SCRKRVGLTGFRCRCGDMFC  127



>gb|ABK90631.1| zinc finger protein [Aeluropus littoralis]
Length=159

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 64/140 (46%), Gaps = 21/140 (15%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ++ K+E+     PE   LC+NNCG  G+   NNMC KC+          +  +  K 
Sbjct  1    MAQESWKQESH---APEAPILCINNCGFFGSSMTNNMCSKCYRDFVKLMEMDAPVVDKKL  57

Query  244  GEKQPRSG--FRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  417
                  S   F     + T PD    +D+  A+                 P K   NRCS
Sbjct  58   ITTASSSTVPFETAKQDDTVPDAAAMDDKQPAQE----------------PPKPPSNRCS  101

Query  418  GCRRKVGLTGFRCRCGELFC  477
             CR+KVGLTGF+CRCG  FC
Sbjct  102  TCRKKVGLTGFQCRCGGTFC  121



>ref|XP_010928202.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Elaeis guineensis]
Length=164

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 69/140 (49%), Gaps = 17/140 (12%)
 Frame = +1

Query  61   RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHK  240
            + +QK   EETEF+  P   TLC NNCG  G+PA NN+C KC+                 
Sbjct  3    QESQKREAEETEFQT-PNIPTLCANNCGFFGSPATNNLCSKCY---------------KD  46

Query  241  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVee-eeeeeeNRSPPAKREVNRCS  417
            +   + ++    L     +   K  E      GE  VE   EE   +   PAK+  NRCS
Sbjct  47   YFLSKSKASIETLVVPPPAEAKKVEEKAAGGDGEAKVESFAEEGAPSGESPAKKPTNRCS  106

Query  418  GCRRKVGLTGFRCRCGELFC  477
             C +KVGL GF+CRCGE+FC
Sbjct  107  FCNKKVGLMGFKCRCGEVFC  126



>dbj|BAK03526.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=163

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 64/138 (46%), Gaps = 13/138 (9%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  K+E   ++    ITLC N+CG  GNPA  N+CQ CF             +    
Sbjct  1    MAQRDHKQEEPTELRAPEITLCANSCGFPGNPATQNLCQNCF-------------LAGPA  47

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
                  S         ++P L R     V         +       + PA+  VNRCS C
Sbjct  48   STSPSSSSSSLPGASVSTPVLDRPRPAPVDAELAHPAVDYRATATEAKPARTSVNRCSSC  107

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGFRCRCG++FC
Sbjct  108  RKRVGLTGFRCRCGDVFC  125



>ref|XP_008794968.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
Length=164

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 71/139 (51%), Gaps = 19/139 (14%)
 Frame = +1

Query  67   AQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFG  246
            +QK   EETEF+  P   TLC NNCG  G+PA NN+C KC+                 F 
Sbjct  5    SQKREAEETEFQT-PNMPTLCANNCGFFGSPATNNLCSKCYKDC--------------FL  49

Query  247  EKQPRSGFRRLSPERTSPDLKRREDRTVA-RGEKTVeeeeeeeeNRS-PPAKREVNRCSG  420
             K   S    + P   S + K+ E++ +   GE  V    EE  +    PAK   NRCS 
Sbjct  50   SKSKASIETSVVP--PSAEAKKAEEKPLGGNGEAKVGSFAEEGASSGESPAKETPNRCSF  107

Query  421  CRRKVGLTGFRCRCGELFC  477
            C ++VGL GF+CRCGELFC
Sbjct  108  CNKRVGLMGFKCRCGELFC  126



>dbj|BAJ88745.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=163

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 64/138 (46%), Gaps = 13/138 (9%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  K+E   ++    ITLC N+CG  GNPA  N+CQ CF             +    
Sbjct  1    MAQRDHKQEEPTELRAPEITLCANSCGFPGNPATQNLCQNCF-------------LAGPA  47

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
                  S         ++P L R     V         +       + PA+  VNRCS C
Sbjct  48   STSPSSSSSSLPGASVSTPVLDRPRPAPVDAELAHPAVDYRATATEAKPARTSVNRCSSC  107

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGFRCRCG++FC
Sbjct  108  RKRVGLTGFRCRCGDVFC  125



>emb|CBI24864.3| unnamed protein product [Vitis vinifera]
Length=241

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +1

Query  40   LVVFLVLRMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCF  189
            + +   L MAQKT KEETEFKV PET+ LCVNNCG TGNPA NNMCQKCF
Sbjct  34   IFILQTLDMAQKTEKEETEFKV-PETLALCVNNCGFTGNPATNNMCQKCF  82



>gb|EMT33843.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
11 [Aegilops tauschii]
Length=172

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 72/140 (51%), Gaps = 8/140 (6%)
 Frame = +1

Query  64   MAQKTGK--EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH  237
            MAQ+  K  E TE  +    ITLC N+CG  GNPA  N+CQ CF A++++   S+A+   
Sbjct  1    MAQRDKKVEEPTEVHLHAAEITLCANSCGFPGNPATKNLCQNCFLASSSSPSPSAASPPS  60

Query  238  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  417
                      F +L P   +  L +     +A         + +       +K  VNRC 
Sbjct  61   PSSSPAAFPLFDKLRPAAVASPLLQAAPVYMAVDRPAAGPADPKA------SKSSVNRCH  114

Query  418  GCRRKVGLTGFRCRCGELFC  477
             CR++VGLTGFRCRCGE+FC
Sbjct  115  NCRKRVGLTGFRCRCGEMFC  134



>ref|XP_003557532.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
 ref|XP_003557533.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
 ref|XP_010228317.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
Length=160

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 64/138 (46%), Gaps = 16/138 (12%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ++ KE  E    PE   LCVNNCG  GN   NNMC KC+         +   +  K 
Sbjct  1    MAQESWKESEETVQTPEAPVLCVNNCGFFGNSMTNNMCSKCYRDFIKVTTMAVPVVEKK-  59

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
                    F   S     P    +ED   A     V + +  +E   PP+    NRC  C
Sbjct  60   -------AFAAASSSMV-PLEPAKEDEVPAAA---VVDSQAAQEPPKPPS----NRCLSC  104

Query  424  RRKVGLTGFRCRCGELFC  477
            R+KVGLTGF+CRCG  FC
Sbjct  105  RKKVGLTGFQCRCGGTFC  122



>ref|XP_010228315.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X1 [Brachypodium distachyon]
 ref|XP_010228316.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X1 [Brachypodium distachyon]
Length=205

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 64/141 (45%), Gaps = 16/141 (11%)
 Frame = +1

Query  55   VLRMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIH  234
            ++ MAQ++ KE  E    PE   LCVNNCG  GN   NNMC KC+         +   + 
Sbjct  43   LVAMAQESWKESEETVQTPEAPVLCVNNCGFFGNSMTNNMCSKCYRDFIKVTTMAVPVVE  102

Query  235  HKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  414
             K         F   S     P    +ED   A          + +  + PP K   NRC
Sbjct  103  KK--------AFAAASSSMV-PLEPAKEDEVPAAA------VVDSQAAQEPP-KPPSNRC  146

Query  415  SGCRRKVGLTGFRCRCGELFC  477
              CR+KVGLTGF+CRCG  FC
Sbjct  147  LSCRKKVGLTGFQCRCGGTFC  167



>gb|AGQ04316.1| SAP1, partial [Oryza glumipatula]
Length=147

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 60/120 (50%), Gaps = 12/120 (10%)
 Frame = +1

Query  118  ITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTS  297
            ITLC N+CG  GNPA  N+CQ CF A TA+  S S+       ++ PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVLDKQPPRPAAPLVEPQAPL  61

Query  298  PDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            P         +A     V +               VNRCS CR++VGLTGFRCRCG LFC
Sbjct  62   PPPVEEMASALATAPAPVAKTS------------AVNRCSRCRKRVGLTGFRCRCGHLFC  109



>gb|AGQ04314.1| SAP1, partial [Oryza nivara]
 gb|AGQ04318.1| SAP1, partial [Oryza barthii]
 gb|AGQ04320.1| SAP1, partial [Oryza glaberrima]
 gb|AGQ04321.1| SAP1, partial [Oryza sativa Indica Group]
 gb|AGQ04322.1| SAP1, partial [Oryza sativa Japonica Group]
Length=147

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 60/120 (50%), Gaps = 12/120 (10%)
 Frame = +1

Query  118  ITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTS  297
            ITLC N+CG  GNPA  N+CQ CF A TA+  S S+       ++ PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVLDKQPPRPAAPLVEPQAPL  61

Query  298  PDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            P         +A     V +               VNRCS CR++VGLTGFRCRCG LFC
Sbjct  62   PPPVEEMASALATAPAPVAKTS------------AVNRCSRCRKRVGLTGFRCRCGHLFC  109



>ref|XP_002460447.1| hypothetical protein SORBIDRAFT_02g028240 [Sorghum bicolor]
 gb|EER96968.1| hypothetical protein SORBIDRAFT_02g028240 [Sorghum bicolor]
Length=172

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 70/141 (50%), Gaps = 10/141 (7%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  KEE      PE ITLC NNCG  GNPA  N+CQ CFSA TA+  SS ++     
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANNCGFPGNPATQNLCQSCFSAATASRSSSPSSPTSSS  59

Query  244  GEK---QPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  414
                  QPR     L        L   +   V +  + V                 VNRC
Sbjct  60   SASAVSQPRPA--ALVDAAAVELLASADAAAVGQSMEVVAAAPAATAA----RSSAVNRC  113

Query  415  SGCRRKVGLTGFRCRCGELFC  477
            S CR++VGLTGFRCRCGELFC
Sbjct  114  SSCRKRVGLTGFRCRCGELFC  134



>gb|ADF80942.1| zinc finger protein [Phyllostachys praecox]
Length=165

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 69/146 (47%), Gaps = 27/146 (18%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  KEE      PE ITLC N CG  GNPA  N+CQ CFSA +A+  S  +      
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANGCGFPGNPATQNLCQNCFSAASASTSSPPSPSSSSS  59

Query  244  GEK-------QPRSGFRRLSP-ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKR  399
                       P     R +P E  SP + R     V  G                  K 
Sbjct  60   SSSSSSLPGLSPVVDKPRPAPVELASPAVDRAPAVEVKAG------------------KT  101

Query  400  EVNRCSGCRRKVGLTGFRCRCGELFC  477
             VNRCS CR++VGLTGFRCRCGELFC
Sbjct  102  SVNRCSSCRKRVGLTGFRCRCGELFC  127



>ref|XP_010925078.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Elaeis guineensis]
Length=164

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 69/140 (49%), Gaps = 21/140 (15%)
 Frame = +1

Query  67   AQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFG  246
            +QK   EETEF+  P   TLC NNCG  G+PA NN+C KC+                 F 
Sbjct  5    SQKREAEETEFQT-PNIPTLCANNCGFFGSPATNNLCSKCY--------------KDYFL  49

Query  247  EKQPRSGFRRLSPERTSPDLKRREDRTVARGE---KTVeeeeeeeeNRSPPAKREVNRCS  417
             K   S    L P    P   ++ ++  A G+   K     EE   +   P K+  NRCS
Sbjct  50   SKSKASIETLLVP---PPVEAKKVEKKSAGGDGEAKDGSFTEEGAPSGGAPVKKPPNRCS  106

Query  418  GCRRKVGLTGFRCRCGELFC  477
             C +KVGL GF+CRCGE+FC
Sbjct  107  FCNKKVGLMGFKCRCGEVFC  126



>ref|NP_001058985.1| Os07g0168800 [Oryza sativa Japonica Group]
 sp|Q7Y1W9.1|SAP9_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 9; Short=OsSAP9 [Oryza sativa Japonica 
Group]
 gb|AAP37480.1| putative A20/AN1-type zinc finger protein ZFP177 [Oryza sativa 
Japonica Group]
 dbj|BAD31780.1| putative zinc finger protein 216 [Oryza sativa Japonica Group]
 dbj|BAF20899.1| Os07g0168800 [Oryza sativa Japonica Group]
 gb|EAZ02907.1| hypothetical protein OsI_25046 [Oryza sativa Indica Group]
 gb|EAZ38825.1| hypothetical protein OsJ_23237 [Oryza sativa Japonica Group]
 dbj|BAH00672.1| unnamed protein product [Oryza sativa Japonica Group]
Length=161

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 66/139 (47%), Gaps = 17/139 (12%)
 Frame = +1

Query  64   MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHK  240
            MAQ++ K E+E  V  PE   LCVNNCG  G+   NNMC KC+         ++  +  K
Sbjct  1    MAQESWKNESEETVHTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFVKVTTMAAPVVEKK  60

Query  241  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
                     F   S  +T  +  + ++   A  E     +E        P K   NRC  
Sbjct  61   --------AFTPASSSKTPLEPAKPDEVPAAAVEDKQAAQE--------PPKPPSNRCLS  104

Query  421  CRRKVGLTGFRCRCGELFC  477
            CR+KVGLTGF+CRCG  FC
Sbjct  105  CRKKVGLTGFQCRCGGTFC  123



>ref|XP_008808665.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
 ref|XP_008808673.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
 ref|XP_008808683.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
Length=164

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 69/139 (50%), Gaps = 19/139 (14%)
 Frame = +1

Query  67   AQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFG  246
            +QK   EETEF+  P   TLC NNCG  G+PA NN+C KC+                 F 
Sbjct  5    SQKREAEETEFQT-PNMPTLCANNCGFFGSPATNNLCSKCY--------------KDYFL  49

Query  247  EKQPRSGFRRLSPERTSPDLKRREDRTV-ARGE-KTVeeeeeeeeNRSPPAKREVNRCSG  420
             K   S    L P     + K+ E++     GE K     +E   +   P K+  NRCS 
Sbjct  50   SKSKASVETLLVPPPV--EAKKVEEKPAGGDGEAKGGSFTDEAAPSEGSPVKKPPNRCSF  107

Query  421  CRRKVGLTGFRCRCGELFC  477
            C ++VGL GF+CRCGE+FC
Sbjct  108  CNKRVGLMGFKCRCGEVFC  126



>gb|ACL01101.1| zinc finger protein [Phyllostachys edulis]
Length=164

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 69/149 (46%), Gaps = 34/149 (23%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  KEE      PE ITLC N+CG  GNPA  N+CQ CF A +A+  S  +      
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANSCGFPGNPATQNLCQNCFLAASASTSSPPSPSSSSS  59

Query  244  GE-----------KQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPP  390
                          +PR     L+    SP + R     V  G                 
Sbjct  60   SSSSSLPGLSPVVDKPRPAPMELA----SPAVDRAPAVEVKAG-----------------  98

Query  391  AKREVNRCSGCRRKVGLTGFRCRCGELFC  477
             K  VNRCS CR++VGLTGFRCRCGELFC
Sbjct  99   -KTSVNRCSSCRKRVGLTGFRCRCGELFC  126



>gb|EPS60935.1| induced stolon tip protein [Genlisea aurea]
Length=156

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 74/143 (52%), Gaps = 30/143 (21%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQKT  +E EFKV PETI+LCV+          + +C KC  +           ++H F
Sbjct  1    MAQKTKNDEPEFKVTPETISLCVD-------CVDSCLCHKCIISAATP-------VNHLF  46

Query  244  GEKQPRSGFRRLSP-----ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  408
             +++ RS     +P     E    DLK            +   E E E   + P +R VN
Sbjct  47   TDEESRSISSPPAPSSIIPETRGDDLKH-----------SGAGETEAEAAAARPLERSVN  95

Query  409  RCSGCRRKVGLTGFRCRCGELFC  477
            RCSGCR+KVGLTGFRCRCGELFC
Sbjct  96   RCSGCRKKVGLTGFRCRCGELFC  118



>ref|XP_006660763.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Oryza brachyantha]
Length=166

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 68/143 (48%), Gaps = 20/143 (14%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  KEE      PE ITLC N+CG  GNPA  N+CQ CF A +A             
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANSCGFPGNPATQNLCQNCFLAASA-------------  46

Query  244  GEKQPRSGFRRLSP-----ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  408
                  +    LSP      R +  L   +    A   + +       E ++P     VN
Sbjct  47   -STSSPASLPGLSPVLDKAARPATSLVEAQAAPAAAPVEELASPAPALEVKAPAKTSAVN  105

Query  409  RCSGCRRKVGLTGFRCRCGELFC  477
            RCS CR++VGLTGFRCRCG LFC
Sbjct  106  RCSRCRKRVGLTGFRCRCGYLFC  128



>ref|XP_008344433.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
Length=136

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 73/134 (54%), Gaps = 19/134 (14%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCF----sattaaagsssaaI  231
            M Q+  KEETEFKV+ ET+T CVNN  VTGNP+ NNMCQKCF    +A T ++ SSS  I
Sbjct  1    MTQRAEKEETEFKVL-ETLTHCVNNYDVTGNPSTNNMCQKCFNAATAAATTSSSSSSVTI  59

Query  232  HHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  411
                 EK PRS     S E  +   K+ +   +AR +++             P +  VN+
Sbjct  60   LKFSAEKSPRST-SSFSFEAPAETFKKTKASEIARSDES-------------PNRCVVNQ  105

Query  412  CSGCRRKVGLTGFR  453
            C  CRRKV    FR
Sbjct  106  CFECRRKVLAAEFR  119



>gb|ADF80943.1| zinc finger protein [Phyllostachys vivax]
Length=163

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 68/140 (49%), Gaps = 17/140 (12%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  KEE      PE ITLC N+CG  GNPA  N+CQ CF A +A+  S  +      
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANSCGFPGNPATQNLCQNCFLAASASTSSPPSPSSSSS  59

Query  244  GEKQPRSGFRRLSPERTSP-DLKRRE-DRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  417
                       +   R +P +L     DR  A   K                K  VNRCS
Sbjct  60   SSSSLPGLSPVVDKPRPAPVELASPAVDRVPAVEVKA--------------GKTSVNRCS  105

Query  418  GCRRKVGLTGFRCRCGELFC  477
             CR+++GLTGFRCRCGELFC
Sbjct  106  SCRKRLGLTGFRCRCGELFC  125



>ref|XP_010268591.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nelumbo nucifera]
Length=163

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 56/123 (46%), Gaps = 15/123 (12%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  288
            P    LC NNCG  G PA NN+C KC+                 F  KQ +     +  E
Sbjct  18   PNAPILCSNNCGFFGTPATNNLCSKCY---------------RDFFLKQSKVAAASVVAE  62

Query  289  RTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  468
            R   +    +   V  G++      EE      P K   NRCS CR++VGLTGF+CRCG+
Sbjct  63   RKVEEPIVEKAGQVGVGQEAKATLSEEGTTSGDPGKLPANRCSFCRKRVGLTGFKCRCGQ  122

Query  469  LFC  477
             FC
Sbjct  123  TFC  125



>gb|EEC76316.1| hypothetical protein OsI_13859 [Oryza sativa Indica Group]
Length=205

