BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF049M02

Length=645
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       256   1e-78   Nicotiana tomentosiformis
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       254   4e-78   Nicotiana sylvestris
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    250   1e-76   Nicotiana tomentosiformis
gb|KDO54650.1|  hypothetical protein CISIN_1g0100251mg                  246   2e-76   Citrus sinensis [apfelsine]
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    250   2e-76   Nicotiana tomentosiformis
emb|CDP11780.1|  unnamed protein product                                249   6e-76   Coffea canephora [robusta coffee]
emb|CDP11782.1|  unnamed protein product                                247   4e-75   Coffea canephora [robusta coffee]
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       246   1e-74   Solanum tuberosum [potatoes]
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             246   1e-74   Citrus clementina [clementine]
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12            244   5e-74   Solanum lycopersicum
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12            244   5e-74   Solanum lycopersicum
ref|XP_010278703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    240   8e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    240   2e-72   Nelumbo nucifera [Indian lotus]
emb|CDY19294.1|  BnaC01g31860D                                          239   5e-72   Brassica napus [oilseed rape]
emb|CDY39494.1|  BnaA01g24940D                                          239   6e-72   Brassica napus [oilseed rape]
ref|XP_003605914.1|  Transparent testa 12 protein                       238   1e-71   Medicago truncatula
emb|CDY19295.1|  BnaC01g31850D                                          231   1e-71   Brassica napus [oilseed rape]
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                    237   2e-71   Arabis alpina [alpine rockcress]
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12            235   9e-71   Glycine max [soybeans]
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    235   1e-70   Pyrus x bretschneideri [bai li]
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    235   1e-70   Pyrus x bretschneideri [bai li]
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       235   2e-70   Brassica rapa
emb|CDY38631.1|  BnaA05g19560D                                          235   2e-70   Brassica napus [oilseed rape]
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    234   2e-70   Cicer arietinum [garbanzo]
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       234   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       234   2e-70   Brassica rapa
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12            234   2e-70   Tarenaya hassleriana [spider flower]
ref|XP_006375529.1|  hypothetical protein POPTR_0014s15140g             229   3e-70   
emb|CDY69153.1|  BnaAnng29470D                                          228   3e-70   Brassica napus [oilseed rape]
ref|XP_008342001.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       229   3e-70   
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                    234   4e-70   Arabis alpina [alpine rockcress]
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       234   4e-70   
ref|XP_006406243.1|  hypothetical protein EUTSA_v10020526mg             231   2e-69   
ref|XP_008379931.1|  PREDICTED: protein TRANSPARENT TESTA 12            229   3e-69   
ref|XP_007045634.1|  MATE efflux family protein isoform 2               229   4e-69   
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg             231   4e-69   Eutrema salsugineum [saltwater cress]
gb|KEH39009.1|  MATE efflux family protein                              228   2e-68   Medicago truncatula
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                            229   2e-68   Glycine soja [wild soybean]
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       229   3e-68   Cicer arietinum [garbanzo]
ref|XP_002883313.1|  mate efflux family protein                         229   3e-68   
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       228   4e-68   Brassica rapa
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       228   5e-68   
emb|CDP17486.1|  unnamed protein product                                228   5e-68   Coffea canephora [robusta coffee]
emb|CDY33129.1|  BnaCnng07000D                                          228   5e-68   Brassica napus [oilseed rape]
ref|XP_003596992.1|  Transparent testa 12 protein                       228   7e-68   Medicago truncatula
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12            228   7e-68   Vitis vinifera
ref|XP_007045633.1|  MATE efflux family protein isoform 1               228   8e-68   
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       227   1e-67   Cucumis sativus [cucumbers]
emb|CBI28937.3|  unnamed protein product                                228   2e-67   Vitis vinifera
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       227   2e-67   Prunus mume [ume]
emb|CAN69305.1|  hypothetical protein VITISV_021605                     221   2e-67   Vitis vinifera
emb|CDY24250.1|  BnaC03g42230D                                          221   3e-67   Brassica napus [oilseed rape]
emb|CBI28939.3|  unnamed protein product                                222   3e-67   Vitis vinifera
dbj|BAJ34540.1|  unnamed protein product                                226   4e-67   Eutrema halophilum
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            226   5e-67   Nelumbo nucifera [Indian lotus]
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                            226   5e-67   Glycine soja [wild soybean]
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       225   7e-67   Glycine max [soybeans]
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       225   8e-67   Camelina sativa [gold-of-pleasure]
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg             225   1e-66   
ref|XP_010930078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    224   1e-66   Elaeis guineensis
emb|CDY65669.1|  BnaCnng48120D                                          224   2e-66   Brassica napus [oilseed rape]
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       224   2e-66   Cucumis melo [Oriental melon]
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       224   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       224   3e-66   Cicer arietinum [garbanzo]
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    224   3e-66   Elaeis guineensis
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                    223   6e-66   Arabis alpina [alpine rockcress]
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       223   6e-66   Brassica rapa
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       223   7e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12            223   7e-66   Phoenix dactylifera
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       223   8e-66   Elaeis guineensis
emb|CDX92916.1|  BnaA03g36380D                                          222   9e-66   
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       222   1e-65   Elaeis guineensis
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12            222   1e-65   
emb|CDY39493.1|  BnaA01g24950D                                          221   2e-65   Brassica napus [oilseed rape]
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       221   2e-65   Brassica rapa
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12            221   3e-65   Vitis vinifera
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       221   3e-65   Elaeis guineensis
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       220   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       221   4e-65   
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein              221   4e-65   Gossypium arboreum [tree cotton]
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    221   4e-65   Vitis vinifera
gb|KGN43522.1|  Mate efflux family protein                              220   5e-65   Cucumis sativus [cucumbers]
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       220   5e-65   
gb|KJB30571.1|  hypothetical protein B456_005G149900                    219   1e-64   Gossypium raimondii
ref|NP_188806.1|  MATE efflux family protein                            219   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg             219   1e-64   Capsella rubella
gb|AAM20595.1|  integral membrane protein, putative                     219   1e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12            219   2e-64   
gb|KDO75455.1|  hypothetical protein CISIN_1g010798mg                   217   3e-64   Citrus sinensis [apfelsine]
tpg|DAA50098.1|  TPA: putative MATE efflux family protein               216   3e-64   
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       218   4e-64   Elaeis guineensis
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    218   4e-64   Cicer arietinum [garbanzo]
gb|KDO75454.1|  hypothetical protein CISIN_1g010798mg                   216   5e-64   Citrus sinensis [apfelsine]
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g             218   5e-64   Phaseolus vulgaris [French bean]
gb|KGN43524.1|  hypothetical protein Csa_7G043660                       217   7e-64   Cucumis sativus [cucumbers]
gb|ACF85423.1|  unknown                                                 217   9e-64   Zea mays [maize]
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       217   9e-64   Prunus mume [ume]
gb|AGT17221.1|  transparent testa 12 protein                            217   1e-63   Saccharum hybrid cultivar R570
ref|NP_001149176.1|  transparent testa 12 protein                       217   1e-63   Zea mays [maize]
gb|ACZ55931.1|  MATE transporter 2                                      216   2e-63   Zea mays [maize]
gb|KGN43526.1|  hypothetical protein Csa_7G043680                       216   2e-63   Cucumis sativus [cucumbers]
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       216   3e-63   Setaria italica
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                   216   3e-63   Citrus sinensis [apfelsine]
ref|NP_001050524.1|  Os03g0572900                                       215   3e-63   
gb|ABF97220.1|  MATE efflux family protein, expressed                   215   3e-63   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75610.1|  hypothetical protein OsI_12322                          215   3e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       215   4e-63   
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg             215   4e-63   Citrus clementina [clementine]
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g             215   5e-63   
tpg|DAA50100.1|  TPA: putative MATE efflux family protein               215   6e-63   
gb|ACZ55932.1|  MATE transporter 2                                      215   6e-63   Zea mays [maize]
tpg|DAA50097.1|  TPA: putative MATE efflux family protein               204   7e-63   
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       214   9e-63   Cucumis melo [Oriental melon]
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...    215   9e-63   Zea mays [maize]
ref|NP_001148084.1|  transparent testa 12 protein                       214   1e-62   Zea mays [maize]
emb|CDM85992.1|  unnamed protein product                                214   1e-62   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g             214   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       213   2e-62   Populus euphratica
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g             213   2e-62   Populus trichocarpa [western balsam poplar]
gb|KDP20755.1|  hypothetical protein JCGZ_21226                         209   3e-62   Jatropha curcas
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       212   6e-62   Citrus sinensis [apfelsine]
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       212   8e-62   
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       212   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC75606.1|  hypothetical protein OsI_12318                          211   2e-61   Oryza sativa Indica Group [Indian rice]
gb|AAS01962.1|  putative MATE efflux family protein                     212   2e-61   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97209.1|  MATE efflux family protein, expressed                   211   2e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       211   2e-61   Setaria italica
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    211   2e-61   Populus euphratica
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       210   3e-61   Populus euphratica
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       210   4e-61   Cucumis melo [Oriental melon]
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                       210   4e-61   
gb|KJB57729.1|  hypothetical protein B456_009G178100                    206   4e-61   Gossypium raimondii
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       210   4e-61   Cucumis sativus [cucumbers]
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       210   5e-61   Cucumis melo [Oriental melon]
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       209   8e-61   Brachypodium distachyon [annual false brome]
ref|XP_004173828.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       204   9e-61   
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       209   1e-60   Fragaria vesca subsp. vesca
ref|XP_006389634.1|  hypothetical protein POPTR_0021s00830g             207   2e-60   
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g             208   2e-60   
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       207   4e-60   
gb|KJB57730.1|  hypothetical protein B456_009G178100                    207   5e-60   Gossypium raimondii
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    207   5e-60   Brachypodium distachyon [annual false brome]
ref|XP_011048000.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    207   5e-60   Populus euphratica
gb|KJB57728.1|  hypothetical protein B456_009G178100                    207   6e-60   Gossypium raimondii
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                            206   7e-60   
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    207   1e-59   Populus euphratica
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g             206   1e-59   Phaseolus vulgaris [French bean]
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       206   1e-59   Zea mays [maize]
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein              206   2e-59   Gossypium arboreum [tree cotton]
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                            206   2e-59   Triticum urartu
emb|CDM86677.1|  unnamed protein product                                205   2e-59   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg             205   4e-59   Citrus clementina [clementine]
gb|KCW76957.1|  hypothetical protein EUGRSUZ_D01316                     203   6e-59   Eucalyptus grandis [rose gum]
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       204   1e-58   Sesamum indicum [beniseed]
gb|KGN64598.1|  hypothetical protein Csa_1G071120                       203   1e-58   Cucumis sativus [cucumbers]
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       204   1e-58   Eucalyptus grandis [rose gum]
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100          203   1e-58   Sorghum bicolor [broomcorn]
gb|KDP20756.1|  hypothetical protein JCGZ_21227                         209   2e-58   Jatropha curcas
gb|KJB69294.1|  hypothetical protein B456_011G014800                    203   2e-58   Gossypium raimondii
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       203   2e-58   Zea mays [maize]
gb|KJB69293.1|  hypothetical protein B456_011G014800                    203   3e-58   Gossypium raimondii
emb|CDM86696.1|  unnamed protein product                                202   4e-58   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007026057.1|  MATE efflux family protein                         202   5e-58   
emb|CDM86692.1|  unnamed protein product                                201   6e-58   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg             201   7e-58   
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       202   7e-58   Sesamum indicum [beniseed]
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       202   7e-58   Fragaria vesca subsp. vesca
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       201   1e-57   Eucalyptus grandis [rose gum]
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                       201   1e-57   Morus notabilis
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg                201   1e-57   Erythranthe guttata [common monkey flower]
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12            201   1e-57   Nelumbo nucifera [Indian lotus]
ref|XP_009618512.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    198   2e-57   Nicotiana tomentosiformis
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       200   2e-57   Solanum tuberosum [potatoes]
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg                200   3e-57   Erythranthe guttata [common monkey flower]
gb|EPS61219.1|  hypothetical protein M569_13580                         190   3e-57   Genlisea aurea
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       200   3e-57   Nicotiana sylvestris
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       200   3e-57   Populus euphratica
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       200   3e-57   Solanum lycopersicum
ref|XP_009618511.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    198   4e-57   Nicotiana tomentosiformis
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2    199   6e-57   
ref|XP_007026054.1|  MATE efflux family protein isoform 1               199   6e-57   
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg                199   9e-57   Erythranthe guttata [common monkey flower]
emb|CDM86687.1|  unnamed protein product                                198   9e-57   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g             199   1e-56   Populus trichocarpa [western balsam poplar]
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       198   2e-56   Glycine max [soybeans]
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                            198   2e-56   Glycine soja [wild soybean]