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 75/147 (51%), Gaps = 20/147 (14%)
 Frame = +1

Query  43   VVFLVLRMAQKTGKEETEFKVV--PETITLCVNNCGVTGNPAANNMCQKCFsattaaags  216
            V  + L MAQ++ K+E E   V  PE   LCVNNCG  G+    NMC KC+  T  A   
Sbjct  39   VQLVFLTMAQESWKKEAEETGVHTPEAPILCVNNCGFFGSRMTENMCSKCYRDTVKAKTV  98

Query  217  ssaaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAK  396
            ++        EK+P      LS      ++      +VA G++ +EE+        PP+ 
Sbjct  99   ATVV------EKKP---LASLSSTPLVAEVTDGGSGSVADGKQVMEED-----TPKPPS-  143

Query  397  REVNRCSGCRRKVGLTGFRCRCGELFC  477
               NRC  CR+KVGLTGF+CRCG  FC
Sbjct  144  ---NRCLSCRKKVGLTGFKCRCGGTFC  167



>gb|EEE60081.1| hypothetical protein OsJ_12913 [Oryza sativa Japonica Group]
Length=205

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 75/147 (51%), Gaps = 20/147 (14%)
 Frame = +1

Query  43   VVFLVLRMAQKTGKEETEFKVV--PETITLCVNNCGVTGNPAANNMCQKCFsattaaags  216
            V  + L MAQ++ K+E E   V  PE   LCVNNCG  G+    NMC KC+  T  A   
Sbjct  39   VQLVFLTMAQESWKKEAEETGVHTPEAPILCVNNCGFFGSRMTENMCSKCYRDTVKAKTV  98

Query  217  ssaaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAK  396
            ++        EK+P      LS      ++      +VA G++ +EE+        PP+ 
Sbjct  99   ATVV------EKKP---LASLSSTPLVTEVTDGGSGSVADGKQVMEED-----TPKPPS-  143

Query  397  REVNRCSGCRRKVGLTGFRCRCGELFC  477
               NRC  CR+KVGLTGF+CRCG  FC
Sbjct  144  ---NRCLSCRKKVGLTGFKCRCGGTFC  167



>gb|AAR83854.1| induced stolon tip protein [Capsicum annuum]
Length=88

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  343  KTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            K V++E+++ ++  PPAKREVNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  6    KKVKQEDDQLKDSLPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  50



>ref|XP_002993103.1| hypothetical protein SELMODRAFT_187216 [Selaginella moellendorffii]
 gb|EFJ05851.1| hypothetical protein SELMODRAFT_187216 [Selaginella moellendorffii]
Length=176

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 70/140 (50%), Gaps = 4/140 (3%)
 Frame = +1

Query  64   MAQKTGKEETEFK--VVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH  237
            MAQ++ K E E     +PE   LC NNCG  G+ A  N+C KC+   +++  + +     
Sbjct  1    MAQESWKREEEAAGCQLPEGPVLCANNCGFFGSVATMNLCSKCYREQSSSKAAETMITTT  60

Query  238  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  417
                    +       E  +     R   T+A G  T+  E++   ++  P  R  NRC 
Sbjct  61   TTTAAACATATPAAKEEALAAIATSRTSTTIATGATTLVTEDDSSASQEKP--RLPNRCL  118

Query  418  GCRRKVGLTGFRCRCGELFC  477
             CR+++GLTGF+CRCG++FC
Sbjct  119  ACRKRLGLTGFKCRCGDVFC  138



>gb|EMS47592.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
6 [Triticum urartu]
Length=267

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 67/140 (48%), Gaps = 17/140 (12%)
 Frame = +1

Query  61   RMAQKTGKEETEFKV-VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH  237
            +MAQ++ KE  +  V  PE   +C+NNCG  GN    NMC KC+  T  A   +   + +
Sbjct  106  KMAQESWKEAEDTGVHAPEAPIMCINNCGFFGNRMTENMCSKCYRDTVKAKKMALL-VEN  164

Query  238  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  417
            K       S    ++  +       +E + VA  E              PP+    NRC 
Sbjct  165  KTAAAVASSPTPMVAEIKDEASASAKEGKQVAEEEAP-----------KPPS----NRCL  209

Query  418  GCRRKVGLTGFRCRCGELFC  477
             CR+KVGLTGF+CRCG+ FC
Sbjct  210  SCRKKVGLTGFKCRCGDTFC  229



>dbj|BAK01503.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 67/139 (48%), Gaps = 17/139 (12%)
 Frame = +1

Query  64   MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHK  240
            MAQ++ KE  +  V  PE   LCVNNCG  GN    NMC KC+  T  A   ++  + +K
Sbjct  1    MAQESWKEAEDTGVHAPEAPILCVNNCGFFGNRMTENMCSKCYRDTAKAKRMATL-VENK  59

Query  241  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
                   S    ++  +       +E + VA  E              PP+    NRC  
Sbjct  60   TAAAVASSPTPLVAEMKDEASGSAKEGKQVAEEEAP-----------KPPS----NRCLS  104

Query  421  CRRKVGLTGFRCRCGELFC  477
            CR+KVGLTGF+CRCG+ FC
Sbjct  105  CRKKVGLTGFKCRCGDTFC  123



>gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii]
Length=87

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +1

Query  385  PPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            PPAKREVNRCSGCRRKVGLTGFRCRCGELFC
Sbjct  19   PPAKREVNRCSGCRRKVGLTGFRCRCGELFC  49



>gb|EMS48100.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
9 [Triticum urartu]
Length=327

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 62/138 (45%), Gaps = 17/138 (12%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ++ KE  E    PE   LCVNNCG  G+   NNMC KC+     A   ++  +    
Sbjct  169  MAQESWKESEETVQTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFIKATTMAAPVVE---  225

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
                 +      S   T    K  E   VA  +    +E         P K   NRC  C
Sbjct  226  -----KVFSVASSSSVTLEQAKADEVPAVAVADSQAAQE---------PPKPPSNRCLSC  271

Query  424  RRKVGLTGFRCRCGELFC  477
            R+KVGLTGF+CRCG  FC
Sbjct  272  RKKVGLTGFQCRCGGTFC  289



>gb|EMT17725.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
6 [Aegilops tauschii]
Length=161

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 66/139 (47%), Gaps = 17/139 (12%)
 Frame = +1

Query  64   MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHK  240
            MAQ++ KE  +  V  PE   +C+NNCG  GN    NMC KC+  T  A   +   + +K
Sbjct  1    MAQESWKEAEDTGVHAPEAPIMCINNCGFFGNRMTENMCSKCYRDTVKAKSMALL-VENK  59

Query  241  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
                   S    ++  +       +E + VA  E              PP+    NRC  
Sbjct  60   TAAAVASSPTPMVAEIKDEASASAKEGKRVAEEEAP-----------KPPS----NRCLS  104

Query  421  CRRKVGLTGFRCRCGELFC  477
            CR+KVGLTGF+CRCG+ FC
Sbjct  105  CRKKVGLTGFKCRCGDTFC  123



>gb|EMT32776.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
9 [Aegilops tauschii]
Length=394

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 62/138 (45%), Gaps = 16/138 (12%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ++ KE  E    PE   LCVNNCG  G+   NNMC KC+     A   ++  +  K 
Sbjct  235  MAQESWKESEETVQTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFIKATTMAAPVVEKKV  294

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
                  S         T    K  E   VA  +    +E         P K   NRC  C
Sbjct  295  FSVASSS-------SVTLEQAKADEVPAVAVADSQAAQE---------PPKPPSNRCLSC  338

Query  424  RRKVGLTGFRCRCGELFC  477
            R+KVGLTGF+CRCG  FC
Sbjct  339  RKKVGLTGFQCRCGGTFC  356



>ref|XP_006657485.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like isoform X1 [Oryza brachyantha]
 ref|XP_006657486.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like isoform X2 [Oryza brachyantha]
Length=160

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 63/139 (45%), Gaps = 18/139 (13%)
 Frame = +1

Query  64   MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHK  240
            MAQ++ K E+E  V  PE   LCVNNCG  G+   NNMC KC+                 
Sbjct  1    MAQESWKNESEETVHTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFIKVTTMVPVV----  56

Query  241  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
                  +  F   S  +T  +  + ++   A  E         ++    P K   NRC  
Sbjct  57   -----DKKVFTAASSSKTPLEPAKPDEVPAAAVED--------KQEAQEPPKPPSNRCLS  103

Query  421  CRRKVGLTGFRCRCGELFC  477
            CR+KVGLTGF+CRCG  FC
Sbjct  104  CRKKVGLTGFQCRCGGTFC  122



>dbj|BAJ94586.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99722.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=160

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 65/138 (47%), Gaps = 16/138 (12%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            M Q + KE  E    PE   LCVNNCG  G+   NNMC KC+     A       I    
Sbjct  1    MTQDSWKESEETVQTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFIKATT-----IAAPV  55

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
             EK       ++    +S ++   + +    G   + + +  +E   PP+    NRC  C
Sbjct  56   AEK-------KVFTVASSSNVTLEQAKADEVGAVPLVDSQAAQEPPKPPS----NRCLSC  104

Query  424  RRKVGLTGFRCRCGELFC  477
            R+KVGLTGF+CRCG  FC
Sbjct  105  RKKVGLTGFQCRCGGTFC  122



>gb|ACM68446.1| stress-associated protein 9 [Solanum lycopersicum]
Length=149

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 66/140 (47%), Gaps = 21/140 (15%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MA++ G E       PE   LC NNCG  G+P   N C KC++            ++ K 
Sbjct  1    MAEEHGFE------APEGHILCANNCGFFGSPTTQNFCSKCYNE-----------VYIKG  43

Query  244  GEKQPRSGFRRLS--PERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  417
            G+++P       S  P  ++  +   ++ T A  E  V         +  P   + NRCS
Sbjct  44   GQQKPIDSLFPPSQLPIPSTSSILVLQESTAAEEEPEVVTAAVTVAVQ--PISAQPNRCS  101

Query  418  GCRRKVGLTGFRCRCGELFC  477
             CR+KVGLTGF+CRCG  FC
Sbjct  102  ACRKKVGLTGFKCRCGTTFC  121



>ref|XP_004249448.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Solanum lycopersicum]
Length=159

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 66/140 (47%), Gaps = 21/140 (15%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MA++ G E       PE   LC NNCG  G+P   N C KC++            ++ K 
Sbjct  1    MAEEHGFE------APEGHILCANNCGFFGSPTTQNFCSKCYNE-----------VYIKG  43

Query  244  GEKQPRSGFRRLS--PERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  417
            G+++P       S  P  ++  +   ++ T A  E  V         +  P   + NRCS
Sbjct  44   GQQKPIDSLFPPSQLPIPSTSSILVLQESTAAEEEPEVVTAAVTVAVQ--PISAQPNRCS  101

Query  418  GCRRKVGLTGFRCRCGELFC  477
             CR+KVGLTGF+CRCG  FC
Sbjct  102  ACRKKVGLTGFKCRCGTTFC  121



>ref|XP_002445913.1| hypothetical protein SORBIDRAFT_07g027940 [Sorghum bicolor]
 gb|EES15408.1| hypothetical protein SORBIDRAFT_07g027940 [Sorghum bicolor]
Length=176

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 72/150 (48%), Gaps = 24/150 (16%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIH---  234
            MAQ+  K E   ++    +TLC N+CG  GNPA NN+CQ CF A TA++ S+S +     
Sbjct  1    MAQRDKKVEEPTELRAPELTLCANSCGFPGNPATNNLCQACFQAATASSASASVSPPSPS  60

Query  235  ---------HKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSP  387
                      KF E+Q         P  T+    R  ++  A                  
Sbjct  61   SSLSPSPAVFKFDEQQ------HARPSATAVFADRPAEQPPAPASARPIRTTSTS-----  109

Query  388  PAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
             +   VNRC  CR++VGLTGFRCRCGELFC
Sbjct  110  -SSSSVNRCQSCRKRVGLTGFRCRCGELFC  138



>gb|AGQ04317.1| SAP1, partial [Oryza longistaminata]
Length=147

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 61/124 (49%), Gaps = 20/124 (16%)
 Frame = +1

Query  118  ITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTS  297
            ITLC N+CG  GNPA  N+CQ CF A TA+  S S+       ++ PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVLDKQPPRPAAPLVEPQAPL  61

Query  298  P----DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCG  465
            P    ++        A   KT                  VNRCS CR++VGLTGFRCRCG
Sbjct  62   PPPVEEVSSALATAPAPAAKT----------------SAVNRCSRCRKRVGLTGFRCRCG  105

Query  466  ELFC  477
             LFC
Sbjct  106  HLFC  109



>gb|AGQ04315.1| SAP1, partial [Oryza rufipogon]
Length=149

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 58/120 (48%), Gaps = 10/120 (8%)
 Frame = +1

Query  118  ITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTS  297
            ITLC N+CG  GNPA  N+CQ CF A TA+  S S+       ++ PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVLDKQPPRPAAPLVEPQAPL  61

Query  298  PDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            P             E+                   VNRCS CR++VGLTGFRCRCG LFC
Sbjct  62   PPPV----------EEMASALATATAPAPVAKTSAVNRCSRCRKRVGLTGFRCRCGHLFC  111



>ref|XP_008344245.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
Length=125

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  KEETEFKV PET+T  VNNCGVT NP+ NN+CQKCF+  T ++  SSAAI    
Sbjct  1    MAQRAEKEETEFKV-PETLTHYVNNCGVTDNPSTNNLCQKCFNTATTSSSFSSAAIXKLS  59

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTV  351
             EK P S     S E  +   ++     +AR ++++
Sbjct  60   AEKSPIST-SSFSFEALAETFRKTTASEIARSDESL  94



>ref|XP_010257702.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nelumbo nucifera]
Length=170

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 71/143 (50%), Gaps = 16/143 (11%)
 Frame = +1

Query  64   MAQKTGKEETEFK--VVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagss-saaIH  234
            MAQ++ K+ET+      PE   LC NNCG  G+ A NN+C KC+            A+  
Sbjct  1    MAQESWKKETDETECQTPEGPILCANNCGFFGSAATNNLCSKCYRDMFMKQQQQFKASTV  60

Query  235  HKFGEK-QPRSGFRRLSPERTSPDLKRREDR-TVARGEKTVeeeeeeeeNRSPPAKREVN  408
                EK Q  S   +L P     +    E++ T+  G  T E       N+ PP     N
Sbjct  61   TPVAEKVQATSTLVQLEPVVGRVNNNNIEEKLTLQEGSSTYET------NKQPP-----N  109

Query  409  RCSGCRRKVGLTGFRCRCGELFC  477
            RC  C+++VGLTGF+CRCG +FC
Sbjct  110  RCLACQKRVGLTGFKCRCGGIFC  132



>ref|XP_011094369.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 isoform X1 [Sesamum indicum]
 ref|XP_011094370.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 isoform X2 [Sesamum indicum]
Length=160

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 64/131 (49%), Gaps = 11/131 (8%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRS  264
            EE  F+  PE   LCVNNCG  G+PA  NMC KC+   +    +  +          P S
Sbjct  3    EEHGFQA-PEGHRLCVNNCGFFGSPATQNMCSKCYRDLSIKKSADFSTP----STAPPPS  57

Query  265  GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLT  444
               +LS   +SPD       TVA     +  +++ +           NRCS CR+KVGLT
Sbjct  58   TAAQLS--LSSPDKAESSVATVAAQSPPMPVQQQAQPQPQ----PPTNRCSTCRKKVGLT  111

Query  445  GFRCRCGELFC  477
            GFRCRCG  FC
Sbjct  112  GFRCRCGITFC  122



>ref|NP_001051527.1| Os03g0792900 [Oryza sativa Japonica Group]
 sp|Q852K5.1|SAP6_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 6; Short=OsSAP6 [Oryza sativa Japonica 
Group]
 gb|AAO37974.1| putative zinc finger protein [Oryza sativa Japonica Group]
 gb|AAQ83587.1| putative zinc finger transcription factor ZFP38 [Oryza sativa 
Japonica Group]
 gb|ABF99304.1| AN1-like Zinc finger family protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF99305.1| AN1-like Zinc finger family protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF99306.1| AN1-like Zinc finger family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13441.1| Os03g0792900 [Oryza sativa Japonica Group]
 gb|AEP20529.1| zinc finger protein [Oryza sativa Japonica Group]
Length=160

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 72/140 (51%), Gaps = 20/140 (14%)
 Frame = +1

Query  64   MAQKTGKEETEFKVV--PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH  237
            MAQ++ K+E E   V  PE   LCVNNCG  G+    NMC KC+  T  A   ++     
Sbjct  1    MAQESWKKEAEETGVHTPEAPILCVNNCGFFGSRMTENMCSKCYRDTVKAKTVATVV---  57

Query  238  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  417
               EK+P      LS      ++      +VA G++ +EE+        PP+    NRC 
Sbjct  58   ---EKKP---LASLSSTPLVTEVTDGGSGSVADGKQVMEEDTP-----KPPS----NRCL  102

Query  418  GCRRKVGLTGFRCRCGELFC  477
             CR+KVGLTGF+CRCG  FC
Sbjct  103  SCRKKVGLTGFKCRCGGTFC  122



>gb|AGQ04319.1| SAP1, partial [Oryza meridionalis]
Length=146

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 60/120 (50%), Gaps = 13/120 (11%)
 Frame = +1

Query  118  ITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTS  297
            ITLC N+CG  GNPA  N+CQ CF A TA+  S S+       +K PR     + P+   
Sbjct  2    ITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVL-DKPPRPAAPLVEPQAPL  60

Query  298  PDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            P         +A     V +               VNRCS CR++VGLTGFRCRCG LFC
Sbjct  61   PPPVEEMASALAPAPAPVVKTS------------AVNRCSRCRKRVGLTGFRCRCGHLFC  108



>ref|XP_006487967.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 3-like [Citrus sinensis]
Length=156

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 58/118 (49%), Gaps = 11/118 (9%)
 Frame = +1

Query  124  LCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPD  303
            LCVNNCG  G+P   N+C KCF      A  SS+A H             +     +S D
Sbjct  12   LCVNNCGFFGSPTTQNLCSKCFRDLQLKAQQSSSAKH----------ALNQTLISSSSVD  61

Query  304  LKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            L  RE R     E   E E+   E  +P      NRC  CRR+VGLTGF+CRCG +FC
Sbjct  62   LSLRE-RPATDVEVAAEAEKPPAEVAAPVQSTAANRCMTCRRRVGLTGFKCRCGSVFC  118



>ref|NP_001140650.1| uncharacterized protein LOC100272725 [Zea mays]
 gb|ACF84270.1| unknown [Zea mays]
 tpg|DAA47934.1| TPA: multiple stress-responsive zinc-finger protein ISAP1 [Zea 
mays]
Length=176