dbj|BAF47751.1|  multi antimicrobial extrusion family protein           197   2e-56   Nicotiana tabacum [American tobacco]
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       197   2e-56   Nicotiana sylvestris
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       197   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS67796.1|  hypothetical protein M569_06975                         197   3e-56   Genlisea aurea
ref|XP_011048008.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    197   3e-56   Populus euphratica
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       197   3e-56   Prunus mume [ume]
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       195   4e-56   
gb|EMT19998.1|  hypothetical protein F775_52364                         201   4e-56   
ref|XP_002518493.1|  multidrug resistance pump, putative                197   4e-56   Ricinus communis
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    197   5e-56   Populus euphratica
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    196   6e-56   Populus euphratica
ref|XP_006389638.1|  MATE efflux family protein                         196   7e-56   
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       196   9e-56   Nicotiana tomentosiformis
ref|XP_006348109.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    194   9e-56   Solanum tuberosum [potatoes]
ref|XP_002518495.1|  multidrug resistance pump, putative                196   1e-55   Ricinus communis
gb|ABK24492.1|  unknown                                                 196   1e-55   Picea sitchensis
emb|CDY33130.1|  BnaCnng07010D                                          190   2e-55   Brassica napus [oilseed rape]
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12            195   2e-55   Vitis vinifera
gb|KDP20757.1|  hypothetical protein JCGZ_21228                         190   2e-55   Jatropha curcas
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    195   2e-55   
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       194   4e-55   Populus euphratica
ref|XP_009614258.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    192   4e-55   
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    194   4e-55   Tarenaya hassleriana [spider flower]
ref|XP_006467446.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    194   4e-55   Citrus sinensis [apfelsine]
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    194   7e-55   Nicotiana sylvestris
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       193   8e-55   Oryza brachyantha
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       194   8e-55   
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    193   8e-55   Solanum tuberosum [potatoes]
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       193   8e-55   Populus euphratica
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    193   8e-55   Solanum tuberosum [potatoes]
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       193   9e-55   Solanum lycopersicum
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       193   1e-54   Solanum tuberosum [potatoes]
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                   193   1e-54   Citrus sinensis [apfelsine]
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    193   1e-54   Citrus sinensis [apfelsine]
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg                193   2e-54   Erythranthe guttata [common monkey flower]
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    192   3e-54   Pyrus x bretschneideri [bai li]
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    192   3e-54   Pyrus x bretschneideri [bai li]
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    192   3e-54   Nicotiana tomentosiformis
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       191   4e-54   Solanum lycopersicum
ref|XP_010533821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    187   4e-54   Tarenaya hassleriana [spider flower]
ref|XP_010533819.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    187   5e-54   Tarenaya hassleriana [spider flower]
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       191   5e-54   
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       191   5e-54   Populus euphratica
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg                191   5e-54   Erythranthe guttata [common monkey flower]
ref|XP_010533820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    186   6e-54   Tarenaya hassleriana [spider flower]
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       191   7e-54   Pyrus x bretschneideri [bai li]
ref|XP_010533818.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    186   8e-54   Tarenaya hassleriana [spider flower]
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    191   1e-53   Nicotiana tomentosiformis
ref|XP_008371177.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       186   1e-53   
ref|XP_008371097.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       186   1e-53   
ref|XP_010533817.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    186   1e-53   
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg             189   2e-53   
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       190   2e-53   Nicotiana sylvestris
gb|ADE77677.1|  unknown                                                 190   2e-53   Picea sitchensis
gb|KDO78210.1|  hypothetical protein CISIN_1g043801mg                   181   3e-53   Citrus sinensis [apfelsine]
gb|EEC75604.1|  hypothetical protein OsI_12313                          189   4e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_002518492.1|  multidrug resistance pump, putative                189   4e-53   Ricinus communis
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       189   5e-53   Prunus mume [ume]
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g             188   7e-53   Populus trichocarpa [western balsam poplar]
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg             188   1e-52   Prunus persica
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140          187   2e-52   Sorghum bicolor [broomcorn]
ref|NP_001147791.1|  transparent testa 12 protein                       187   2e-52   Zea mays [maize]
gb|AGT17223.1|  MATE efflux family protein                              187   2e-52   Saccharum hybrid cultivar R570
ref|NP_001050520.1|  Os03g0570800                                       187   2e-52   
ref|XP_008371179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       182   3e-52   
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       186   4e-52   
tpg|DAA62913.1|  TPA: putative MATE efflux family protein               188   5e-52   
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12            186   6e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       186   6e-52   Vitis vinifera
gb|KDP20759.1|  hypothetical protein JCGZ_21230                         181   6e-52   Jatropha curcas
gb|AHI48506.1|  multidrug and toxic extrusion transporter               186   9e-52   Vaccinium corymbosum [American blueberry]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       185   2e-51   Prunus mume [ume]
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       184   2e-51   Nicotiana sylvestris
emb|CDP04391.1|  unnamed protein product                                184   3e-51   Coffea canephora [robusta coffee]
ref|NP_001142368.1|  uncharacterized protein LOC100274540               183   3e-51   Zea mays [maize]
gb|AAS01961.1|  putative MatE domain containing protein, 3'-partial     177   3e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12            183   5e-51   Vitis vinifera
ref|XP_007026056.1|  MATE efflux family protein                         183   6e-51   
gb|KEH36840.1|  MATE efflux family protein                              182   8e-51   Medicago truncatula
ref|XP_008364095.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    183   8e-51   
ref|XP_008364096.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    182   9e-51   
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    182   1e-50   
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    182   1e-50   
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    182   1e-50   
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    182   2e-50   
emb|CDP11781.1|  unnamed protein product                                177   3e-49   Coffea canephora [robusta coffee]
ref|XP_009362007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    177   4e-49   
gb|EAY90719.1|  hypothetical protein OsI_12317                          175   6e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    177   7e-49   
tpg|DAA40987.1|  TPA: putative MATE efflux family protein               177   1e-48   
ref|XP_009345548.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    175   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_011100216.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    175   2e-48   
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    176   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    176   3e-48   
gb|EMT03955.1|  Protein TRANSPARENT TESTA 12                            177   3e-48   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   6e-48   