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 69/138 (50%), Gaps = 0/138 (0%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  K E   ++    +TLC N+CG  GNPA NN+CQ CF A TA++ +S++      
Sbjct  1    MAQRDKKVEEPTELRAPELTLCANSCGFPGNPATNNLCQACFLAATASSSASASVSPPPP  60

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
                      +   ++   + + R        E+            +P +   V RC  C
Sbjct  61   SSSSSSPAVLQFDEQQQQQNPRPRAPAASGPTEEPPRPARASAPAPAPASSSSVRRCQTC  120

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGFRCRCG+LFC
Sbjct  121  RKRVGLTGFRCRCGDLFC  138



>ref|XP_004510979.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cicer arietinum]
Length=160

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 69/141 (49%), Gaps = 22/141 (16%)
 Frame = +1

Query  64   MAQK-TGKEETEFKVVPETITL--CVNNCGVTGNPAANNMCQKCFsattaaagsssaaIH  234
            MA K T KEETEFKV PETIT   C+N                  + TT +    S    
Sbjct  1    MAHKITKKEETEFKV-PETITPSPCINIQTAATTTVTAATTTVTAATTTTSISEPSRFFE  59

Query  235  HKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  414
             K      RS     SP+R+ P     +D T  + + T           S  AKR VNRC
Sbjct  60   DK---STARSATSSRSPKRSHPS----DDDTQVQPQTT-----------SSEAKRAVNRC  101

Query  415  SGCRRKVGLTGFRCRCGELFC  477
            SGCRR+VGLTGFRCRCG+LFC
Sbjct  102  SGCRRRVGLTGFRCRCGDLFC  122



>ref|XP_006339126.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Solanum tuberosum]
Length=159

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 64/141 (45%), Gaps = 23/141 (16%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MA++ G E       PE   LC NNCG  G+P   N C KC++            ++ K 
Sbjct  1    MAEEHGFE------APEGHILCANNCGFFGSPTTQNFCSKCYNE-----------VYIKG  43

Query  244  GEKQPRSGF---RRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  414
            G+++P       +   P ++S  L   E   V   E+  E           P   + NRC
Sbjct  44   GQQKPIDSLFPPQLPIPSQSSSVLVLPEPAAV---EEKPEVVIAAVTAAVQPMPAQSNRC  100

Query  415  SGCRRKVGLTGFRCRCGELFC  477
            S CR+KVGL GF+CRCG  FC
Sbjct  101  SACRKKVGLIGFKCRCGTTFC  121



>ref|XP_010031823.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 isoform X1 [Eucalyptus grandis]
Length=196

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 67/159 (42%), Gaps = 12/159 (8%)
 Frame = +1

Query  16   LSLRISDCLVVFLVLRMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsa  195
            L + I  CL  F   R+ +K   +ET  +  PE   LC+NNCG  G+PA  NMC KC   
Sbjct  7    LQMIIERCLFQFSRWRI-EKMEHDETGCQAPPEGPILCINNCGFFGSPATMNMCSKCHKD  65

Query  196  ttaaagsssaaIHHKFGEKQPRSGFRRLSP---ERTSPDLKRREDRTVARGE--KTVeee  360
                   +  A       +   S      P         L   E +T+ +     +V   
Sbjct  66   MLLKQEQAKLAASSIAAAENGSSSTTASEPVFAASVDTQLNTVEPKTIPKQPACDSVTVA  125

Query  361  eeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
              E+    P       RCS C ++VGLTGF CRCG +FC
Sbjct  126  TVEKPKEGP------TRCSSCNKRVGLTGFSCRCGNIFC  158



>ref|NP_001275387.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
8-like [Solanum tuberosum]
 gb|AFW90615.1| stress-associated protein 3 [Solanum tuberosum]
 gb|AFX66985.1| stress-associated protein 3 [Solanum tuberosum]
Length=171

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 61/137 (45%), Gaps = 13/137 (9%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH----KFGEK  252
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+         +  A+        G  
Sbjct  4    DETGCQPPPEGPILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLAVSSIENLVNGSS  63

Query  253  QPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCR  426
                G   + P    PD       T+      +   +    +  P  K +V  NRC  C+
Sbjct  64   AGEKGMVIVDPVDVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCK  116

Query  427  RKVGLTGFRCRCGELFC  477
            +KVG+TGF+CRCG L+C
Sbjct  117  KKVGITGFKCRCGNLYC  133



>ref|XP_009419155.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Musa acuminata subsp. malaccensis]
 ref|XP_009419156.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Musa acuminata subsp. malaccensis]
 ref|XP_009419157.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Musa acuminata subsp. malaccensis]
Length=175

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 56/129 (43%), Gaps = 6/129 (5%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             PE   LC+NNCG  G+ A  NMC KC          +  A           SG    S 
Sbjct  10   APEGPILCINNCGFFGSAATMNMCSKCHREMILKQEQAKLAAS-SIDNLVNGSGGDICSS  68

Query  286  ERTSPDLKRREDRTVARGEKTVeeeee-----eeeNRSPPAKREVNRCSGCRRKVGLTGF  450
                P +    D T+  GE      +         +    AK   NRCS CR++VGLTGF
Sbjct  69   NGKEPVISAVTDVTIVSGELKAIPSQSPEVLCSSGSGEAKAKNGPNRCSTCRKRVGLTGF  128

Query  451  RCRCGELFC  477
            +CRCG+LFC
Sbjct  129  QCRCGDLFC  137



>gb|KDP35279.1| hypothetical protein JCGZ_09438 [Jatropha curcas]
Length=133

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 58/119 (49%), Gaps = 35/119 (29%)
 Frame = +1

Query  124  LCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERT-SP  300
             CVNNCG  GN   NN+C KC+                KF  KQP+    +   E T +P
Sbjct  11   YCVNNCGFFGNAKTNNLCSKCYK---------------KFLLKQPQ----QTQIESTIAP  51

Query  301  DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
                     VA GE+T        ENR P A    NRCS CR++VGLTGF CRCG+ FC
Sbjct  52   ---------VAGGEQT---GANSSENRPPAA---ANRCSFCRKRVGLTGFNCRCGQTFC  95



>ref|XP_009412395.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009412396.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009412397.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009412398.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=166

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 66/139 (47%), Gaps = 21/139 (15%)
 Frame = +1

Query  70   QKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGE  249
            ++TGK + +   +P    LC NNCG  G+PA NN+C KC+                 F  
Sbjct  8    RETGKTDLQSSNIP---VLCANNCGFFGSPATNNLCSKCYKDY--------------FLS  50

Query  250  KQPRSGFRRLSP---ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
            K   S    + P   E    D K   D  +A+   +  EE    E   P  K+  NRCS 
Sbjct  51   KSKASMETLVIPPALESKRVDEKPGGDDGIAKSVNS-SEEGATSEGGGPLPKKNPNRCSF  109

Query  421  CRRKVGLTGFRCRCGELFC  477
            C ++VGL GF+CRCGE+FC
Sbjct  110  CNKRVGLMGFKCRCGEVFC  128



>ref|XP_009412393.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412394.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=191

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 65/138 (47%), Gaps = 21/138 (15%)
 Frame = +1

Query  73   KTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEK  252
            +TGK + +   +P    LC NNCG  G+PA NN+C KC+                 F  K
Sbjct  34   ETGKTDLQSSNIP---VLCANNCGFFGSPATNNLCSKCYKDY--------------FLSK  76

Query  253  QPRSGFRRLSP---ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
               S    + P   E    D K   D  +A+   +  EE    E   P  K+  NRCS C
Sbjct  77   SKASMETLVIPPALESKRVDEKPGGDDGIAKSVNS-SEEGATSEGGGPLPKKNPNRCSFC  135

Query  424  RRKVGLTGFRCRCGELFC  477
             ++VGL GF+CRCGE+FC
Sbjct  136  NKRVGLMGFKCRCGEVFC  153



>ref|NP_001106263.1| AN110 [Zea mays]
 gb|ABS83249.1| AN110 [Zea mays]
Length=174

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 68/138 (49%), Gaps = 2/138 (1%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  K E   ++    +TLC N+CG  GNPA NN+CQ CF A TA+A +S +      
Sbjct  1    MAQRDKKVEEPTELRAPELTLCANSCGFPGNPATNNLCQACFLAATASASASVSPPPPSS  60

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
                    F     ++   + + R     A G              +P +   V RC  C
Sbjct  61   SSSPAVLQFDDQQQQQQQQNPRPRA--PAASGPTEEPPRPARAPAPAPASSSSVRRCQTC  118

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGFRCRCG+LFC
Sbjct  119  RKRVGLTGFRCRCGDLFC  136



>ref|XP_006345467.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum tuberosum]
Length=167

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 57/135 (42%), Gaps = 26/135 (19%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             P+   LCVNNCG  G  A  NMC KC+                    KQ ++ F   S 
Sbjct  10   APQAPVLCVNNCGFFGTAATMNMCSKCYKDMIF---------------KQEQANFAASSI  54

Query  286  ER----TSPDLKRREDRTVARGEKTVeeeeeeeeNRSP-------PAKREVNRCSGCRRK  432
            E     +S    +  D  V   E   E      +  +P        AK   NRCS CRR+
Sbjct  55   ESFVNGSSSASVKAVDVAVTVQEGPAESLVIPTQVAAPVESVQVEKAKEGPNRCSTCRRR  114

Query  433  VGLTGFRCRCGELFC  477
            VGLTGF CRCG LFC
Sbjct  115  VGLTGFNCRCGNLFC  129



>ref|XP_006361216.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Solanum tuberosum]
Length=171

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 61/137 (45%), Gaps = 13/137 (9%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH----KFGEK  252
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+         +  A+        G  
Sbjct  4    DETGCQPPPEGPILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLAVSSIENLVNGSS  63

Query  253  QPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCR  426
                G   + P    PD       T+      +   +    +  P  K +V  NRC  C+
Sbjct  64   AGEKGMVIVDPVDVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCK  116

Query  427  RKVGLTGFRCRCGELFC  477
            +KVG+TGF+CRCG ++C
Sbjct  117  KKVGITGFKCRCGNIYC  133



>ref|XP_010531421.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Tarenaya hassleriana]
Length=161

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 60/137 (44%), Gaps = 18/137 (13%)
 Frame = +1

Query  67   AQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFG  246
            +QK   EET  +     I LC NNCG  G P  NN+C KC+         +        G
Sbjct  5    SQKRKLEETSHESQTAPI-LCANNCGFFGGPNTNNLCSKCYREFLLNQSKAIDDNTVVVG  63

Query  247  EKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCR  426
            +++         PE   P L  RE   +  GE           N   P     NRCS CR
Sbjct  64   KEKGIDQTTGKKPENNEP-LGYRETGRIWEGE-----------NSEKP-----NRCSLCR  106

Query  427  RKVGLTGFRCRCGELFC  477
            ++VGLTGF+CRCG  FC
Sbjct  107  KRVGLTGFKCRCGHTFC  123



>ref|XP_010261028.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nelumbo nucifera]
Length=164

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 60/129 (47%), Gaps = 24/129 (19%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKC----FsattaaagsssaaIHHKFGEKQPRS-GF  270
             P    LC NNCG  G+PA NN+C KC    F   + A  + +     K GE    + G 
Sbjct  17   TPNVPILCANNCGFFGSPATNNLCSKCYRDFFLKQSKAVAALTVVAEKKVGESIVETKGQ  76

Query  271  RRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGF  450
              + PE  +  +   E+ T +                  P K   NRCS C+++VGLTGF
Sbjct  77   SGVGPEAKATLV---EEGTTS----------------GDPGKLPANRCSFCKKRVGLTGF  117

Query  451  RCRCGELFC  477
            +CRCG+ FC
Sbjct  118  KCRCGQTFC  126



>gb|AGQ04323.1| SAP1, partial [Oryza punctata]
Length=146

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 55/120 (46%), Gaps = 13/120 (11%)
 Frame = +1

Query  118  ITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTS  297
            ITLC N+CG  GNPA  N+CQ CF A +A+                P        P R +
Sbjct  2    ITLCANSCGFPGNPATQNLCQSCFLAASAST---------SSLSSLPGLSPVLDKPPRPA  52

Query  298  PDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
              L   +       E+ V         ++      VNRCS CR++V LTGFRCRCG LFC
Sbjct  53   TPLVESQAPLPPPVEEMVSAPAPALAAKT----SAVNRCSRCRKRVSLTGFRCRCGHLFC  108



>ref|XP_004955567.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like isoform X1 [Setaria italica]
 ref|XP_004955568.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like isoform X2 [Setaria italica]
Length=164

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 65/140 (46%), Gaps = 16/140 (11%)
 Frame = +1

Query  64   MAQKTGKEETEFKVV--PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH  237
            MAQ++ K+E+E   V  PE   LC+NNCG  G+   NNMC KC+                
Sbjct  1    MAQESWKQESEETGVHAPEAPILCINNCGFFGSSMTNNMCSKCYRDFIKLM---------  51

Query  238  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  417
                + P    + ++   +S           A      E   E++  + PP K   NRC 
Sbjct  52   ----EAPVVEKKVITAASSSAVPLETAKHDDAHAAAVTEAVAEKQAEQEPP-KPPSNRCL  106

Query  418  GCRRKVGLTGFRCRCGELFC  477
             CR+KVGLTGF+CRCG  FC
Sbjct  107  TCRKKVGLTGFQCRCGGTFC  126



>gb|ABK21092.1| unknown [Picea sitchensis]
 gb|ABR17716.1| unknown [Picea sitchensis]
Length=181

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 62/128 (48%), Gaps = 5/128 (4%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCF---sattaaagsssaaIHHKFGEKQPRSGFRR  276
             PE  TLC NNCG  G+ A  N+C KC+       A A S+ AA+   F    P      
Sbjct  17   APEGHTLCANNCGFFGSSATRNLCSKCYRDLIMKEAQATSAMAAVEKSFAAGSPMDEVPL  76

Query  277  LSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSP-PAKREVNRCSGCRRKVGLTGFR  453
             SP+      + +    VA G  +V+  +    + SP P     NRC  CR++VGLTGF+
Sbjct  77   SSPDAIVQQNRVQISAAVA-GVSSVQLADSGSSSSSPQPPAETPNRCFSCRKRVGLTGFK  135

Query  454  CRCGELFC  477
            CRC   FC
Sbjct  136  CRCENTFC  143



>ref|XP_003557802.2| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X1 [Brachypodium distachyon]
Length=226

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 67/141 (48%), Gaps = 21/141 (15%)
 Frame = +1

Query  55   VLRMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIH  234
            + RMAQ+   EET     PE   LC+NNCG  G+    NMC KC+  T      ++ A  
Sbjct  69   LARMAQEA--EETGVHA-PEAPILCINNCGFFGSRMTENMCSKCYRDTVKVKTVAAVAEK  125

Query  235  HKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRC  414
                     S    +  E + P         V  G++ VEEE        PP+    NRC
Sbjct  126  KVAVASSSTSLVAEIEDEVSVP---------VKDGKQAVEEEAP-----KPPS----NRC  167

Query  415  SGCRRKVGLTGFRCRCGELFC  477
              CR+KVGLTGFRCRCG+ FC
Sbjct  168  LSCRKKVGLTGFRCRCGDTFC  188



>ref|XP_004228358.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum lycopersicum]
 ref|XP_004228359.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum lycopersicum]
Length=171

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 59/136 (43%), Gaps = 13/136 (10%)
 Frame = +1

Query  88   ETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH----KFGEKQ  255
            ET  +  PE   LC+NNCG  G+ A  NMC KC+         +  A+        G   
Sbjct  5    ETGCQPPPEGPILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLAVSSIENLVNGSSA  64

Query  256  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCRR  429
               G     P    PD       T+      +   +    +  P  K +V  NRC  C++
Sbjct  65   SEKGMVIAGPVDVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCKK  117

Query  430  KVGLTGFRCRCGELFC  477
            KVG+TGF+CRCG L+C
Sbjct  118  KVGITGFKCRCGNLYC  133



>ref|XP_008795703.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
 ref|XP_008795704.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
 ref|XP_008795705.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
 ref|XP_008795706.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
Length=171

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 64/129 (50%), Gaps = 10/129 (8%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKC---FsattaaagsssaaIHHKFGEKQPRSGFRR  276
             PE   LC+NNCG  G+ A  NMC KC          A  +S++I+         SG   
Sbjct  10   TPEAPILCINNCGFFGSAATMNMCSKCHKDLILKQEQAKLASSSINGIVNGSGSSSGKEP  69

Query  277  LSPERTSPDLKRREDRTVAR--GEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGF  450
            +  E  +  +   E +T++    + TV  E  E + +  P     NRCS CR++VGLTGF
Sbjct  70   IVSENANVAVGPVEPKTISAHLSDSTVISEGGETKVKVGP-----NRCSTCRKRVGLTGF  124

Query  451  RCRCGELFC  477
             CRCG LFC
Sbjct  125  NCRCGNLFC  133



>gb|ACM68454.1| stress-associated protein 4 [Solanum pennellii]
Length=161

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 57/135 (42%), Gaps = 26/135 (19%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             P+   LCVNNCG  G  A  NMC KC+                    KQ ++ F   S 
Sbjct  4    APQAPVLCVNNCGFFGTAATMNMCSKCYKDMIF---------------KQEQANFAASSI  48

Query  286  ER----TSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV-------NRCSGCRRK  432
            E     +S    +  D  V   E   E      +  +P    +V       NRCS CRR+
Sbjct  49   ESFVNGSSNASVKAVDVAVTVQEGPAESLVIPTQVAAPVESEQVEKAKEGPNRCSTCRRR  108

Query  433  VGLTGFRCRCGELFC  477
            VGLTGF CRCG LFC
Sbjct  109  VGLTGFNCRCGNLFC  123



>ref|XP_004288126.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Fragaria vesca subsp. vesca]
 ref|XP_004288127.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Fragaria vesca subsp. vesca]
Length=167

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 57/122 (47%), Gaps = 19/122 (16%)
 Frame = +1

Query  124  LCVNNCGVTGNPAANNMCQKCFs----attaaagsssaaIHHKFGEKQPRSGFRRLSPER  291
            LCVNNCG  G+   N++C KC+       +  A   +  + +K GE     G   ++   
Sbjct  23   LCVNNCGYYGSAKTNDLCSKCYKEFLLTQSKGAVEGTVIVENKVGE----GGANVVNKSH  78

Query  292  TSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGEL  471
                ++      V  G  +             P KR  NRCS CR++VGLTGF+CRCG+ 
Sbjct  79   VEQVVEEVRQSQVEEGTTS-----------ENPEKRPANRCSFCRKRVGLTGFKCRCGDT  127

Query  472  FC  477
            FC
Sbjct  128  FC  129



>ref|XP_010228642.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X3 [Brachypodium distachyon]
Length=155