ref|XP_002892653.1|  mate efflux family protein                         175   6e-48   
gb|AAM98160.1|  unknown protein                                         175   6e-48   
ref|NP_172632.1|  MATE efflux family protein                            175   7e-48   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                            174   8e-48   
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg             174   9e-48   
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    174   9e-48   
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg             174   1e-47   
emb|CDY64933.1|  BnaCnng45550D                                          174   1e-47   
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    174   1e-47   
emb|CDY64820.1|  BnaA08g31640D                                          174   1e-47   
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   2e-47   
tpg|DAA40993.1|  TPA: putative MATE efflux family protein               172   2e-47   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg             173   3e-47   
dbj|BAJ90668.1|  predicted protein                                      172   4e-47   
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                    172   7e-47   
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   7e-47   
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12            172   8e-47   
emb|CDY34637.1|  BnaC08g41960D                                          171   1e-46   
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1      171   1e-46   
tpg|DAA40990.1|  TPA: putative MATE efflux family protein               171   2e-46   
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   2e-46   
ref|XP_008667480.1|  PREDICTED: putative MATE efflux family prote...    171   3e-46   
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   3e-46   
emb|CDY34833.1|  BnaA09g47590D                                          169   7e-46   
gb|KDP20758.1|  hypothetical protein JCGZ_21229                         169   8e-46   
ref|NP_564787.1|  MATE efflux family protein                            169   8e-46   
ref|XP_002886501.1|  mate efflux family protein                         169   8e-46   
emb|CAN60226.1|  hypothetical protein VITISV_039920                     169   9e-46   
gb|AAK82541.1|  At1g61890/F8K4_9                                        169   9e-46   
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   9e-46   
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   1e-45   
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   2e-45   
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720          167   7e-45   
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg             167   7e-45   
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   7e-45   
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   8e-45   
emb|CDY25329.1|  BnaC01g29980D                                          166   8e-45   
emb|CDY47166.1|  BnaA01g22920D                                          166   8e-45   
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   2e-44   
emb|CDY12916.1|  BnaA09g13580D                                          165   2e-44   
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   2e-44   
emb|CDY19507.1|  BnaC09g13960D                                          165   2e-44   
ref|XP_006391951.1|  hypothetical protein EUTSA_v10023417mg             164   4e-44   
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                    164   5e-44   
emb|CBI28938.3|  unnamed protein product                                163   6e-44   
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg             164   1e-43   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120          161   8e-43   
emb|CDX94061.1|  BnaC07g36950D                                          160   1e-42   
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                            159   2e-42   
gb|AGT17222.1|  MATE efflux family protein                              159   3e-42   
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   2e-41   
emb|CDX98711.1|  BnaA03g44960D                                          157   2e-41   
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   3e-41   
emb|CDX94063.1|  BnaC07g36970D                                          155   8e-41   
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   1e-40   
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   2e-40   
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg             155   2e-40   
emb|CDX98712.1|  BnaA03g44970D                                          154   2e-40   
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                            154   3e-40   
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   3e-40   
emb|CBI23252.3|  unnamed protein product                                149   4e-40   
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   6e-40   
ref|XP_010439401.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   6e-40   
emb|CDX76391.1|  BnaA08g10090D                                          153   7e-40   
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    152   1e-39   
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    152   2e-39   
emb|CDY27434.1|  BnaC03g64740D                                          152   2e-39   
emb|CBI23251.3|  unnamed protein product                                149   6e-39   
dbj|BAC56017.1|  putative ripening regulated protein DDTFR18            150   7e-39   
gb|EEC82143.1|  hypothetical protein OsI_26198                          150   7e-39   
ref|NP_001059785.1|  Os07g0516600                                       150   8e-39   
ref|XP_002867814.1|  mate efflux family protein                         149   2e-38   
ref|XP_008646561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   2e-38   
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   2e-38   
emb|CDY27431.1|  BnaC03g64710D                                          149   3e-38   
emb|CDX98713.1|  BnaA03g44980D                                          148   3e-38   
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg             148   3e-38   
emb|CDX79109.1|  BnaA01g11760D                                          148   4e-38   
emb|CDP04390.1|  unnamed protein product                                147   4e-38   
emb|CDX76392.1|  BnaA08g10080D                                          147   5e-38   
emb|CAA17158.1|  putative protein                                       148   6e-38   
dbj|BAH19969.1|  AT4G21910                                              147   6e-38   
ref|NP_974587.1|  MATE efflux family protein                            147   6e-38   
ref|XP_009353369.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       139   8e-38   
ref|NP_001190793.1|  MATE efflux family protein                         147   8e-38   
ref|XP_002867813.1|  mate efflux family protein                         147   1e-37   
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   1e-37   
emb|CDP20703.1|  unnamed protein product                                145   3e-37   
gb|EMS54427.1|  Protein TRANSPARENT TESTA 12                            147   5e-37   
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg             144   9e-37   
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg             144   1e-36   
ref|NP_567640.1|  MATE efflux family protein                            143   2e-36   
gb|AAM62936.1|  unknown                                                 143   3e-36   
emb|CDY07256.1|  BnaC04g19150D                                          134   4e-36   
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg             142   5e-36   
emb|CDP11775.1|  unnamed protein product                                139   1e-35   
emb|CBI23254.3|  unnamed protein product                                137   2e-34   
gb|AAL06936.1|  AT5g38030/F16F17_30                                     132   2e-33   
ref|XP_006836338.1|  hypothetical protein AMTR_s00092p00085880          134   2e-33   
gb|KDP35980.1|  hypothetical protein JCGZ_08375                         132   1e-32   
ref|NP_198619.1|  MATE efflux family protein                            132   2e-32   
ref|XP_002868811.1|  mate efflux family protein                         132   3e-32   
ref|XP_004299689.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       132   3e-32   
ref|XP_010026078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       131   5e-32   
ref|XP_006292391.1|  hypothetical protein CARUB_v10018603mg             131   5e-32   
ref|NP_001119025.1|  mate efflux domain-containing protein              130   7e-32   
ref|NP_001190792.1|  mate efflux domain-containing protein              130   7e-32   
ref|XP_009791264.1|  PREDICTED: protein TRANSPARENT TESTA 12            130   8e-32   
ref|XP_010275892.1|  PREDICTED: protein TRANSPARENT TESTA 12            130   9e-32   
ref|NP_191462.1|  protein TRANSPARENT TESTA 12                          130   1e-31   
ref|XP_010502591.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    129   1e-31   
ref|XP_010425356.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       130   1e-31   
ref|XP_010512133.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       130   1e-31   
gb|KFK35144.1|  hypothetical protein AALP_AA5G243900                    129   2e-31   
ref|XP_006402730.1|  hypothetical protein EUTSA_v10005907mg             129   2e-31   
ref|XP_010502590.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    129   3e-31   
ref|XP_002876486.1|  hypothetical protein ARALYDRAFT_907401             129   3e-31   
ref|XP_006290950.1|  hypothetical protein CARUB_v10017066mg             129   4e-31   
emb|CDX67772.1|  BnaA07g18120D                                          128   4e-31   
ref|XP_010554152.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       128   5e-31   
gb|KFK33585.1|  hypothetical protein AALP_AA5G032800                    128   6e-31   
ref|XP_006852302.1|  hypothetical protein AMTR_s00049p00190590          125   6e-31   
ref|XP_006417171.1|  hypothetical protein EUTSA_v10007376mg             128   7e-31   
ref|XP_010514303.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       127   7e-31   
ref|XP_009152044.1|  PREDICTED: protein TRANSPARENT TESTA 12            127   8e-31   
emb|CDY13643.1|  BnaA06g32800D                                          127   8e-31   
ref|XP_006395543.1|  hypothetical protein EUTSA_v10005286mg             127   8e-31   
ref|XP_009591643.1|  PREDICTED: protein TRANSPARENT TESTA 12            127   9e-31   
ref|XP_010528103.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       127   1e-30   
ref|XP_004250128.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       127   1e-30   
ref|XP_010504879.1|  PREDICTED: protein TRANSPARENT TESTA 12            127   1e-30   
ref|XP_010504878.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       127   1e-30   
gb|ACJ36215.1|  transparent testa 12                                    127   1e-30   
ref|XP_009373462.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       127   1e-30   
gb|KJB64207.1|  hypothetical protein B456_010G037100                    127   1e-30   
gb|KFK32791.1|  hypothetical protein AALP_AA6G288700                    127   1e-30   
ref|XP_010250482.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    127   1e-30   
gb|ACJ36211.1|  transparent testa 12 isoform 2                          127   1e-30   
ref|XP_009398326.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       127   1e-30   
ref|XP_010250481.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    127   1e-30   
ref|XP_009104180.1|  PREDICTED: protein TRANSPARENT TESTA 12            127   2e-30   
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       126   2e-30   
ref|XP_006426305.1|  hypothetical protein CICLE_v10025480mg             124   2e-30   
ref|XP_009759747.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    124   2e-30   
gb|KDO60642.1|  hypothetical protein CISIN_1g011371mg                   124   2e-30   
emb|CDX83627.1|  BnaC07g23670D                                          126   2e-30   
ref|XP_009759746.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    124   3e-30   
gb|AHH83753.1|  multidrug and toxic extrusion transporter               126   3e-30   
ref|XP_010681039.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       126   3e-30   
ref|XP_010556333.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       126   3e-30   
ref|XP_010100396.1|  Protein TRANSPARENT TESTA 12                       126   3e-30   
ref|XP_006306102.1|  hypothetical protein CARUB_v10011529mg             126   3e-30   
ref|XP_008221919.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       126   3e-30   
gb|ACU15197.1|  unknown                                                 121   4e-30   
ref|XP_010476276.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       125   4e-30   
ref|XP_006353193.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       125   4e-30   
ref|XP_009759744.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    124   4e-30   
ref|XP_010106306.1|  Protein TRANSPARENT TESTA 12                       125   4e-30   
ref|XP_010524117.1|  PREDICTED: protein TRANSPARENT TESTA 12            125   5e-30   
ref|XP_010999529.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       125   5e-30   
gb|AIW42903.1|  transparent testa 12                                    125   6e-30   
ref|NP_172755.1|  root hair specific 2                                  125   7e-30   
ref|XP_009409170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       125   8e-30   
dbj|BAE99795.1|  hypothetical protein                                   125   8e-30   
ref|XP_009599386.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       124   9e-30   
ref|XP_010681038.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       125   9e-30   
ref|XP_006394040.1|  hypothetical protein EUTSA_v100040871mg            120   9e-30   
gb|KDO60639.1|  hypothetical protein CISIN_1g011371mg                   124   9e-30   
ref|XP_004501679.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       124   9e-30   
emb|CBI19217.3|  unnamed protein product                                125   9e-30   
gb|KDO60638.1|  hypothetical protein CISIN_1g011371mg                   124   9e-30   
ref|XP_002285728.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       124   9e-30   
ref|XP_006426307.1|  hypothetical protein CICLE_v10025480mg             124   1e-29   
ref|XP_010458735.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       124   1e-29   
ref|XP_010494806.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       124   1e-29   
gb|KDO60641.1|  hypothetical protein CISIN_1g011371mg                   124   1e-29   
ref|XP_006426304.1|  hypothetical protein CICLE_v10025480mg             124   1e-29   
gb|KFK43564.1|  hypothetical protein AALP_AA1G142600                    124   1e-29   
gb|KDO60640.1|  hypothetical protein CISIN_1g011371mg                   124   1e-29   
ref|XP_008779773.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       122   1e-29   
gb|ACJ36209.1|  transparent testa 12 isoform 1                          124   1e-29   
ref|XP_006574630.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    121   2e-29   
gb|KHG03893.1|  Protein TRANSPARENT TESTA 12 -like protein              123   2e-29   
ref|XP_010100395.1|  Protein TRANSPARENT TESTA 12                       124   2e-29   
gb|ABK24651.1|  unknown                                                 124   2e-29   
ref|XP_009601126.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       122   2e-29   
ref|XP_009359346.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       124   2e-29   
emb|CDY26602.1|  BnaA09g46750D                                          124   2e-29   
ref|XP_010026089.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       123   2e-29   
emb|CDP01534.1|  unnamed protein product                                123   3e-29   
ref|XP_006466280.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       123   3e-29   
ref|NP_001067276.1|  Os12g0615700                                       123   3e-29   
ref|XP_002876984.1|  mate efflux family protein                         123   3e-29   
ref|XP_007222487.1|  hypothetical protein PRUPE_ppa004113mg             123   3e-29   
ref|XP_011032739.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       123   3e-29   
emb|CAA66405.1|  orf04                                                  123   3e-29   
gb|KFK43565.1|  hypothetical protein AALP_AA1G142700                    123   4e-29   
ref|XP_008340112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       123   4e-29   
ref|XP_011086623.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       123   4e-29   
ref|XP_008353026.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       123   4e-29   
gb|EAY83897.1|  hypothetical protein OsI_39119                          122   4e-29   
ref|XP_010060062.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       123   4e-29   
ref|XP_007224466.1|  hypothetical protein PRUPE_ppa022569mg             122   4e-29   
ref|XP_009629826.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       122   4e-29   
emb|CDY16041.1|  BnaC08g40820D                                          123   4e-29   
ref|XP_002516716.1|  multidrug resistance pump, putative                121   5e-29   
ref|XP_010646478.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    122   5e-29   
gb|AIW42905.1|  transparent testa 12                                    122   5e-29   
ref|NP_189291.1|  MATE efflux family protein                            122   5e-29   
ref|XP_010916697.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       122   5e-29   
ref|XP_009359227.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       122   5e-29   
gb|AHI48503.1|  multidrug and toxic extrusion transporter               122   5e-29   
ref|XP_009117173.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   5e-29   
emb|CAN64516.1|  hypothetical protein VITISV_023506                     122   5e-29   
ref|XP_009110609.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       122   6e-29   
ref|XP_002272214.2|  PREDICTED: protein TRANSPARENT TESTA 12-like...    122   6e-29   
gb|AFK46935.1|  unknown                                                 122   6e-29   
gb|EYU30642.1|  hypothetical protein MIMGU_mgv1a004692mg                122   6e-29   