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 65/138 (47%), Gaps = 21/138 (15%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+   EET     PE   LC+NNCG  G+    NMC KC+  T      ++ A     
Sbjct  1    MAQEA--EETGVHA-PEAPILCINNCGFFGSRMTENMCSKCYRDTVKVKTVAAVAEKKVA  57

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
                  S    +  E + P         V  G++ VEEE        PP+    NRC  C
Sbjct  58   VASSSTSLVAEIEDEVSVP---------VKDGKQAVEEEAP-----KPPS----NRCLSC  99

Query  424  RRKVGLTGFRCRCGELFC  477
            R+KVGLTGFRCRCG+ FC
Sbjct  100  RKKVGLTGFRCRCGDTFC  117



>ref|XP_010555326.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Tarenaya hassleriana]
 ref|XP_010555327.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Tarenaya hassleriana]
Length=162

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 67/139 (48%), Gaps = 21/139 (15%)
 Frame = +1

Query  67   AQKTGKEET--EFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHK  240
            +QK   EET  E +  P   T+C NNCG  G P  +N+C KC+         + A     
Sbjct  5    SQKRKLEETSHEPQAAP---TICANNCGFFGCPNTSNLCSKCYRDFLLKQSKTIAKNTVA  61

Query  241  FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
             G+++   G  + + +   P+    +   +  GE +V           PP   + NRCS 
Sbjct  62   VGKEK---GIEQTTEK---PENNESQPGKIWDGENSVR----------PPPPLKSNRCSS  105

Query  421  CRRKVGLTGFRCRCGELFC  477
            CR++VGLTGF+CRCG  FC
Sbjct  106  CRKRVGLTGFKCRCGHTFC  124



>ref|XP_009802017.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger A20 and AN1 domain-containing 
stress-associated protein 4 [Nicotiana sylvestris]
Length=152

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 59/138 (43%), Gaps = 24/138 (17%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MA++ G E  E  +      LC NNCG  G+    N C KC+     A  S    I   F
Sbjct  1    MAEEHGFEAQEGHI------LCANNCGFFGSSTTQNFCSKCYHEIXLAQQSQQKPIDSLF  54

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
              + P       S     P+L + E +  A  E  V                + NRCS C
Sbjct  55   PLQPPVPAAS--SSVVVLPELLKVEKKPAAVVEPVV----------------QPNRCSVC  96

Query  424  RRKVGLTGFRCRCGELFC  477
            R+KVGLTGF+CRCG  FC
Sbjct  97   RKKVGLTGFKCRCGTTFC  114



>ref|XP_007206025.1| hypothetical protein PRUPE_ppa012468mg [Prunus persica]
 gb|EMJ07224.1| hypothetical protein PRUPE_ppa012468mg [Prunus persica]
Length=168

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 61/118 (52%), Gaps = 11/118 (9%)
 Frame = +1

Query  124  LCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPD  303
            +CVNNCG  G+   NN+C KC+         ++A      G+K        +S      +
Sbjct  23   MCVNNCGFFGSEKTNNLCSKCYKDFLLKQSKTAADDTAVVGKK--------VSAGDQDLE  74

Query  304  LKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
             KR   + +   +++  EE    EN   P KR  NRC+ CR++VGLTGF+CRCG+ FC
Sbjct  75   NKRHVQQVLEEVKQSQVEEGTTSEN---PEKRPANRCNFCRKRVGLTGFKCRCGQTFC  129



>ref|XP_010228638.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like isoform X2 [Brachypodium distachyon]
Length=163

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 65/138 (47%), Gaps = 21/138 (15%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+   EET     PE   LC+NNCG  G+    NMC KC+  T      ++ A     
Sbjct  9    MAQEA--EETGVHA-PEAPILCINNCGFFGSRMTENMCSKCYRDTVKVKTVAAVAEKKVA  65

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
                  S    +  E + P         V  G++ VEEE        PP+    NRC  C
Sbjct  66   VASSSTSLVAEIEDEVSVP---------VKDGKQAVEEEAP-----KPPS----NRCLSC  107

Query  424  RRKVGLTGFRCRCGELFC  477
            R+KVGLTGFRCRCG+ FC
Sbjct  108  RKKVGLTGFRCRCGDTFC  125



>emb|CDP10084.1| unnamed protein product [Coffea canephora]
Length=263

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 59/139 (42%), Gaps = 30/139 (22%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             PE   LC+NNCG  G+ A  NMC KC               H +   KQ ++     S 
Sbjct  102  APEGPILCINNCGFFGSAATMNMCSKC---------------HKEMILKQEQAKLAASSI  146

Query  286  ER-TSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--------------NRCSG  420
            E   +     +E   V  G   V+    + E  S  A  E+              NRCS 
Sbjct  147  ENIVNGSSSSKEKEPVVTGALAVQAVSADFEVVSTKASPEILVGQGSEAKVKEGPNRCST  206

Query  421  CRRKVGLTGFRCRCGELFC  477
            CR++VGLTGF CRCG LFC
Sbjct  207  CRKRVGLTGFNCRCGNLFC  225



>ref|XP_006446073.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 ref|XP_006446074.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 ref|XP_006446075.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 ref|XP_006446076.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 ref|XP_006467189.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Citrus sinensis]
 gb|ESR59313.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 gb|ESR59314.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 gb|ESR59315.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 gb|ESR59316.1| hypothetical protein CICLE_v10016944mg [Citrus clementina]
 gb|KDO64801.1| hypothetical protein CISIN_1g030300mg [Citrus sinensis]
 gb|KDO64802.1| hypothetical protein CISIN_1g030300mg [Citrus sinensis]
 gb|KDO64803.1| hypothetical protein CISIN_1g030300mg [Citrus sinensis]
Length=172

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 67/136 (49%), Gaps = 10/136 (7%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsa---ttaaagsssaaIHHKFGEKQ  255
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+         A  ++++I     E  
Sbjct  4    DETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETS  63

Query  256  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCRR  429
              +G   ++           E + +     +V+     E + S  AK +   +RCS C++
Sbjct  64   SSNGSESVAAATVDVQASSVEPKII-----SVQPSCASELSESVEAKPKEGPSRCSSCKK  118

Query  430  KVGLTGFRCRCGELFC  477
            +VGLTGF+CRCG L+C
Sbjct  119  RVGLTGFKCRCGNLYC  134



>gb|ACM68441.1| stress-associated protein 4 [Solanum lycopersicum]
Length=161

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 56/135 (41%), Gaps = 26/135 (19%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             P+   LCVNNCG  G  A  NMC KC+                    KQ ++ F   S 
Sbjct  4    APQAPVLCVNNCGFFGTAATMNMCSKCYKDMIF---------------KQEQANFAASSI  48

Query  286  ER----TSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV-------NRCSGCRRK  432
            E     +S    +  D  V   E   E      +   P    +V       NRCS CRR+
Sbjct  49   ESFVNGSSNASVKAVDVAVTVQEGPAESLVIPTQVAVPVESEQVEKAKEGPNRCSTCRRR  108

Query  433  VGLTGFRCRCGELFC  477
            VGLTGF CRCG LFC
Sbjct  109  VGLTGFNCRCGNLFC  123



>gb|KDO64800.1| hypothetical protein CISIN_1g030300mg [Citrus sinensis]
Length=179

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 67/136 (49%), Gaps = 10/136 (7%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsa---ttaaagsssaaIHHKFGEKQ  255
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+         A  ++++I     E  
Sbjct  11   DETGCQAPPEGPILCINNCGFFGSVATMNMCSKCYKDIMLKQDQAKLAASSIGSIVNETS  70

Query  256  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCRR  429
              +G   ++           E + +     +V+     E + S  AK +   +RCS C++
Sbjct  71   SSNGSESVAAATVDVQASSVEPKII-----SVQPSCASELSESVEAKPKEGPSRCSSCKK  125

Query  430  KVGLTGFRCRCGELFC  477
            +VGLTGF+CRCG L+C
Sbjct  126  RVGLTGFKCRCGNLYC  141



>ref|XP_007133828.1| hypothetical protein PHAVU_011G212300g [Phaseolus vulgaris]
 gb|AAA33773.1| PVPR3 [Phaseolus vulgaris]
 gb|ESW05822.1| hypothetical protein PHAVU_011G212300g [Phaseolus vulgaris]
Length=137

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 62/139 (45%), Gaps = 41/139 (29%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQK  K +T+FKV PE IT C           +                         F
Sbjct  1    MAQKAQKNDTDFKV-PEPITPCATATAAAATSISEP--------------------SRFF  39

Query  244  GEKQPRSGFRRLSPERTSP-DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
                P +  R  SP+R+ P +     DRTVA                S P KR VNRCSG
Sbjct  40   DAATPATSSR--SPKRSLPLEDAANADRTVA----------------SEP-KRAVNRCSG  80

Query  421  CRRKVGLTGFRCRCGELFC  477
            CRR+VGLTGFRCRCG+LFC
Sbjct  81   CRRRVGLTGFRCRCGDLFC  99



>ref|XP_004229614.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Solanum lycopersicum]
Length=167

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 56/135 (41%), Gaps = 26/135 (19%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             P+   LCVNNCG  G  A  NMC KC+                    KQ ++ F   S 
Sbjct  10   APQAPVLCVNNCGFFGTAATMNMCSKCYKDMIF---------------KQEQANFAASSI  54

Query  286  ER----TSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV-------NRCSGCRRK  432
            E     +S    +  D  V   E   E      +   P    +V       NRCS CRR+
Sbjct  55   ESFVNGSSNASVKAVDVAVTVQEGPAESLVIPTQVAVPVESEQVEKAKEGPNRCSTCRRR  114

Query  433  VGLTGFRCRCGELFC  477
            VGLTGF CRCG LFC
Sbjct  115  VGLTGFNCRCGNLFC  129



>gb|ACM68459.1| stress-associated protein 9 [Solanum pennellii]
Length=156

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 66/139 (47%), Gaps = 20/139 (14%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MA++ G E       PE   LC NNCG  G+P   N C KC++            ++ K 
Sbjct  1    MAEEHGFE------APEGHILCANNCGFFGSPTTQNFCSKCYNE-----------VYIKG  43

Query  244  GEKQP-RSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
            G ++P  S F    P  ++  +   ++   A  E  V         +  PA  + NRCS 
Sbjct  44   GLQKPIDSLFPPQLPIPSTSSILVLQESAAAEEEPEVVTAAVAVAVQPIPA--QPNRCSA  101

Query  421  CRRKVGLTGFRCRCGELFC  477
            CR+KVGLTGF+CRCG  FC
Sbjct  102  CRKKVGLTGFKCRCGTTFC  120



>gb|AGQ04324.1| SAP1, partial [Oryza officinalis]
Length=145

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 59/120 (49%), Gaps = 14/120 (12%)
 Frame = +1

Query  118  ITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTS  297
            ITLC N+CG  GNPA  N+CQ CF A +A+  S S+         +P        P   +
Sbjct  2    ITLCANSCGFPGNPATQNLCQSCFLAASASTSSPSSLAGLSPVLDKP--------PRPAT  53

Query  298  PDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            P ++ +        E          +  +      VNRCS CR++VGLTGFRCRCG LFC
Sbjct  54   PLVEAKAPLPPPAEEMASAPAPAPAKTSA------VNRCSRCRKRVGLTGFRCRCGHLFC  107



>ref|XP_009770817.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=151

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 71/140 (51%), Gaps = 29/140 (21%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQK  KEETE KV P++I L   N  V+  P A+N  QK  S +T++  +   +  +  
Sbjct  1    MAQKREKEETELKV-PQSIPL--PNLPVSSQPHADN--QKPASPSTSSVRAPEISDLNFS  55

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG-  420
            G    RS     SPE++  +  RR    V R                    RE NRCSG 
Sbjct  56   GTDDSRSSSGARSPEKSDLEEIRR---LVKR-------------------PREANRCSGI  93

Query  421  -CRRKVGLTGFRCRCGELFC  477
             CRRKVGL GFRCRCGE+FC
Sbjct  94   GCRRKVGLIGFRCRCGEVFC  113



>ref|XP_004951572.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X1 [Setaria italica]
 ref|XP_004951573.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Setaria italica]
Length=171

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 55/123 (45%), Gaps = 0/123 (0%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  288
            PE   LC+NNCG  G+ A  NMC KC          +  A            G +  +  
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKCHKEMIMKQEQAQLAASSIDSIVNGGDGVKGPAIA  70

Query  289  RTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  468
             T+  +  + +      +  V  E  E     P AK   NRC+ CR++VGLTGF CRCG 
Sbjct  71   ATAEVVFAQVEEKAIFVQPPVVAETSEAAAVIPKAKEGPNRCATCRKRVGLTGFNCRCGN  130

Query  469  LFC  477
            ++C
Sbjct  131  MYC  133



>ref|XP_002513177.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF49168.1| zinc finger protein, putative [Ricinus communis]
Length=140

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +1

Query  391  AKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            AKR+VNRCSGCRRKVGLTGFRCRCG+LFC
Sbjct  74   AKRDVNRCSGCRRKVGLTGFRCRCGDLFC  102



>ref|XP_002285530.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Vitis vinifera]
 ref|XP_002285528.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Vitis vinifera]
Length=172

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 61/134 (46%), Gaps = 6/134 (4%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKC---FsattaaagsssaaIHHKFGEKQ  255
            +ET  +  PE   LC+NNCG  G+PA  NMC KC          A  ++++I        
Sbjct  4    DETGCQAHPEGPILCINNCGFFGSPATMNMCSKCHKDMMLKQEQAKLAASSIDSIVNGSS  63

Query  256  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  435
              +G            +  +E + ++         E   E +    K   NRCS C+++V
Sbjct  64   SNNGKEPAIASTVDVQVDAKEPKIISVQSSFSFGSEGSGEAKP---KEGPNRCSTCKKRV  120

Query  436  GLTGFRCRCGELFC  477
            GLTGF CRCG LFC
Sbjct  121  GLTGFNCRCGHLFC  134



>ref|XP_008786424.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
Length=171

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 58/139 (42%), Gaps = 30/139 (22%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             PE   LCVNNCG  G+PA  NMC KC               H     KQ ++     S 
Sbjct  10   TPEAPILCVNNCGFFGSPATMNMCSKC---------------HKDLLLKQEQAKLVASSV  54

Query  286  ERT----------SPDLKRREDRTVARGE-KTVeeeeeeeeNRSPPAKREV----NRCSG  420
            + T           P +    D  V   E KT           S   + +V    NRC+ 
Sbjct  55   DSTVSGSGSSSGKEPVVSWSVDFAVGPTEPKTTLAYPSNASAISKGGETKVKDGPNRCNT  114

Query  421  CRRKVGLTGFRCRCGELFC  477
            CR++VGLTGF CRCG LFC
Sbjct  115  CRKRVGLTGFTCRCGNLFC  133



>gb|ABK24386.1| unknown [Picea sitchensis]
 gb|ACN40611.1| unknown [Picea sitchensis]
Length=162

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 65/140 (46%), Gaps = 18/140 (13%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVP--ETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH  237
            MAQ   K ++E       E   LC N+CG  G+ +  N C KCF         S+A +  
Sbjct  1    MAQDNWKGDSEGTGYQPQEDPILCANSCGFFGSSSTMNFCSKCFKDLVLKQALSAAVVEI  60

Query  238  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  417
              G     S      P + +  L R    T+ +GE T        E   PPA    NRC+
Sbjct  61   SSG-----SALGLQQPVQIADQLARPA--TLEQGEGT-----SSGEQPKPPA----NRCT  104

Query  418  GCRRKVGLTGFRCRCGELFC  477
             C+++VGLTGF+CRCG+ FC
Sbjct  105  YCKKRVGLTGFKCRCGDTFC  124



>gb|EYU18025.1| hypothetical protein MIMGU_mgv1a014524mg [Erythranthe guttata]
 gb|EYU18026.1| hypothetical protein MIMGU_mgv1a014524mg [Erythranthe guttata]
Length=186

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 59/145 (41%), Gaps = 14/145 (10%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH---------  237
            EET  +  PE   LC NNCG  G+ A  NMC KC+         +  A            
Sbjct  4    EETGCQTAPEGPILCANNCGFFGSAANMNMCSKCYKDQVLKQEQAKVAASSIENIVNGSS  63

Query  238  --KFGEKQPRSGFRRLSP---ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKRE  402
                      +G  + S    E  +  +   E +T+      V           P AK  
Sbjct  64   SSSSSSSSTSTGVEKESAVIAESGNVKIDLVEVKTITAPSLNVSSTPAVVAAVEPKAKEG  123

Query  403  VNRCSGCRRKVGLTGFRCRCGELFC  477
              RCS C+++VGLTGF+CRCG ++C
Sbjct  124  PARCSSCKKRVGLTGFKCRCGNMYC  148



>ref|XP_010928496.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Elaeis guineensis]
 ref|XP_010928497.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Elaeis guineensis]
Length=171

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 62/129 (48%), Gaps = 10/129 (8%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKC---FsattaaagsssaaIHHKFGEKQPRSGFRR  276
             PE   LC+NNCG  G+ A  NMC KC          A  +S++I+         SG   
Sbjct  10   TPEAPILCINNCGFFGSAATMNMCSKCHQDLILKQEQAKLASSSINDIVNGSGSSSGEEP  69

Query  277  LSPERTSPDLKRREDRTVAR--GEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGF  450
            +        +   E +T++    + TV  E  E + +  P     NRCS CR++VGLTGF
Sbjct  70   IVSGNADVAVGPVEPKTISAHLSDSTVISEGGETKVKVGP-----NRCSTCRKRVGLTGF  124

Query  451  RCRCGELFC  477
             CRCG LFC
Sbjct  125  NCRCGNLFC  133



>ref|XP_010907320.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Elaeis guineensis]
Length=169

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 65/142 (46%), Gaps = 15/142 (11%)
 Frame = +1

Query  64   MAQKTGKEETEFKVV--PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH  237
            MAQ + K+ETE      P++ TLC NNCG  G+   NN+C KC+             +  
Sbjct  1    MAQDSWKQETEETECQRPKSPTLCANNCGYFGSAMTNNLCSKCYRDFI---------MKQ  51

Query  238  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPA--KREVNR  411
            +     P  G  + +   T+    +RE                   ++S  A  K+  NR
Sbjct  52   QSVATPPVIGVEKAAS--TACSSVQREPAIEKSDTLDGGNLMNVGNDQSEDACDKQPTNR  109

Query  412  CSGCRRKVGLTGFRCRCGELFC  477
            C  CR+KVGLTGF+CRCG  FC
Sbjct  110  CLRCRKKVGLTGFKCRCGGTFC  131



>gb|EYU46282.1| hypothetical protein MIMGU_mgv1a014897mg [Erythranthe guttata]
 gb|EYU46283.1| hypothetical protein MIMGU_mgv1a014897mg [Erythranthe guttata]
Length=174