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 163/189 (86%), Gaps = 4/189 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGIPRWQRLKLATWIEL  248
            MDSS    Y P  E++G  + SP   E+   E+SNELE++L+DT IP W +L+LATWIE+
Sbjct  1    MDSSKNNTYQPFLENNGTSNLSPQLSETHNFESSNELETVLLDTEIPFWSKLRLATWIEM  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAA  608
            VETLCGQAFGA K+++LG+YLQRST+LLTLTG+LL  +Y+F +PILIFLG++  I+SAAA
Sbjct  121  VETLCGQAFGAKKFDMLGVYLQRSTILLTLTGILLTFVYIFCKPILIFLGESERIASAAA  180

Query  609  LFVYGLIPK  635
            LFVYGLIP+
Sbjct  181  LFVYGLIPQ  189



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 164/189 (87%), Gaps = 4/189 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGIPRWQRLKLATWIEL  248
            MDSS    Y P  +++G  S SP   E+   E+SNELE++L+DT IP W +L+LATWIE+
Sbjct  1    MDSSKNNIYQPFLDNNGNSSLSPQFSETHNFESSNELETVLLDTEIPLWNKLRLATWIEM  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  61   KLLFHLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAA  608
            VETLCGQAFGA KY++LG+YLQRST+LLTLTG+LLA +Y+F +PILIFLG++  I+SAAA
Sbjct  121  VETLCGQAFGAKKYDMLGVYLQRSTILLTLTGILLAFVYIFCKPILIFLGESERIASAAA  180