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 61/148 (41%), Gaps = 32/148 (22%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRS  264
            +ET  +  PE   LCVNNCG  G+ A  NMC KC+                    KQ ++
Sbjct  4    DETGCQASPEGPLLCVNNCGFFGSAANMNMCSKCYKDLIL---------------KQEQA  48

Query  265  GFRRLSPER----TSPDLKRREDRTV-------------ARGEKTVeeeeeeeeNRSPPA  393
             F   S E     +S      +D  +             A+             +  P A
Sbjct  49   KFAASSIENIVNGSSSGTPTEQDSVIVAESANIPTPSVEAKSISLPSVINASTSDEPPRA  108

Query  394  KREVNRCSGCRRKVGLTGFRCRCGELFC  477
            K   ++CS C+++VGLTGF+CRCG  FC
Sbjct  109  KEGPSKCSSCKKRVGLTGFKCRCGSTFC  136



>gb|ACM68453.1| stress-associated protein 3 [Solanum pennellii]
Length=171

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 58/136 (43%), Gaps = 13/136 (10%)
 Frame = +1

Query  88   ETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH----KFGEKQ  255
            ET  + + E   LC+NNCG  G+ A  NMC KC+         +   +        G   
Sbjct  5    ETGCQPLREGPILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLDVSSIENLVNGSSA  64

Query  256  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCRR  429
               G     P    PD       T+      +   +    +  P  K +V  NRC  C++
Sbjct  65   SEKGMVIAGPVDVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCKK  117

Query  430  KVGLTGFRCRCGELFC  477
            KVG+TGF+CRCG L+C
Sbjct  118  KVGITGFKCRCGNLYC  133



>ref|XP_002279037.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 [Vitis vinifera]
 emb|CAN73104.1| hypothetical protein VITISV_042893 [Vitis vinifera]
Length=141

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 63/138 (46%), Gaps = 35/138 (25%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            M QK+ + E    +      LC NNCG  G+ A NN+C KC+                +F
Sbjct  1    MEQKSQENEVNAAI------LCANNCGFFGSAATNNLCSKCYK---------------EF  39

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
              KQ +              +   E+ TV  GE +    EE     SP  K   NRCS C
Sbjct  40   VIKQSKE-----------ASVVENENNTV--GENSGSGIEEGAAAGSPE-KCPANRCSFC  85

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGF+CRCG+ FC
Sbjct  86   RKRVGLTGFKCRCGQTFC  103



>ref|XP_003542858.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Glycine max]
Length=137

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 64/139 (46%), Gaps = 41/139 (29%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQK  K +TEFK VPE I   +N C  T     +      F                 F
Sbjct  1    MAQKAQKNDTEFK-VPEPI---INPCTTTTTTTTSISEPSRF-----------------F  39

Query  244  GEKQPRSGFRRLSPERTSP-DLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
                P +  R  SP+R+ P D + + D+T                  S   KR VNRCSG
Sbjct  40   DATTPATSSR--SPKRSLPLDEESQTDQTT-----------------SSEPKRAVNRCSG  80

Query  421  CRRKVGLTGFRCRCGELFC  477
            CRR+VGLTGFRCRCG+LFC
Sbjct  81   CRRRVGLTGFRCRCGDLFC  99



>ref|XP_006424263.1| hypothetical protein CICLE_v10029439mg [Citrus clementina]
 gb|ESR37503.1| hypothetical protein CICLE_v10029439mg [Citrus clementina]
Length=162

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 57/118 (48%), Gaps = 5/118 (4%)
 Frame = +1

Query  124  LCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPD  303
            LCVNNCG  G+P   N+C KCF      A  SS+A H               S    S D
Sbjct  12   LCVNNCGFFGSPTTQNLCSKCFRDLQLKAQQSSSAKH----ALNQTLISSSSSSPSPSVD  67

Query  304  LKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            L  RE R     E   E E+   E  +P      NRC  CRR+VGLTGF+CRCG +FC
Sbjct  68   LSLRE-RPATDVEVAAEAEKPPAEVAAPVQSTAANRCITCRRRVGLTGFKCRCGSVFC  124



>ref|XP_006410805.1| hypothetical protein EUTSA_v10017322mg [Eutrema salsugineum]
 gb|ESQ52258.1| hypothetical protein EUTSA_v10017322mg [Eutrema salsugineum]
Length=169

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 55/127 (43%), Gaps = 7/127 (6%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsa---ttaaagsssaaIHHKFGEKQPRSGFRR  276
             PE   LCVNNCG  G+ A  N+C  C+           S  + +        P S    
Sbjct  9    APEGHRLCVNNCGFFGSSATMNLCSNCYGDLCLEKQQQASMKSTVESSLSVASPPSPEIE  68

Query  277  LSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRC  456
              P   SP L    D   A  +    E+   +     P ++  NRC+ CR++VGLTGF C
Sbjct  69   SIPATISPVL----DNYAAELQILATEKPIPQIPTEQPQQQRPNRCTVCRKRVGLTGFMC  124

Query  457  RCGELFC  477
            RCG  FC
Sbjct  125  RCGTTFC  131



>ref|XP_009601977.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 [Nicotiana tomentosiformis]
Length=152

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 58/138 (42%), Gaps = 24/138 (17%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MA++ G E  E  +      LC NNCG  G+    N C KC+     A  S    I   F
Sbjct  1    MAEEHGFEAQEGHI------LCANNCGFFGSSTTQNFCSKCYHEIYLAQQSQQKPIDSLF  54

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
              + P       S     P+  + E +  A  E  V                + NRCS C
Sbjct  55   PLQPPVPAAS--SSVVVLPEPLKLEKKPAAVVEPVV----------------QPNRCSVC  96

Query  424  RRKVGLTGFRCRCGELFC  477
            R+KVGLTGF+CRCG  FC
Sbjct  97   RKKVGLTGFKCRCGTTFC  114



>gb|AEZ53300.1| zinc finger protein [Festuca arundinacea]
Length=167

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 54/124 (44%), Gaps = 16/124 (13%)
 Frame = +1

Query  124  LCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRL--SPERTS  297
            LCVNNCG  G+ A  NMC KC    T     +          K   S F  +    + T 
Sbjct  16   LCVNNCGFFGSAATMNMCSKCHKEMTLKEEQA----------KLAASSFDSIVNGADATK  65

Query  298  PDLKRREDRTVARGE----KTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCG  465
              L       VA        TV  +       S PA +  +RCS CR++VGLTGF CRCG
Sbjct  66   EHLVAGNTAAVAVAHVELKTTVIAQPAVVAGPSEPAPKGPSRCSTCRKRVGLTGFNCRCG  125

Query  466  ELFC  477
             L+C
Sbjct  126  NLYC  129



>gb|ACJ86086.1| unknown [Medicago truncatula]
Length=164

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 61/134 (46%), Gaps = 6/134 (4%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKC---FsattaaagsssaaIHHKFGEKQ  255
            ++T  +  PE   LC+NNCG  G+ A  NMC KC          A  ++++I +      
Sbjct  4    DQTGCEAAPEGPMLCINNCGFFGSAATMNMCSKCHKDMMLKQEQATLAASSIGNIMNGSS  63

Query  256  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  435
              SG            +   E + ++  E  V    EE   + P  K    RCS C ++V
Sbjct  64   SSSGIEPAITANVEISVDPVEPKIIS-AEPLVASGSEESLEKKP--KDGPKRCSNCNKRV  120

Query  436  GLTGFRCRCGELFC  477
            GLTGF CRCG L+C
Sbjct  121  GLTGFNCRCGNLYC  134



>ref|XP_008461274.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Cucumis melo]
Length=172

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 59/134 (44%), Gaps = 6/134 (4%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKC---FsattaaagsssaaIHHKFGEKQ  255
            +ET  +  PE   LC NNCG  G+ A  NMC KC   F      A  ++++  +      
Sbjct  4    KETGCQAPPEAPKLCANNCGFFGSAATMNMCSKCHKDFIMKQEQAKLAASSFGNIVNCGP  63

Query  256  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  435
               G + +    T  +++  E   +                +    K   NRCS CR++V
Sbjct  64   NDHGKKAVVTSPTKLEIEPAESSIIPTQATCTSSNASSTVEK---VKESPNRCSSCRKRV  120

Query  436  GLTGFRCRCGELFC  477
            GLTGF CRCG LFC
Sbjct  121  GLTGFNCRCGSLFC  134



>ref|XP_007145644.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris]
 ref|XP_007145645.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris]
 gb|ESW17638.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris]
 gb|ESW17639.1| hypothetical protein PHAVU_007G256400g [Phaseolus vulgaris]
Length=172

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 61/127 (48%), Gaps = 6/127 (5%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsat---taaagsssaaIHHKFGEKQPRSGFRR  276
             PE   LC NNCG  G  A  NMC KC+  T         ++A++ +        SG + 
Sbjct  11   APERPILCTNNCGFFGRAATMNMCSKCYKDTLLKQEQDKLAAASVENIVNGGSGCSGKQA  70

Query  277  LSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRC  456
            ++       +   E +TV+     +  +    +N    AK   +RC+ CR++VGLTGF C
Sbjct  71   VTAGSVDVQVGNVEMKTVS---AEISGDSSSGQNLEMKAKTGPSRCATCRKRVGLTGFSC  127

Query  457  RCGELFC  477
            +CG LFC
Sbjct  128  KCGNLFC  134



>gb|ACJ83925.1| unknown [Medicago truncatula]
 gb|AFK35119.1| unknown [Medicago truncatula]
 gb|AFK43343.1| unknown [Medicago truncatula]
 gb|AES67697.2| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
Length=172

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 61/134 (46%), Gaps = 6/134 (4%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKC---FsattaaagsssaaIHHKFGEKQ  255
            ++T  +  PE   LC+NNCG  G+ A  NMC KC          A  ++++I +      
Sbjct  4    DQTGCEAAPEGPMLCINNCGFFGSAATMNMCSKCHKDMMLKQEQATLAASSIGNIMNGSS  63

Query  256  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  435
              SG            +   E + ++  E  V    EE   + P  K    RCS C ++V
Sbjct  64   SSSGIEPAITANVEISVDPVEPKIIS-AEPLVASGSEESLEKKP--KDGPKRCSNCNKRV  120

Query  436  GLTGFRCRCGELFC  477
            GLTGF CRCG L+C
Sbjct  121  GLTGFNCRCGNLYC  134



>gb|ACM68440.1| stress-associated protein 3 [Solanum lycopersicum]
Length=171

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 55/128 (43%), Gaps = 13/128 (10%)
 Frame = +1

Query  112  ETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH----KFGEKQPRSGFRRL  279
            E   LC+NNCG  G+ A  NMC KC+         +  A+        G      G    
Sbjct  13   EGPILCINNCGFFGSAANMNMCSKCYKDMVLKQEQAKLAVSSIENLVNGSSASEKGMVIA  72

Query  280  SPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCRRKVGLTGFR  453
             P    PD       T+      +   +    +  P  K +V  NRC  C++KVG+TGF+
Sbjct  73   GPVDVQPD-------TIEAQSIALPSSQTSSSSDMPDVKAKVGPNRCGTCKKKVGITGFK  125

Query  454  CRCGELFC  477
            CRCG L+C
Sbjct  126  CRCGNLYC  133



>ref|XP_010279014.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nelumbo nucifera]
Length=172

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 56/140 (40%), Gaps = 31/140 (22%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             PE   LCVNNCG  G+ A  NMC KC               H     KQ ++     S 
Sbjct  10   APEGPILCVNNCGFFGSAATMNMCSKC---------------HKDLVLKQEQAKLAASSI  54

Query  286  ERT-----------SPDLKRREDRTVARGEKTVeeeeeeeeNRSPPA-----KREVNRCS  417
            E              P +    D ++   E  +   +    + S        K   NRCS
Sbjct  55   ENIVNGSSSSSNGKEPVVAGSVDVSIGSVEPKLISTQVSSASASSEGVEVKVKEGPNRCS  114

Query  418  GCRRKVGLTGFRCRCGELFC  477
             CR++VGLTGF CRCG +FC
Sbjct  115  SCRKRVGLTGFNCRCGNIFC  134



>gb|ABI31653.1| zinc finger protein [Camellia sinensis]
Length=173

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 61/142 (43%), Gaps = 19/142 (13%)
 Frame = +1

Query  82   KEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGE----  249
            + ET  +V P+   LCVNNCG  G+ A  N C KC          +  A     G     
Sbjct  3    QNETGCQVPPDAPMLCVNNCGFFGSAATMNPCSKCHKDLMLKQQQTELAAS-SIGSIANG  61

Query  250  ------KQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNR  411
                  K+P S    +  +  S D       ++    +++  E        PP     NR
Sbjct  62   GSGSPGKEPDSAITTVHVDAGSSDSMIV---SMQASHESLLNENNVIVKEVPP-----NR  113

Query  412  CSGCRRKVGLTGFRCRCGELFC  477
            CS CR++VGLTGF CRCG LFC
Sbjct  114  CSACRKRVGLTGFNCRCGNLFC  135



>ref|NP_001058066.1| Os06g0612800 [Oryza sativa Japonica Group]
 sp|A2YEZ6.2|SAP8_ORYSI RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 8; Short=OsSAP8; AltName: Full=Stress-associated 
protein 3 [Oryza sativa Indica Group]
 sp|A3BDI8.1|SAP8_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 8; Short=OsSAP8; AltName: Full=Stress-associated 
protein 3 [Oryza sativa Japonica Group]
 dbj|BAD35521.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAD35553.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAF19980.1| Os06g0612800 [Oryza sativa Japonica Group]
 gb|EAZ37627.1| hypothetical protein OsJ_21962 [Oryza sativa Japonica Group]
 dbj|BAG96476.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91568.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96788.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96826.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87267.1| unnamed protein product [Oryza sativa Japonica Group]
Length=171

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 61/138 (44%), Gaps = 30/138 (22%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  288
            PE   LC+NNCG  G+ A  NMC KC               H +   KQ ++     S +
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKC---------------HKEMIMKQEQAKLAASSID  55

Query  289  RT--------SPDLKRREDRTVARGE-KTVeeeeeeeeNRS------PPAKREVNRCSGC  423
                       P +    +  VA+ E KT+  +  E    S      P  +   NRCS C
Sbjct  56   SIVNGGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTC  115

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGF CRCG L+C
Sbjct  116  RKRVGLTGFNCRCGNLYC  133



>gb|ACG26325.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|ACG28071.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
Length=171

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 60/138 (43%), Gaps = 30/138 (22%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  288
            PE   LC+NNCG  G+ A  NMC KC               H +   KQ ++     S +
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKC---------------HKEMITKQEQAQLAASSID  55

Query  289  RT--------SPDLKRREDRTVARGE-KTVeeeeeeeeNRS------PPAKREVNRCSGC  423
                       P +    +  V + E KT+  +       S      P AK   +RC+ C
Sbjct  56   SIVNGGDGGKGPVIAASVNAAVPQVEQKTIVVQPMLVAETSEAAAVIPKAKEGPDRCAAC  115

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGF CRCG ++C
Sbjct  116  RKRVGLTGFSCRCGNMYC  133



>ref|XP_009407895.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Musa acuminata subsp. malaccensis]
 ref|XP_009407896.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Musa acuminata subsp. malaccensis]
 ref|XP_009407897.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Musa acuminata subsp. malaccensis]
Length=171

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 57/139 (41%), Gaps = 30/139 (22%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             PE   LC+NNCG  G+ A  NMC KC               H     KQ ++     S 
Sbjct  10   APEGPILCINNCGFFGSAATMNMCSKC---------------HEDMILKQEQAKLAASSI  54

Query  286  E---RTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPP------------AKREVNRCSG  420
            +     S     +E       +  V   E +  +  PP            AK   NRC+ 
Sbjct  55   DSLVNGSGSGSGKEPVVSGNADVAVGSVESKAISAQPPDVLGSSEAGEAKAKEGPNRCNT  114

Query  421  CRRKVGLTGFRCRCGELFC  477
            CR++VGLTGF CRCG LFC
Sbjct  115  CRKRVGLTGFSCRCGNLFC  133



>ref|XP_002282913.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 [Vitis vinifera]
 ref|XP_010654069.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4 [Vitis vinifera]
Length=161

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 59/124 (48%), Gaps = 9/124 (7%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             PE   LC NNCG  G+PA  N+C KC+         +S+A   K   ++  S     + 
Sbjct  9    APEGHRLCANNCGFFGSPATLNLCSKCYRDLRLKEEQASSA---KSAVEKSLSAASSSTA  65

Query  286  ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCG  465
              + P L   E    A  E TV            P+  + NRCS CR++VGLTGFRCRCG
Sbjct  66   PLSPPALTLPE----AANEITVPAAVTAAVPS--PSATQPNRCSTCRKRVGLTGFRCRCG  119

Query  466  ELFC  477
              FC
Sbjct  120  ITFC  123



>ref|XP_006381027.1| hypothetical protein POPTR_0006s05520g [Populus trichocarpa]
 gb|ERP58824.1| hypothetical protein POPTR_0006s05520g [Populus trichocarpa]
Length=171

 Score = 61.2 bits (147),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 56/138 (41%), Gaps = 29/138 (21%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             PE   LC+NNCG  G+ A  NMC KC               H     KQ ++     S 
Sbjct  11   APEGPILCINNCGFFGSAATMNMCSKC---------------HKDIILKQQQAQLAASSI  55

Query  286  ERT----------SPDLKRREDRTVARGEKTVeeeeeeeeNRSPP----AKREVNRCSGC  423
            E             P +    D   A  E  +   E      S P    AK   +RC+ C
Sbjct  56   ESIVNGNSSGNGKEPVVAVAVDVQSAPVEVKIISTEPSSATSSKPSEMKAKEGPSRCTSC  115

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGF CRCG LFC
Sbjct  116  RKRVGLTGFSCRCGNLFC  133



>ref|XP_003606132.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
 gb|AES88329.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
Length=170

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 59/125 (47%), Gaps = 12/125 (10%)
 Frame = +1

Query  124  LCVNNCGVTGNPAANNMCQKCF---sattaaagsssaaIHHKFGEKQPRSGFRR---LSP  285
            LC NNCG  G+PA  ++C KC+         + S+   ++     +Q  S       + P
Sbjct  13   LCANNCGFFGSPAMQDLCSKCYRDLQMKEQRSSSAKLVLNQTLIPQQSNSSSLDTGIIHP  72

Query  286  ERTSPDLKRREDRTVARGEKTVeeeeeeee-NRSPPAKREVNRCSGCRRKVGLTGFRCRC  462
              TSP +       V+    TVE        + + P K + NRC  CRR+VGLTGF+CRC
Sbjct  73   SSTSPSV-----MIVSSSTPTVELVAAAAGPSEAEPPKVQPNRCGTCRRRVGLTGFKCRC  127

Query  463  GELFC  477
            G   C
Sbjct  128  GLTLC  132



>ref|NP_001130325.1| LOC100191419 [Zea mays]
 ref|XP_008680964.1| PREDICTED: LOC100191419 isoform X1 [Zea mays]
 ref|XP_008680965.1| PREDICTED: LOC100191419 isoform X1 [Zea mays]
 gb|ACF78509.1| unknown [Zea mays]
 gb|ACF81174.1| unknown [Zea mays]
 gb|ACN33638.1| unknown [Zea mays]
 gb|AFW70762.1| zinc finger A20 and AN1 domain-containing protein isoform 1 [Zea 
mays]
 gb|AFW70763.1| zinc finger A20 and AN1 domain-containing protein isoform 2 [Zea 
mays]
 gb|AFW70764.1| zinc finger A20 and AN1 domain-containing protein isoform 3 [Zea 
mays]
 gb|AFW70765.1| zinc finger A20 and AN1 domain-containing protein isoform 4 [Zea 
mays]
Length=171

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 60/138 (43%), Gaps = 30/138 (22%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  288
            PE   LC+NNCG  G+ A  NMC KC               H +   KQ ++     S +
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKC---------------HKEMITKQEQAQLAASSID  55

Query  289  RT--------SPDLKRREDRTVARGE-KTVeeeeeeeeNRS------PPAKREVNRCSGC  423
                       P +    +  V + E KT+  +       S      P AK   +RC+ C
Sbjct  56   SIVNGGDGGKGPVIAASVNVAVPQVEQKTIVVQPMLVAETSEAAAVIPKAKEGPDRCAAC  115

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGF CRCG ++C
Sbjct  116  RKRVGLTGFSCRCGNMYC  133



>gb|ABK21043.1| unknown [Picea sitchensis]
Length=170

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 64/148 (43%), Gaps = 26/148 (18%)
 Frame = +1

Query  64   MAQKTGKE--ETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH  237
            MAQ++ K   E   +  P    LC N CG  G+ A  NMC KC+               H
Sbjct  1    MAQESWKNMGEDRGRQPPGGPVLCSNKCGFFGSSATMNMCSKCYR-------------DH  47

Query  238  KFGEKQPRSGFRRLSPERTSPDLKR----REDRTVARGEKTVeeeeeeeeN----RSPPA  393
               + Q  S  +    +  S D+      R D T  R    +     ++ N      PP 
Sbjct  48   FLAQTQA-SAVKSAVEKSLSLDIDSSKALRFDATGVRNPAEIVGSSSDDGNSVSSEEPP-  105

Query  394  KREVNRCSGCRRKVGLTGFRCRCGELFC  477
             R  NRC  CR++VGLTGF+CRCG +FC
Sbjct  106  -RVSNRCQSCRKRVGLTGFKCRCGYVFC  132



>ref|XP_004135920.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform 1 [Cucumis sativus]
 ref|XP_004135921.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform 2 [Cucumis sativus]
 gb|KGN45145.1| hypothetical protein Csa_7G428820 [Cucumis sativus]
Length=172

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 59/134 (44%), Gaps = 6/134 (4%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKC---FsattaaagsssaaIHHKFGEKQ  255
            +ET  +  PE   LC NNCG  G+ A  NMC KC   F      A  ++++  +      
Sbjct  4    KETGCQAPPEAPKLCANNCGFFGSAATMNMCSKCHKDFIMKQEQAKLAASSFGNIVNCGP  63

Query  256  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  435
               G + +    T  +++  E   +                +    K   NRCS CR++V
Sbjct  64   NDHGKKAVVTSPTKLEIEPAESSIIPTQATCTSSNARSIVEK---VKESPNRCSSCRKRV  120

Query  436  GLTGFRCRCGELFC  477
            GLTGF CRCG LFC
Sbjct  121  GLTGFNCRCGSLFC  134



>ref|XP_010271706.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nelumbo nucifera]
Length=173

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 59/128 (46%), Gaps = 7/128 (5%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsa---ttaaagsssaaIHHKFGEKQPRSGFRRL  279
            PE   LC NNCG  G+PA  N+C KC+         A S+  A+          S     
Sbjct  10   PEGHHLCANNCGFFGSPATLNLCSKCYRDLCLKEEQASSAKLAVEKSCAASPSSSSSADS  69

Query  280  SPERTSPDLKRREDRTVARGEKTVeeeeee--eeNRSPPAKREVNRCSGCRRKVGLTGFR  453
            S    SP L    D  V R    V        + N +P +  + NRC+ CR++VGLTGF+
Sbjct  70   SRAPVSPLLLENPD--VGRNPVNVPATVASPSKSNPAPSSASQPNRCATCRKRVGLTGFK  127

Query  454  CRCGELFC  477
            CRCG  FC
Sbjct  128  CRCGITFC  135



>emb|CDP20483.1| unnamed protein product [Coffea canephora]
Length=168

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 59/134 (44%), Gaps = 24/134 (18%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSG----FRR  276
            P +  LC NNCG  G+P   N+C KC+               H   E+Q +       + 
Sbjct  10   PGSHRLCANNCGFFGSPTTLNLCSKCYK-------------DHCLKEQQLKDAKLAVEKT  56

Query  277  LSPERTS-------PDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  435
            L+P  TS       PD+K       A  +   E+        +  A  + NRC+ CRR+V
Sbjct  57   LTPPETSSVSPLPSPDVKIDTIADPAELKAPAEDTVSTSAAPAAVAAAQPNRCASCRRRV  116

Query  436  GLTGFRCRCGELFC  477
            G TGF+CRCG  FC
Sbjct  117  GFTGFKCRCGITFC  130



>gb|AFK36400.1| unknown [Medicago truncatula]
Length=151

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  382  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            S  AKR VNRCSGCR++VGLTGFRCRCG+LFC
Sbjct  82   SSEAKRAVNRCSGCRKRVGLTGFRCRCGDLFC  113



>ref|XP_003627722.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
 gb|AET02198.1| AN1-like zinc finger protein [Medicago truncatula]
 gb|AFK41885.1| unknown [Medicago truncatula]
Length=151

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +1

Query  382  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            S  AKR VNRCSGCR++VGLTGFRCRCG+LFC
Sbjct  82   SSEAKRAVNRCSGCRKRVGLTGFRCRCGDLFC  113



>ref|XP_010053387.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1 [Eucalyptus grandis]
 ref|XP_010053388.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1 [Eucalyptus grandis]
 ref|XP_010053389.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1 [Eucalyptus grandis]
 gb|KCW77665.1| hypothetical protein EUGRSUZ_D01966 [Eucalyptus grandis]
Length=165

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 51/122 (42%), Gaps = 14/122 (11%)
 Frame = +1

Query  124  LCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPD  303
            LC NNCG  GNPA   +C KC+             +  +       +  + L+P+  +P 
Sbjct  16   LCANNCGFWGNPATMGLCSKCY---------KDLCLREQRAAAAKAAMEKSLAPD-AAPA  65

Query  304  LKRREDRTVARGEKTVeeeeeeeeNRSP----PAKREVNRCSGCRRKVGLTGFRCRCGEL  471
             +    R  A   + +           P    P  +  NRC  C RKVGLTGF C+CG  
Sbjct  66   PQETSTRAAASPSQAMPGVGASSSEFPPTSGEPKSKATNRCEACNRKVGLTGFNCKCGST  125

Query  472  FC  477
            FC
Sbjct  126  FC  127



>ref|XP_002304765.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE79744.2| zinc finger family protein [Populus trichocarpa]
Length=178

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 65/142 (46%), Gaps = 4/142 (3%)
 Frame = +1

Query  58   LRMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH  237
            ++  QK  ++ET  +  PE   LC+NNCG  G+ A  NMC KC          +  A   
Sbjct  1    MQEKQKMDRDETGCQAPPERPILCINNCGFFGSAATMNMCSKCHKDMLLKQEQTKLAAS-  59

Query  238  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NR  411
              G     S    ++ E    D    +   V     TV+            AK +   +R
Sbjct  60   SIGSIVNGSASSNVN-EPVIADTINVQINAVEPKTITVQPSCASVSGERVEAKPKEGPSR  118

Query  412  CSGCRRKVGLTGFRCRCGELFC  477
            C+ C+++VGLTGF+CRCG+LFC
Sbjct  119  CTSCKKRVGLTGFKCRCGDLFC  140



>ref|XP_011080265.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
 ref|XP_011080266.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=172

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 61/141 (43%), Gaps = 20/141 (14%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRS  264
            +ET  +  PE   LCVNNCG  G+ A  NMC KC+             I  +   K   S
Sbjct  4    DETGCQPPPEGPILCVNNCGFFGSAANMNMCSKCYKDL----------ILKQEQAKLAAS  53

Query  265  GFRRLSPERTSPDLKR---------REDRTVARGEKTVeeeeeeeeNRSPPAKRE-VNRC  414
                +    +S + +          + D   A+               + P  +E  NRC
Sbjct  54   SIENIVNGSSSGNEQESVVADAAIMQTDLVEAKAISLPSINTSSFAEAAEPKTKEGPNRC  113

Query  415  SGCRRKVGLTGFRCRCGELFC  477
            S C+++VGLTGF+CRCG LFC
Sbjct  114  STCKKRVGLTGFKCRCGYLFC  134



>gb|ABK26062.1| unknown [Picea sitchensis]
Length=180

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 70/157 (45%), Gaps = 34/157 (22%)
 Frame = +1

Query  64   MAQKTG---KEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIH  234
            MAQ++    KEET  +V PE +  C NNCG  G+PA  ++C KC+               
Sbjct  1    MAQESWNREKEETGCQV-PEGLIRCANNCGFFGSPATMSLCSKCYREFVLL---------  50

Query  235  HKFGEKQPRSGFRRLSPERTS-------PDLKRREDRTVARGEKTVeeeeeeeeNR----  381
                   P+S F +   ++         PD+   E R+                ++    
Sbjct  51   -----NSPKSSFDKPQQQQIQGEVSIPRPDVGDEEIRSKYLAVDGSGPSCSTAAHQLEPQ  105

Query  382  -----SPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
                  PP  R+ NRC  CR++VGLTGFRCRCG++FC
Sbjct  106  QQQNPPPPPPRQTNRCFSCRKRVGLTGFRCRCGDMFC  142



>ref|XP_004158200.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 1 [Cucumis sativus]
 ref|XP_004158201.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 2 [Cucumis sativus]
 ref|XP_004158202.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 3 [Cucumis sativus]
 ref|XP_004158203.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 4 [Cucumis sativus]
Length=172

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 59/134 (44%), Gaps = 6/134 (4%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKC---FsattaaagsssaaIHHKFGEKQ  255
            +ET  +  PE   LC NNCG  G+ A  NMC KC   F      A  ++++  +      
Sbjct  4    KETGCQAPPEAPKLCANNCGFFGSAATMNMCSKCHKDFIMKQEQAKLAASSFGNIVNCGP  63

Query  256  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  435
               G + +    T  +++  E   +                +    K   NRCS CR++V
Sbjct  64   NDHGKKAVVTSPTKLEIEPAESSIIPTQATCTSSNVRSIVEK---VKESPNRCSSCRKRV  120

Query  436  GLTGFRCRCGELFC  477
            GLTGF CRCG LFC
Sbjct  121  GLTGFNCRCGSLFC  134



>ref|XP_009418488.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Musa acuminata subsp. malaccensis]
Length=164

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 58/132 (44%), Gaps = 23/132 (17%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLS-  282
             PE   LC+NNCG  G+ A  NMC KC               H     KQ ++     S 
Sbjct  10   APEGPILCINNCGFFGSAATMNMCSKC---------------HKDMMLKQEQAKLDASSI  54

Query  283  ---PERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPP---AKREV-NRCSGCRRKVGL  441
                    P +    D      E      +  +E+ S     AK E  NRC+ CR++VGL
Sbjct  55   GNLASGKGPVITGNADVGTGYLEAKSLLAQVSDESGSSDIREAKAEGPNRCNTCRKRVGL  114

Query  442  TGFRCRCGELFC  477
            TGFRCRCG+LFC
Sbjct  115  TGFRCRCGDLFC  126



>emb|CDP09861.1| unnamed protein product [Coffea canephora]
Length=166

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 60/128 (47%), Gaps = 20/128 (16%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  288
            P   TLC N CG  G+PA  N+C KC+               + F  ++ +    +++ E
Sbjct  16   PSEPTLCANGCGFFGSPATMNLCSKCY---------------NDFQMEEQQKAAAKVALE  60

Query  289  RTSPDLKRRED-----RTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFR  453
            +     K+ +D        + G   V+ E +EE   +P A  + NRC  C +KVG+ GF 
Sbjct  61   KLVTSQKKADDAFHVGSPESYGTAAVQVERQEEAASAPAAVVKSNRCFCCNKKVGVMGFT  120

Query  454  CRCGELFC  477
            CRCG  FC
Sbjct  121  CRCGSTFC  128



>ref|XP_011078867.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=172

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 60/128 (47%), Gaps = 8/128 (6%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKC---FsattaaagsssaaIHHKFGEKQPRSGFRR  276
             PE   LCVNNCG  G+ A  NMC KC          A  ++ +I +        +    
Sbjct  11   APEGPILCVNNCGFFGSAATMNMCSKCHKDMILKQQQAKLAATSIENIVNGSSSSNQKEP  70

Query  277  LSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV-NRCSGCRRKVGLTGFR  453
            +  E    +    E +T A  + +    +      S P  +EV NRC+ CR++VGLTGF 
Sbjct  71   VLAEAVKVEAGSVELKTDALQQSS----DLLSVPSSEPKPKEVPNRCTTCRKRVGLTGFN  126

Query  454  CRCGELFC  477
            C+CG LFC
Sbjct  127  CKCGNLFC  134



>gb|ABK21003.1| unknown [Picea sitchensis]
 gb|ACN40831.1| unknown [Picea sitchensis]
Length=180

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 67/156 (43%), Gaps = 32/156 (21%)
 Frame = +1

Query  64   MAQKTGKEETEFK--VVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH  237
            MAQ++   E E     VPE +  C NNCG  G+PA  ++C KC+                
Sbjct  1    MAQESWNREKEETGCQVPEGLIRCANNCGFFGSPATMSLCSKCYREFVLL----------  50

Query  238  KFGEKQPRSGFRRLSPERTS-------PDLKRREDRTVARGEKTVeeeeeeeeNR-----  381
                  P+S F +   ++         PD+   E R+                ++     
Sbjct  51   ----NSPKSSFDKPQQQQIQGEVSIPRPDVGDEEIRSKYLAVDGSGPSCSTAAHQLEPQQ  106

Query  382  ----SPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
                 PP  R+ NRC  CR++VGLTGFRCRCG++FC
Sbjct  107  QQNPPPPPPRQTNRCFSCRKRVGLTGFRCRCGDMFC  142



>ref|NP_001288688.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
1-like [Zea mays]
 gb|ACG49173.1| multiple stress-responsive zinc-finger protein ISAP1 [Zea mays]
 tpg|DAA40383.1| TPA: multiple stress-responsive zinc-finger protein ISAP1 [Zea 
mays]
Length=161

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 62/138 (45%), Gaps = 15/138 (11%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            MAQ+  KEE      PE ITLC NNCG  GNPA  N+CQ CFSA+ + +  +S++     
Sbjct  1    MAQRDKKEEPTELRAPE-ITLCANNCGFPGNPATQNLCQSCFSASRSPSSPTSSSSSLAS  59

Query  244  GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGC  423
               QPR           +           A G+ T           S   KR        
Sbjct  60   AASQPRP---AALVVDAAAVEALAAPAAAAVGQATEAAARASASRCSSCRKR--------  108

Query  424  RRKVGLTGFRCRCGELFC  477
               VGLTGFRCRCGELFC
Sbjct  109  ---VGLTGFRCRCGELFC  123



>gb|ABK25818.1| unknown [Picea sitchensis]
Length=170

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 64/148 (43%), Gaps = 26/148 (18%)
 Frame = +1

Query  64   MAQKTGKE--ETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH  237
            MAQ++ K   E   +  P    LC N CG  G+ A  NMC KC+               H
Sbjct  1    MAQESWKNMGEDRGRQPPGGPVLCSNKCGFFGSSATMNMCSKCYR-------------DH  47

Query  238  KFGEKQPRSGFRRLSPERTSPDLKR----REDRTVARGEKTVeeeeeeeeN----RSPPA  393
               + Q  S  +    +  S D+      R D +  R    V     ++ N      PP 
Sbjct  48   FLAQTQA-SAVKSAVEKSLSLDIDSSKALRFDASGVRNPAEVVGSSSDDGNSVSSEEPP-  105

Query  394  KREVNRCSGCRRKVGLTGFRCRCGELFC  477
             R  NRC  CR++VGLTGF+CRCG +FC
Sbjct  106  -RVSNRCQSCRKRVGLTGFKCRCGYVFC  132



>ref|XP_011468813.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Fragaria vesca subsp. vesca]
Length=168

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 60/141 (43%), Gaps = 26/141 (18%)
 Frame = +1

Query  88   ETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSG  267
            ET  +  PE   LC NNCG  G+ A  N+C KC               H     KQ ++ 
Sbjct  5    ETGCQAPPEAPKLCANNCGFFGSAATMNLCSKC---------------HKDLVLKQEQAK  49

Query  268  FRRLSPER----TSPDLKRREDRT--VARGEKTVeeeeeeeeNRSPP-----AKREVNRC  414
               +S E     T  +  ++   T  V  G   +     E  +  PP      K    RC
Sbjct  50   VAAVSIESAVNATPNNWGKKPAVTLDVQAGSPDLPLISTEASSTPPPNNEEKVKETPTRC  109

Query  415  SGCRRKVGLTGFRCRCGELFC  477
            + CR++VGLTGF CRCG LFC
Sbjct  110  NTCRKRVGLTGFNCRCGHLFC  130



>ref|XP_004306523.2| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X1 [Fragaria vesca subsp. vesca]
Length=229

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 60/141 (43%), Gaps = 26/141 (18%)
 Frame = +1

Query  88   ETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSG  267
            ET  +  PE   LC NNCG  G+ A  N+C KC               H     KQ ++ 
Sbjct  66   ETGCQAPPEAPKLCANNCGFFGSAATMNLCSKC---------------HKDLVLKQEQAK  110

Query  268  FRRLSPER----TSPDLKRREDRT--VARGEKTVeeeeeeeeNRSPP-----AKREVNRC  414
               +S E     T  +  ++   T  V  G   +     E  +  PP      K    RC
Sbjct  111  VAAVSIESAVNATPNNWGKKPAVTLDVQAGSPDLPLISTEASSTPPPNNEEKVKETPTRC  170

Query  415  SGCRRKVGLTGFRCRCGELFC  477
            + CR++VGLTGF CRCG LFC
Sbjct  171  NTCRKRVGLTGFNCRCGHLFC  191



>ref|XP_004830573.1| zinc finger protein, putative [Babesia equi]
 gb|AFZ80907.1| zinc finger protein, putative [Babesia equi strain WA]
Length=162