Query  609  LFVYGLIPK  635
            LFVYGLIP+
Sbjct  181  LFVYGLIPQ  189



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 162/189 (86%), Gaps = 4/189 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGIPRWQRLKLATWIEL  248
            M SS      P  E++GV +  P     +  E+++ELE++L+DT +P W RL+LATWIE 
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLPLWSRLRLATWIET  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL+LGMGSA
Sbjct  61   KLLFFLAAPAVMVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLLLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAA  608
            VETLCGQA+GA KY++LG+YLQRST+LLTLTGVLL L+Y+F +PILIFLG++P+I+SAAA
Sbjct  121  VETLCGQAYGARKYDMLGVYLQRSTILLTLTGVLLTLVYIFCKPILIFLGESPEIASAAA  180

Query  609  LFVYGLIPK  635
            LFVYGLIP+
Sbjct  181  LFVYGLIPQ  189



>gb|KDO54650.1| hypothetical protein CISIN_1g0100251mg, partial [Citrus sinensis]
Length=351

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 160/193 (83%), Gaps = 8/193 (4%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLAT  236
            HH+   ++ S     + P P +  V+S  P E    SN ELE++L DT +  WQRL+ AT
Sbjct  12   HHIHQPLLQS-----HPPAPPA--VLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRAT  64

Query  237  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  416
            WIE KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLG
Sbjct  65   WIESKLLFHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLG  124

Query  417  MGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDIS  596
            MGSAVETLCGQA+GA KYE+LGIYLQRS VLLTLTG+L+ ++YVFS PILIFLG++PDI+
Sbjct  125  MGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLGESPDIA  184

Query  597  SAAALFVYGLIPK  635
            S+AA+FVYGLIP+
Sbjct  185  SSAAVFVYGLIPQ  197



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 162/189 (86%), Gaps = 4/189 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGIPRWQRLKLATWIEL  248
            M SS      P  E++GV +  P     +  E+++ELE++L+DT +P W RL+LATWIE 
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLPLWSRLRLATWIET  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL+LGMGSA
Sbjct  61   KLLFFLAAPAVMVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLLLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAA  608
            VETLCGQA+GA KY++LG+YLQRST+LLTLTGVLL L+Y+F +PILIFLG++P+I+SAAA
Sbjct  121  VETLCGQAYGARKYDMLGVYLQRSTILLTLTGVLLTLVYIFCKPILIFLGESPEIASAAA  180

Query  609  LFVYGLIPK  635
            LFVYGLIP+
Sbjct  181  LFVYGLIPQ  189



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   249 bits (635),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 155/185 (84%), Gaps = 9/185 (5%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDSS+  A  PL          P   ++ S ELE IL D   P  QR + ATWIE+KLL 
Sbjct  1    MDSSSVDASQPLL---------PRTNTQISKELEEILCDNEQPLLQRYRAATWIEMKLLF  51

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  52   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  111

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQAFGA KYE+LG+YLQRST+LL+LTGVLLA+IYVFS+PILIFLGQAPDI+SAAALFVY
Sbjct  112  CGQAFGAKKYEMLGVYLQRSTILLSLTGVLLAIIYVFSKPILIFLGQAPDIASAAALFVY  171

Query  621  GLIPK  635
            GLIP+
Sbjct  172  GLIPQ  176



>emb|CDP11782.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   247 bits (631),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 154/185 (83%), Gaps = 9/185 (5%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDSS+  A  PL          P   ++ S ELE IL D   P  QR + ATWIE+KLL 
Sbjct  1    MDSSSNDAGQPLL---------PRTNTQISKELEEILCDNEQPLLQRYRAATWIEMKLLF  51

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  52   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  111

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQAFGA K+E+LGIYLQRST+LL+LTGVLL +IYVFS+PILIFLGQ+PDI+SAAALFVY
Sbjct  112  CGQAFGAKKFEMLGIYLQRSTILLSLTGVLLTIIYVFSKPILIFLGQSPDIASAAALFVY  171

Query  621  GLIPK  635
            GLIP+
Sbjct  172  GLIPQ  176



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 158/188 (84%), Gaps = 3/188 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGIPRWQRLKLATWIELK  251
            M S     Y P  +++    SP   E+   E+SNELE++L+DT IP W +L+LATWIE+K
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEIPLWSKLRLATWIEMK  60

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
             L +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAV
Sbjct  61   FLFFLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAV  120

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAAL  611
            ETLCGQAFGA KY++LG+YLQRSTVLLTLTG+LL ++Y+F +PILIFLGQ   I++AAAL
Sbjct  121  ETLCGQAFGAKKYDMLGVYLQRSTVLLTLTGILLTIMYIFCKPILIFLGQTERIAAAAAL  180

Query  612  FVYGLIPK  635
            FVYGLIP+
Sbjct  181  FVYGLIPQ  188



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 160/193 (83%), Gaps = 8/193 (4%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLAT  236
            HH+   ++ S     + P P +  V+S  P E    SN ELE++L DT +  WQRL+ AT
Sbjct  12   HHIHQPLLQS-----HPPAPPA--VLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRAT  64

Query  237  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  416
            WIE KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLG
Sbjct  65   WIESKLLFHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLG  124

Query  417  MGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDIS  596
            MGSAVETLCGQA+GA KYE+LGIYLQRS VLLTLTG+L+ ++YVFS PILIFLG++PDI+
Sbjct  125  MGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLGESPDIA  184