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 57/118 (48%), Gaps = 7/118 (6%)
 Frame = +1

Query  124  LCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPD  303
            +C N CG  GNPA  N+C KC+     +      +    +GE+      + +S E+    
Sbjct  14   MCKNGCGFCGNPANENLCSKCYREYIKSQTYKCESQAPNYGEE------KDVSYEKGVES  67

Query  304  LKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
             ++ E + V     T   +  E E  +PP  ++ +RC  CR+ VGL GF CRCG  FC
Sbjct  68   NEKAEIKDVINDTLTAMLKTPEPEAAAPPV-QDTSRCYMCRKAVGLLGFGCRCGFTFC  124



>ref|XP_006597247.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Glycine max]
Length=183

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 63/154 (41%), Gaps = 30/154 (19%)
 Frame = +1

Query  61   RMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHK  240
            ++ +K   ++T  +  PE   LC+ NCG  G+ A  NMC KC               H  
Sbjct  7    KVEKKMDHDKTGCEAPPEGPILCITNCGFFGSAATMNMCSKC---------------HKD  51

Query  241  FGEKQPRSGFRRLS----------PERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPP  390
               KQ ++G    S               P +    D +V   E  +   +    + S  
Sbjct  52   MMLKQEQAGLVASSIGNIMNGSSSSSGNEPAIATSVDVSVNSIEPKIIPAQPLVASGSEE  111

Query  391  A-----KREVNRCSGCRRKVGLTGFRCRCGELFC  477
            +     K   NRCS C ++VGLTGF CRCG LFC
Sbjct  112  SDEAKPKDGPNRCSNCNKRVGLTGFNCRCGNLFC  145



>ref|XP_009365001.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=172

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 54/133 (41%), Gaps = 6/133 (5%)
 Frame = +1

Query  88   ETEFKVVPETITLCVNNCGVTGNPAANNMCQKC---FsattaaagsssaaIHHKFGEKQP  258
            ET  +  PE   LC NNCG  G+PA  N+C KC          A   +A+I         
Sbjct  5    ETGCQAPPEAPKLCANNCGFFGSPATMNLCSKCHKDLVLKQEQAKVVAASIDSAVNGSPS  64

Query  259  RSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVG  438
             SG     P  T+    +     V                R    K    RC  CR++VG
Sbjct  65   ESG---KGPVATAAVDVQAGPADVMLISTQASSTPSLNIKREEKVKETPTRCGTCRKRVG  121

Query  439  LTGFRCRCGELFC  477
            LTGF CRCG+LFC
Sbjct  122  LTGFSCRCGDLFC  134



>gb|AAQ84334.1| stress-associated protein 8 [Oryza sativa Indica Group]
Length=171

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 61/138 (44%), Gaps = 30/138 (22%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  288
            P+   LC+NNCG  G+ A  NMC KC               H +   KQ ++     S +
Sbjct  11   PKGPILCINNCGFFGSAATMNMCSKC---------------HKEMIMKQEQAKLAASSID  55

Query  289  RT--------SPDLKRREDRTVARGE-KTVeeeeeeeeNRS------PPAKREVNRCSGC  423
                       P +    +  VA+ E KT+  +  E    S      P  +   NRCS C
Sbjct  56   SIVNGGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTC  115

Query  424  RRKVGLTGFRCRCGELFC  477
            R++VGLTGF CRCG L+C
Sbjct  116  RKRVGLTGFNCRCGNLYC  133



>gb|ACF80251.1| unknown [Zea mays]
Length=174

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 58/143 (41%), Gaps = 35/143 (24%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             PE   LC+NNCG  G+ A  NMC KC               H +   KQ ++     S 
Sbjct  10   APEGPILCINNCGFFGSAATMNMCSKC---------------HKEMITKQDQAKLAASSI  54

Query  286  ERTSPDLKRREDRTVARGEKTVeeeee---eeeNRSPPA----------------KREVN  408
            +          +  VA G  TV    +   +  N   PA                K   N
Sbjct  55   DSIVNGSDAVMEPVVA-GSNTVVAVAQVELQTMNVQQPADVAGSSEGVAAISKGGKVGPN  113

Query  409  RCSGCRRKVGLTGFRCRCGELFC  477
            RCS CR++VGLTGF CRCG L+C
Sbjct  114  RCSACRKRVGLTGFNCRCGNLYC  136



>ref|XP_006647019.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Oryza brachyantha]
Length=252

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 74/181 (41%), Gaps = 38/181 (21%)
 Frame = +1

Query  4    LSLPLSLRISDCLVVFLVLR-MAQKTGKEETEFKVV----PETITLCVNNCGVTGNPAAN  168
            L + L +RI      +LVL  +  +    E E K      PE   LC+NNCG  G+ A  
Sbjct  49   LLIYLYVRIVSYSFGYLVLHCLFDEQIIVEMEHKEAGCQQPEGPILCINNCGFFGSAATM  108

Query  169  NMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGE--  342
            NMC KC               H +   K+ ++     S +         ++  VA G   
Sbjct  109  NMCSKC---------------HKEMIMKEEQAKLAASSIDSIVNGCDGGKEHIVAGGSGS  153

Query  343  ----------KTVeeeeeeeeNRS------PPAKREVNRCSGCRRKVGLTGFRCRCGELF  474
                      KT+  +  +    S      P  K   NRC+ CR++VGLTGF CRCG ++
Sbjct  154  AAVAVAQVEAKTLIVQPADVAGTSEEVAAAPKVKEGPNRCATCRKRVGLTGFNCRCGNMY  213

Query  475  C  477
            C
Sbjct  214  C  214



>ref|XP_008349975.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
Length=172

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 54/133 (41%), Gaps = 6/133 (5%)
 Frame = +1

Query  88   ETEFKVVPETITLCVNNCGVTGNPAANNMCQKC---FsattaaagsssaaIHHKFGEKQP  258
            ET  +  PE   LC NNCG  G+PA  N+C KC          A   +A+I         
Sbjct  5    ETGCQAPPEAPKLCANNCGFFGSPATMNLCSKCHKDLVLKQEQAKVVAASIDSAVNGSPS  64

Query  259  RSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVG  438
             SG     P  T+    +     V                R    K    RC  CR++VG
Sbjct  65   ESG---KGPVATAAVDVQAGPADVMLISTQASSTPSLNIKREEKVKETPTRCGTCRKRVG  121

Query  439  LTGFRCRCGELFC  477
            LTGF CRCG+LFC
Sbjct  122  LTGFSCRCGDLFC  134



>gb|AAX14637.1| zinc finger protein [Zea mays]
 gb|ABS83244.1| AN13 [Zea mays]
 gb|ACG36018.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|ACG48526.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|AFW87476.1| zinc finger protein1 isoform 1 [Zea mays]
 gb|AFW87477.1| zinc finger protein1 isoform 2 [Zea mays]
 gb|AFW87478.1| zinc finger protein1 isoform 3 [Zea mays]
Length=174

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 58/143 (41%), Gaps = 35/143 (24%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             PE   LC+NNCG  G+ A  NMC KC               H +   KQ ++     S 
Sbjct  10   APEGPILCINNCGFFGSAATMNMCSKC---------------HKEMITKQDQAKLAASSI  54

Query  286  ERTSPDLKRREDRTVARGEKTVeeeee---eeeNRSPPA----------------KREVN  408
            +          +  VA G  TV    +   +  N   PA                K   N
Sbjct  55   DSIVNGSDAVMEPVVA-GSNTVVAVAQVELQTMNVQQPADVAGPSEGVAAISKGGKVGPN  113

Query  409  RCSGCRRKVGLTGFRCRCGELFC  477
            RCS CR++VGLTGF CRCG L+C
Sbjct  114  RCSACRKRVGLTGFNCRCGNLYC  136



>ref|XP_006842203.1| hypothetical protein AMTR_s00078p00168800 [Amborella trichopoda]
 gb|ERN03878.1| hypothetical protein AMTR_s00078p00168800 [Amborella trichopoda]
Length=168

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 62/143 (43%), Gaps = 18/143 (13%)
 Frame = +1

Query  64   MAQKTGKEETEF--KVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH  237
            MAQ++ K + E      P+    C N CG  G+ + NN+C KC+             I  
Sbjct  1    MAQESKKRDAEDMGHEPPKGPIFCANKCGFFGSASTNNLCSKCYKDFYLKQLKEDENITD  60

Query  238  KFG---EKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVN  408
            K       +P +          + +L+  ED    +G         +  +   P K+  N
Sbjct  61   KVIPCLNNEPNAKV-------DAANLQNSEDGKKNKG------VVVDGTSSEEPQKQAPN  107

Query  409  RCSGCRRKVGLTGFRCRCGELFC  477
            RC  CR++VGL GFRCRCG LFC
Sbjct  108  RCRLCRKRVGLAGFRCRCGGLFC  130



>ref|XP_007145317.1| hypothetical protein PHAVU_007G228900g [Phaseolus vulgaris]
 gb|ESW17311.1| hypothetical protein PHAVU_007G228900g [Phaseolus vulgaris]
Length=171

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 58/128 (45%), Gaps = 9/128 (7%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsa---ttaaagsssaaIHHKFGE--KQPRSGFR  273
            PE   LCVNNCG  G+ A  N+C KC+ A         ++ + I        K P S   
Sbjct  10   PEGHRLCVNNCGFFGSSATMNLCSKCYGAIRLKEQDDATTKSTIEAALSSSAKTPLS---  66

Query  274  RLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFR  453
              SP   + D+  +    +          +    + S     + NRC+ CR++VGLTGF+
Sbjct  67   -TSPPAAAVDVLVKASPPLPAEVTVAVPVQVPVTSSSITGSAQPNRCAACRKRVGLTGFK  125

Query  454  CRCGELFC  477
            CRCG  FC
Sbjct  126  CRCGVTFC  133



>ref|XP_010244455.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Nelumbo nucifera]
 ref|XP_010244459.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Nelumbo nucifera]
Length=168

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 59/127 (46%), Gaps = 8/127 (6%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsa---ttaaagsssaaIHHKFGEKQPRSGFRR  276
             PE   LC NNCG  G+PA  N+C KC+         A S+  A+          S    
Sbjct  9    APEGHRLCANNCGFFGSPATLNLCSKCYRDLRLKEEQASSAKIAVEKSLAASSSSSSSAA  68

Query  277  LSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRC  456
            LS +  S  L +  + T A    TV          SP A  + NRC+ CR++VGLTGF+C
Sbjct  69   LSTDPVSHPLVKLPNETPADHPLTVPASVG-----SPSAAPQPNRCATCRKRVGLTGFKC  123

Query  457  RCGELFC  477
            RCG   C
Sbjct  124  RCGITLC  130



>ref|XP_002297783.1| zinc finger family protein [Populus trichocarpa]
 gb|ABK92782.1| unknown [Populus trichocarpa]
 gb|EEE82588.1| zinc finger family protein [Populus trichocarpa]
Length=172

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 58/133 (44%), Gaps = 4/133 (3%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRS  264
            +ET  +  PE   LC NNCG  G+ A  NMC KC          ++ A           S
Sbjct  4    DETGCQAPPEGPILCTNNCGFFGSAATMNMCSKCHKGMLLKQEQANLAASSIGSIVNGSS  63

Query  265  GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCRRKVG  438
                  P     D+   ++  V     TV+            AK +   NRC+ C+++VG
Sbjct  64   SSNVFEP--VIADIIDVQNNAVEPKTITVQPSCASGSGERVEAKPKEGPNRCTSCKKRVG  121

Query  439  LTGFRCRCGELFC  477
            LTGF+CRCG LFC
Sbjct  122  LTGFKCRCGSLFC  134



>emb|CBI16408.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 53/131 (40%), Gaps = 40/131 (31%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRS  264
            +ET  +  PE   LC+NNCG  G+PA  NMC KC                          
Sbjct  4    DETGCQAHPEGPILCINNCGFFGSPATMNMCSKCHKDMM---------------------  42

Query  265  GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLT  444
                         LK+ + +  +      E   E +    P      NRCS C+++VGLT
Sbjct  43   -------------LKQEQAKLASSFSFGSEGSGEAKPKEGP------NRCSTCKKRVGLT  83

Query  445  GFRCRCGELFC  477
            GF CRCG LFC
Sbjct  84   GFNCRCGHLFC  94



>ref|XP_010911243.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Elaeis guineensis]
 ref|XP_010911244.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Elaeis guineensis]
Length=161

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 59/133 (44%), Gaps = 38/133 (29%)
 Frame = +1

Query  124  LCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPER----  291
            LC NNCG  G+PA  N+C KC+               ++  E+Q  S   +++ E+    
Sbjct  13   LCANNCGFFGSPATLNLCSKCYR-------------DYRLKEEQAASA--KIAVEKSFAS  57

Query  292  -----------TSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVG  438
                       TSP    R    +   E  V        + + P   + +RC+ CR++VG
Sbjct  58   SSSSSPSAVAVTSPAGDARSPVALTLPEAAV--------SETSPVASQTSRCTACRKRVG  109

Query  439  LTGFRCRCGELFC  477
            LTGF+CRCG  +C
Sbjct  110  LTGFKCRCGSTYC  122



>ref|XP_002323304.1| hypothetical protein POPTR_0016s05220g [Populus trichocarpa]
 ref|XP_006373771.1| hypothetical protein POPTR_0016s05220g [Populus trichocarpa]
 ref|XP_011033292.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 ref|XP_011033293.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 ref|XP_011033294.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 ref|XP_011033295.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 gb|ABK94854.1| unknown [Populus trichocarpa]
 gb|ABK96387.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF05065.1| hypothetical protein POPTR_0016s05220g [Populus trichocarpa]
 gb|ERP51568.1| hypothetical protein POPTR_0016s05220g [Populus trichocarpa]
Length=170

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 57/132 (43%), Gaps = 18/132 (14%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             PE   LC+NNCG  G+ A  NMC KC              I ++   +   S    +  
Sbjct  11   APEGPILCINNCGFFGSAATMNMCSKCHKDI----------ILNQQQAQLAASSIESIVN  60

Query  286  ERTS-----PDLKRREDRTVARGEKTVeeeeeeeeNRSPP---AKREVNRCSGCRRKVGL  441
              +S     P +    D   A  E  +   E    +  P    AK   +RC+ CR++VGL
Sbjct  61   GNSSGNGKEPVVAGAVDVQAAPVEVKIISTEPSIASSKPSEMKAKEGPSRCTACRKRVGL  120

Query  442  TGFRCRCGELFC  477
            TGF CRCG LFC
Sbjct  121  TGFGCRCGNLFC  132



>ref|XP_010105325.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 [Morus notabilis]
 gb|EXC04346.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 [Morus notabilis]
Length=168

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 54/124 (44%), Gaps = 4/124 (3%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             PE   LC+NNCG  G  A NNMC KCF  T      +  A           +G   +  
Sbjct  11   APERPILCINNCGFFGRAATNNMCSKCFKDTLLKQEQAKLAASSIDSIVNGGNGKEPVIA  70

Query  286  ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCG  465
            +         E   V     +     +  EN     K+  NRC+ CR++VGLTGF C+CG
Sbjct  71   DALDVQAGPVETEIVTTEPSSDSSSSKPVEN----VKQGPNRCTTCRKRVGLTGFNCKCG  126

Query  466  ELFC  477
             LFC
Sbjct  127  NLFC  130



>ref|XP_010540147.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 7-like [Tarenaya hassleriana]
 ref|XP_010540154.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 7-like [Tarenaya hassleriana]
Length=167

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 56/123 (46%), Gaps = 6/123 (5%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  288
            P    LC N CG  G+P+  N+C KC+    A     +AA        +P      L+PE
Sbjct  13   PSEPKLCANGCGFFGSPSNMNLCSKCYRDLRAMEDQKAAAKAAVEKSFKPS----LLTPE  68

Query  289  RTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGE  468
            + +  +    +  V  G  T         ++  P +   NRCS C +KVG+ GF+C+CG 
Sbjct  69   QPAKPVPASAEAAVVNG--TEPTATPGAADKHEPPRHPSNRCSSCNKKVGVMGFKCKCGS  126

Query  469  LFC  477
             FC
Sbjct  127  TFC  129



>emb|CDP15398.1| unnamed protein product [Coffea canephora]
Length=164

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 59/135 (44%), Gaps = 15/135 (11%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQP--  258
            EE  F+  PE   LC NNCG  G+PA  N C KC+        + S        + +P  
Sbjct  3    EEHGFRA-PEGHRLCANNCGFFGSPATQNFCSKCYRDLCLNKEADS--------KAKPVM  53

Query  259  --RSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRK  432
                     S    +    + ++  VA    T       +    P A  + NRCS CRRK
Sbjct  54   DSLYALPSSSSSAPTSASLKPDNSAVAAAADTETVGLVSQAAVQPVA--QPNRCSVCRRK  111

Query  433  VGLTGFRCRCGELFC  477
            VGLTGFRCRCG  FC
Sbjct  112  VGLTGFRCRCGITFC  126



>ref|XP_003633556.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Vitis vinifera]
 ref|XP_003633557.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Vitis vinifera]
 emb|CAN83974.1| hypothetical protein VITISV_035215 [Vitis vinifera]
Length=172

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 58/140 (41%), Gaps = 20/140 (14%)
 Frame = +1

Query  88   ETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSG  267
            ET  +  PE   LC+NNCG  G+ A  NMC KC              +  +   K   S 
Sbjct  5    ETGCQAPPEAPILCINNCGFFGSAATMNMCSKCHKDL----------VLKQEQAKLAASS  54

Query  268  FRRLSPERTSPDLKRR-----EDRTVARGEKTVeeeeeeeeNRSPP-----AKREVNRCS  417
            F  +    ++ + K       +   +  G         +    SP       K   NRCS
Sbjct  55   FESIVEGSSNCNAKESMVAIAKADIIQTGPSESMPVPTQAACASPSETNDRVKEGPNRCS  114

Query  418  GCRRKVGLTGFRCRCGELFC  477
             CR++VGLTGF CRCG +FC
Sbjct  115  SCRKRVGLTGFNCRCGNIFC  134



>gb|ACJ84133.1| unknown [Medicago truncatula]
Length=151

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +1

Query  382  SPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            S  AKR VNRCSGCR++VGLTGF CRCG+LFC
Sbjct  82   SSEAKRAVNRCSGCRKRVGLTGFHCRCGDLFC  113



>ref|XP_010557404.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger A20 and AN1 domain-containing 
stress-associated protein 3 [Tarenaya hassleriana]
Length=155

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 56/118 (47%), Gaps = 12/118 (10%)
 Frame = +1

Query  124  LCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPD  303
            LC NNCG  G+PA  ++C KCF        +SS  + H          ++ L     S  
Sbjct  12   LCANNCGFFGSPATXSLCSKCFCDLQIKQQNSSPKLAH----------YQTLVSTSASTP  61

Query  304  LKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
                 D T  +  ++  E+        P  +++ +R S CRR+VGLTGF CRCG ++C
Sbjct  62   SILAVDSTAVKVSRSKSEDPTAVTQPQP--QQDPDRWSSCRRRVGLTGFXCRCGFVYC  117



>emb|CBI24865.3| unnamed protein product [Vitis vinifera]
Length=135

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 54/132 (41%), Gaps = 41/132 (31%)
 Frame = +1

Query  88   ETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSG  267
            ET  +  PE   LC+NNCG  G+ A  NMC KC               H     KQ ++ 
Sbjct  5    ETGCQAPPEAPILCINNCGFFGSAATMNMCSKC---------------HKDLVLKQEQAK  49

Query  268  FRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCRRKVGL  441
                S E            ++  G                 AK  +  NRCS CR++VGL
Sbjct  50   LAASSFE------------SIVEGSSNCN------------AKESMGPNRCSSCRKRVGL  85

Query  442  TGFRCRCGELFC  477
            TGF CRCG +FC
Sbjct  86   TGFNCRCGNIFC  97



>ref|XP_002891622.1| hypothetical protein ARALYDRAFT_474234 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67881.1| hypothetical protein ARALYDRAFT_474234 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 61/139 (44%), Gaps = 1/139 (1%)
 Frame = +1

Query  64   MAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKF  243
            M  +   ++T  +  PE   LC+NNCG  G+ A  NMC KC           +       
Sbjct  1    MVLEMDHDKTGCQSPPEGPKLCINNCGFFGSAATMNMCSKCHKDMLFEQEQGAKFASAVS  60

Query  244  GEKQPRSGFRR-LSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSG  420
            G     +  +  ++      + K  E  TV+    +V+   E          +  +RC+ 
Sbjct  61   GTSSSSNLIKETITAALVDVETKSVEPMTVSVQPSSVQVVAEVVAPEEAAKPKGPSRCTT  120

Query  421  CRRKVGLTGFRCRCGELFC  477
            C ++VGLTGF+CRCG LFC
Sbjct  121  CNKRVGLTGFKCRCGNLFC  139



>gb|AFW87479.1| zinc finger protein1 [Zea mays]
Length=193

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 62/155 (40%), Gaps = 39/155 (25%)
 Frame = +1

Query  82   KEETEFK----VVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGE  249
            KE  E K      PE   LC+NNCG  G+ A  NMC KC               H +   
Sbjct  17   KEAMEHKEAGCQAPEGPILCINNCGFFGSAATMNMCSKC---------------HKEMIT  61

Query  250  KQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeee---eeeNRSPPA---------  393
            KQ ++     S +          +  VA G  TV    +   +  N   PA         
Sbjct  62   KQDQAKLAASSIDSIVNGSDAVMEPVVA-GSNTVVAVAQVELQTMNVQQPADVAGPSEGV  120

Query  394  -------KREVNRCSGCRRKVGLTGFRCRCGELFC  477
                   K   NRCS CR++VGLTGF CRCG L+C
Sbjct  121  AAISKGGKVGPNRCSACRKRVGLTGFNCRCGNLYC  155



>ref|XP_010500691.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2 [Camelina sativa]
 ref|XP_010500692.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2 [Camelina sativa]
 ref|XP_010500693.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2 [Camelina sativa]
 ref|XP_010500694.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2 [Camelina sativa]
 ref|XP_010461952.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2 [Camelina sativa]
 ref|XP_010461953.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2 [Camelina sativa]
Length=173

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 55/124 (44%), Gaps = 1/124 (1%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRR-LSP  285
            PE   LCVNNCG  G+ A  NMC KC           +       G     +  +  ++ 
Sbjct  12   PEGPKLCVNNCGFFGSAATMNMCSKCHKDMLFQQEQGAKFASAVSGTSSSSNIIKETITA  71

Query  286  ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCG  465
                 + K  E  TV+    +V+   E          +  +RC+ C ++VGLTGF+CRCG
Sbjct  72   ALVDVETKSVEPMTVSVQPSSVQVVAEVVAPEEAAKPKGPSRCTTCNKRVGLTGFKCRCG  131

Query  466  ELFC  477
             LFC
Sbjct  132  NLFC  135



>ref|XP_006656245.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Oryza brachyantha]
Length=171

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 56/125 (45%), Gaps = 4/125 (3%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFG-EKQPRSGFRRLSP  285
            PE   LC+NNCG  G+ A  NMC KC          +  A            SG   +  
Sbjct  11   PEGPILCINNCGFFGSAATMNMCSKCHKEMIMKQEQAKLAASSIDSIVNGGDSGKEPIIA  70

Query  286  ERTSPDLKRREDRT-VARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRC  462
              T     + E +T VA+  +     E    N  P  K   +RCS CR++VGLTGF CRC
Sbjct  71   GHTEVAFAQVEVQTLVAQPAEIAGPSEGLTVN--PKGKEGPSRCSTCRKRVGLTGFNCRC  128

Query  463  GELFC  477
            G L+C
Sbjct  129  GNLYC  133



>ref|XP_007206046.1| hypothetical protein PRUPE_ppa012588mg [Prunus persica]
 gb|EMJ07245.1| hypothetical protein PRUPE_ppa012588mg [Prunus persica]
Length=162

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 55/118 (47%), Gaps = 5/118 (4%)
 Frame = +1

Query  124  LCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPD  303
            LCVNNCG  G+P   N+C KC+         + A            S          SP 
Sbjct  12   LCVNNCGFFGSPTTQNLCSKCYRDLQLKEQQTLALNQTLISSASASSSSHSF----LSPL  67

Query  304  LKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
            +                +EEEE+E  +PPA R+ N+C  CRR+VGLTGF+CRCG  FC
Sbjct  68   ISASPSHDARVERVVETKEEEEKEQHAPPA-RQANKCMTCRRRVGLTGFKCRCGMTFC  124



>ref|XP_011037831.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 ref|XP_011037832.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
Length=172

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 61/136 (45%), Gaps = 10/136 (7%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsat---taaagsssaaIHHKFGEKQ  255
            +ET  +  PE   LC NNCG  G+ A  NMC KC          A  ++++I        
Sbjct  4    DETGCQAPPEGPILCTNNCGFFGSAATMNMCSKCHKDMLLKQEQANLAASSIGSIVNGSS  63

Query  256  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREV--NRCSGCRR  429
                F     E    D+   ++  V     TV+            AK +   NRC+ C++
Sbjct  64   SSDVF-----ETVIADIIDVQNNAVEPKTITVQPSCASGSGERVEAKPKEGPNRCTSCKK  118

Query  430  KVGLTGFRCRCGELFC  477
            +VGLTGF+CRCG LFC
Sbjct  119  RVGLTGFKCRCGSLFC  134



>gb|EMS48637.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 [Triticum urartu]
Length=302

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 50/130 (38%), Gaps = 20/130 (15%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  288
            PE   LCVNNCG  G+ A  NMC KC                    E+Q +         
Sbjct  148  PEGPILCVNNCGFFGSAATMNMCSKCHKEMVMK-------------EEQAKLAASSFDSI  194

Query  289  RTSPDLKRREDRTVARGEKTVe-------eeeeeeeNRSPPAKREVNRCSGCRRKVGLTG  447
                D    E        K +            E    SP  K   NRCS CR++VGLTG
Sbjct  195  VNGGDAANAEVAVAQVDVKALVVQPAADVAGTSEAVAVSPKRKEGPNRCSTCRKRVGLTG  254

Query  448  FRCRCGELFC  477
            F CRCG ++C
Sbjct  255  FNCRCGNMYC  264



>ref|XP_009783306.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Nicotiana sylvestris]
Length=168

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 54/134 (40%), Gaps = 23/134 (17%)
 Frame = +1

Query  106  VPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSP  285
             P+  TLCVNNCG  G     NMC KC+                 F ++Q       +  
Sbjct  10   APQAPTLCVNNCGFFGTATTMNMCSKCYKDMM-------------FKQEQAELAASSIES  56

Query  286  ERTSPDLKRREDRTVARGEKTVeeeeeeeeNRS---PP-------AKREVNRCSGCRRKV  435
                      +   VA G +    E      +    PP       AK   NRC+ CR++V
Sbjct  57   FVNGSSSATAKAVDVAVGVQEGPAESLVIPKQVVCVPPENDNVEKAKVGPNRCNTCRKRV  116

Query  436  GLTGFRCRCGELFC  477
            GLTGF CRCG LFC
Sbjct  117  GLTGFNCRCGHLFC  130



>ref|XP_006354259.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum tuberosum]
Length=170

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 62/134 (46%), Gaps = 8/134 (6%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsa---ttaaagsssaaIHHKFGEKQ  255
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+         A  ++++I +      
Sbjct  4    DETGCQPHPEGPILCINNCGFFGSAANMNMCSKCYKDVILKQEQAKLAASSIENFVNGST  63

Query  256  PRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKV  435
             + G   +      P L   +    +    +   E  E   +  P+     RCS C++KV
Sbjct  64   SQKGPVIVGSVDVQPALLESKSVIFSSPPSSSSGEAAELMAKEGPS-----RCSTCKKKV  118

Query  436  GLTGFRCRCGELFC  477
            GLTGF+CRCG  +C
Sbjct  119  GLTGFKCRCGNFYC  132



>gb|KDO50474.1| hypothetical protein CISIN_1g030772mg [Citrus sinensis]
Length=171

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/142 (30%), Positives = 59/142 (42%), Gaps = 18/142 (13%)
 Frame = +1

Query  67   AQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFG  246
            +QK   EET  +    T   C NNCG  G+   NN+C KC+                   
Sbjct  5    SQKRKLEETSHET-QNTPIYCANNCGFFGSANTNNLCSKCYKDYLLKQS-----------  52

Query  247  EKQPRSGFRRLSPERTSPDLKRREDRTVA-----RGEKTVeeeeeeeeNRSPPAKREVNR  411
             K P          +   ++++ E   V      R         +E  +   P KR  NR
Sbjct  53   -KNPNPSPIEEEKNKNKTNIEQNEANPVGGVVENRDPAAQVVVVDEGASSENPEKRPANR  111

Query  412  CSGCRRKVGLTGFRCRCGELFC  477
            CS CR+++GLTGF+CRC + FC
Sbjct  112  CSFCRKRIGLTGFKCRCEQTFC  133



>emb|CDP13127.1| unnamed protein product [Coffea canephora]
Length=166

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 59/128 (46%), Gaps = 20/128 (16%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPE  288
            P   TLC N CG  G+PA  N+C KC+                 F  ++ +    +++ E
Sbjct  16   PSEPTLCANGCGFFGSPATMNLCSKCYK---------------DFQMEEQQKAAAKVALE  60

Query  289  RTSPDLKRREDRTVARGEKTVeeeeeeeeNR-----SPPAKREVNRCSGCRRKVGLTGFR  453
            +     K+ +D + A   ++     E+ E +     +P A  + NRC  C +KVG+ GF 
Sbjct  61   KLVTSQKKADDASHAGSPESYGTAAEQVERQEEAVSAPVAVVKSNRCFCCNKKVGVMGFT  120

Query  454  CRCGELFC  477
            CRCG  FC
Sbjct  121  CRCGSTFC  128



>ref|XP_009770813.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana sylvestris]
Length=172

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 61/137 (45%), Gaps = 12/137 (9%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRS  264
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+  T      +      K       +
Sbjct  4    DETGCQSHPEGPILCINNCGFFGSAANMNMCSKCYKDTILKQEQA------KLAATSIEN  57

Query  265  GFRRLSPERTSPDLKRREDRTVARGE-KTVeeeeeeeeNRSPPA-----KREVNRCSGCR  426
                 +     P +    D   A  E K+V        + +  A     K   +RCS C+
Sbjct  58   LVNGSNASEKGPVVVDSVDMQPAVLETKSVVALSSPPSSSAGEAAELKTKVGPSRCSSCK  117

Query  427  RKVGLTGFRCRCGELFC  477
            +KVGLTGF+CRCG L+C
Sbjct  118  KKVGLTGFKCRCGNLYC  134



>gb|EEE56499.1| hypothetical protein OsJ_05747 [Oryza sativa Japonica Group]
Length=181

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 57/126 (45%), Gaps = 4/126 (3%)
 Frame = +1

Query  109  PETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRR---L  279
            PE   LC+NNCG  G+ A  NMC KC          +  A            G +     
Sbjct  19   PEGPILCINNCGFFGSAATMNMCSKCHKEMIMKEEQAKLAASSIDSIVNGCDGGKEHIVA  78

Query  280  SPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCR  459
            +   T+  + + E +T+   + T      EE    P  K   NRC+ CR++VGLTGF CR
Sbjct  79   ASGSTAVAVAQVEAKTLVV-QPTDVAGTSEEVAVVPKVKEGPNRCATCRKRVGLTGFNCR  137

Query  460  CGELFC  477
            CG ++C
Sbjct  138  CGNMYC  143



>ref|XP_002975420.1| hypothetical protein SELMODRAFT_150464 [Selaginella moellendorffii]
 gb|EFJ23621.1| hypothetical protein SELMODRAFT_150464 [Selaginella moellendorffii]
Length=175

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 63/140 (45%), Gaps = 5/140 (4%)
 Frame = +1

Query  64   MAQKTGKEETEFK--VVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHH  237
            MAQ++ K E E     +PE   LC NNCG  G+ A  N+C KC+   +++  ++   I  
Sbjct  1    MAQESWKREEEAAGCQLPEGPVLCANNCGFFGSVATMNLCSKCYREQSSSKAAAETMITT  60

Query  238  KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCS  417
                    +          +    R            V E++       P   R  NRC 
Sbjct  61   TTTAAAAAATPAAKEEALAAIATSRTSTTIATAATTLVTEDDSSASQEKP---RLSNRCL  117

Query  418  GCRRKVGLTGFRCRCGELFC  477
             CR+++GLTGF+CRCG++FC
Sbjct  118  ACRKRLGLTGFKCRCGDVFC  137



>ref|XP_009589284.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
 ref|XP_009589285.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
Length=172

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 61/146 (42%), Gaps = 30/146 (21%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRS  264
            +ET  +  PE   LC+NNCG  G+ A  NMC KC+  T                 KQ ++
Sbjct  4    DETGCQSHPEGPILCINNCGFFGSAANMNMCSKCYKDTIL---------------KQEQA  48

Query  265  GFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSP---------------PAKR  399
                 S E         E   V  G   V+    E ++                   AK 
Sbjct  49   KLAATSIENLVNGSIASEKGPVVVGSVDVQPAMLETKSVVVLSSPPSSSAGEAAELKAKV  108

Query  400  EVNRCSGCRRKVGLTGFRCRCGELFC  477
              +RCS C++KVGLTGF+CRCG L+C
Sbjct  109  GPSRCSSCKKKVGLTGFKCRCGNLYC  134



>ref|XP_007028890.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 4 [Theobroma cacao]
 gb|EOY09392.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 4 [Theobroma cacao]
Length=182

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 44/158 (28%), Positives = 65/158 (41%), Gaps = 27/158 (17%)
 Frame = +1

Query  43   VVFLVLRMAQKTGKEETEFKVVPETITLCVNNCGVTGNPAANNMCQKCFsattaaagsss  222
            ++ +  R+ +    +ET  +  PE   LCVNNCG  G+ A  NMC KC  A         
Sbjct  1    MILMSWRLEKMESHDETGCQA-PEGPILCVNNCGFFGSAATMNMCSKCHKAMI-------  52

Query  223  aaIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVeeeeeeeeNRSPPA---  393
                    ++Q +     +            ++ T+A          E +   + P+   
Sbjct  53   ------LKQEQVQLAASSIGSIVNGSSSGNGKEPTLAAALDVQSGIFESKNGSAEPSIDP  106

Query  394  ----------KREVNRCSGCRRKVGLTGFRCRCGELFC  477
                      K   NRC+ CR++VGLTGF CRCG LFC
Sbjct  107  SRMTFGGMKIKEGPNRCTTCRKRVGLTGFNCRCGNLFC  144



>ref|XP_004506164.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 3-like [Cicer arietinum]
Length=158

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 55/118 (47%), Gaps = 9/118 (8%)
 Frame = +1

Query  124  LCVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERTSPD  303
            LC NNCG  G+PA  ++C KC+         SS+A   K    Q     + +SP    P 
Sbjct  12   LCANNCGFFGSPAMQDLCSKCYRDLQIKEQRSSSA---KLVLNQTLVSPQSISPAEIQPS  68

Query  304  LKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC  477
                   + +  E+ V+   E E    P      NRC  CRR+VGLTGF+CRCG   C
Sbjct  69   SSISSSSSSSAEEQVVDGPLEVEVKVQP------NRCGTCRRRVGLTGFKCRCGLTLC  120



>dbj|BAO74165.1| zinc finger protein [Cucurbita pepo subsp. ovifera]
Length=176

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 59/136 (43%), Gaps = 7/136 (5%)
 Frame = +1

Query  85   EETEFKVVPETITLCVNNCGVTGNPAANNMCQKC---FsattaaagsssaaIHHKFGEKQ  255
            +ET  +  PE   LC NNCG  G+ A  N+C KC   F         ++++I        
Sbjct  5    KETGCQAPPEAPKLCANNCGFFGSAATMNLCSKCHKDFIMKQEQVKLAASSIGSIVNGGP  64

Query  256  PRSGFRRLSPERTSPDLKRRED--RTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRR  429
               G  + +   TSP     E    ++   + +               K   NRCS CR+
Sbjct  65   NDHG--KKAAVVTSPTKLEIEPAVSSIIPTQPSWTSPNASSSTNIEKVKASPNRCSSCRK  122

Query  430  KVGLTGFRCRCGELFC  477
            +VGLTGF CRCG LFC
Sbjct  123  RVGLTGFNCRCGSLFC  138



>ref|XP_010913090.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Elaeis guineensis]
Length=145

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 61/127 (48%), Gaps = 29/127 (23%)
 Frame = +1

Query  127  CVNNCGVTGNPAANNMCQKCFsattaaagsssaaIHHKFGEKQPRSGFRRLSPERT----  294
            C NNCG  G+PA  N+C KC+               H F  K+ ++   +++ E++    
Sbjct  14   CANNCGFFGSPATLNLCSKCY---------------HNFRLKEDQATSAKIAVEKSLSTT  58

Query  295  ------SPDLKRREDRTVARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRC  456
                   P +       V R    +    EE++ +    +R  NRC+ C++++GLTGFRC
Sbjct  59   ATTVVPPPTIMLAAADPVVRTLGGIASPTEEKQQQ----ERRSNRCAACQKRMGLTGFRC  114

Query  457  RCGELFC  477
            RCGE +C
Sbjct  115  RCGETYC  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567171140730