Query  597  SAAALFVYGLIPK  635
            S+AA+FVYGLIP+
Sbjct  185  SSAAVFVYGLIPQ  197



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 158/188 (84%), Gaps = 3/188 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGIPRWQRLKLATWIELK  251
            M S     Y P  +++    SP   E+   E+SNELE++L+DT I  W +L+LATWIE+K
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEITLWSKLRLATWIEMK  60

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAV
Sbjct  61   LLFFLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAV  120

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAAL  611
            ETLCGQAFGA KY++LG+YLQRSTVLLTLTG+LL ++Y+F +PILIF+GQ   I++AAAL
Sbjct  121  ETLCGQAFGAKKYDMLGVYLQRSTVLLTLTGILLTIVYIFCKPILIFVGQTERIAAAAAL  180

Query  612  FVYGLIPK  635
            FVYGLIP+
Sbjct  181  FVYGLIPQ  188



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 155/179 (87%), Gaps = 5/179 (3%)
 Frame = +3

Query  114  LPESDGVVSSPPHEESEASN-----ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            +  S+  V+ P  E+S AS+     ELES+L+D  +PRW RL+ ATWIE+KLL  LAAPA
Sbjct  1    MASSENDVNQPFIEKSRASDSESSIELESVLLDHSLPRWNRLRQATWIEMKLLFSLAAPA  60

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V+VYMINYLMSMSTQIFSGH+GNLELAAASLGNTGIQIF YGLMLGMGSAVETLCGQA+G
Sbjct  61   VMVYMINYLMSMSTQIFSGHIGNLELAAASLGNTGIQIFVYGLMLGMGSAVETLCGQAYG  120

Query  459  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            A KY++LG+YLQRST+LL LTGVLL  +YVFS+PIL+FLGQ+P+I+SAAA+FVYGLIP+
Sbjct  121  ARKYDMLGVYLQRSTILLVLTGVLLTFVYVFSKPILLFLGQSPEIASAAAIFVYGLIPQ  179



>ref|XP_010278703.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nelumbo 
nucifera]
Length=484

 Score =   240 bits (612),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 157/189 (83%), Gaps = 4/189 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES----EASNELESILMDTGIPRWQRLKLATWIEL  248
            M++S      P+  S    +S   ++S    E S ELE IL D  +P ++R ++ATWIEL
Sbjct  1    METSGEELNQPILHSKSPAASISRQQSAAEQEWSKELEQILSDMQMPAFKRYRVATWIEL  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVIVYMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAA  608
            VETLCGQ++GAGKYE+LGIYLQRST+LL  TG+ LA+IY+ S+P+LIFLG++P+I+SAAA
Sbjct  121  VETLCGQSYGAGKYEMLGIYLQRSTILLMATGIPLAVIYILSKPLLIFLGESPEIASAAA  180

Query  609  LFVYGLIPK  635
            +FVYGLIP+
Sbjct  181  MFVYGLIPQ  189



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 157/189 (83%), Gaps = 4/189 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES----EASNELESILMDTGIPRWQRLKLATWIEL  248
            M++S      P+  S    +S   ++S    E S ELE IL D  +P ++R ++ATWIEL
Sbjct  1    METSGEELNQPILHSKSPAASISRQQSAAEQEWSKELEQILSDMQMPAFKRYRVATWIEL  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVIVYMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAA  608
            VETLCGQ++GAGKYE+LGIYLQRST+LL  TG+ LA+IY+ S+P+LIFLG++P+I+SAAA
Sbjct  121  VETLCGQSYGAGKYEMLGIYLQRSTILLMATGIPLAVIYILSKPLLIFLGESPEIASAAA  180

Query  609  LFVYGLIPK  635
            +FVYGLIP+
Sbjct  181  MFVYGLIPQ  189



>emb|CDY19294.1| BnaC01g31860D [Brassica napus]
Length=514

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 155/185 (84%), Gaps = 3/185 (2%)
 Frame = +3

Query  87   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            S N   Y PL  P+SDG V   P  ES ++ ELE +L D   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESKLLF  62

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQAFG  KYE+LGIYLQRSTVLLTLTGVLL LIYVFS+PIL+FLG++P+I+SAA++FVY
Sbjct  123  CGQAFGGRKYEMLGIYLQRSTVLLTLTGVLLTLIYVFSKPILLFLGESPEIASAASIFVY  182

Query  621  GLIPK  635
            GLIP+
Sbjct  183  GLIPQ  187



>emb|CDY39494.1| BnaA01g24940D [Brassica napus]
Length=514

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 155/185 (84%), Gaps = 3/185 (2%)
 Frame = +3

Query  87   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            S N   Y PL  P+SDG V   P  ES ++ ELE +L D   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESKLLF  62

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQAFG  KYE+LGIYLQRSTVLLTLTGVLL LIYVFS+PIL+FLG++P+I+SAA++FVY
Sbjct  123  CGQAFGGRKYEMLGIYLQRSTVLLTLTGVLLTLIYVFSKPILLFLGESPEIASAASIFVY  182

Query  621  GLIPK  635
            GLIP+
Sbjct  183  GLIPQ  187



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 150/171 (88%), Gaps = 3/171 (2%)
 Frame = +3

Query  132  VVSSPPHE---ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            ++SS  H    + E+  ELE IL DT +P  +R+KLATW+E KLL YLAAP+V+VY+INY
Sbjct  25   LLSSFTHSFGSKHESDGELERILSDTSVPFVKRIKLATWVEFKLLFYLAAPSVIVYLINY  84

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
            +MSMSTQIFSGHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLCGQAFGA KYE+LG
Sbjct  85   VMSMSTQIFSGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLCGQAFGAKKYEMLG  144

Query  483  IYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            IYLQRSTVLLT+ G++L +IY+FSEPILIFLG++P I+SAA+LFV+GLIP+
Sbjct  145  IYLQRSTVLLTIAGLILTIIYIFSEPILIFLGESPKIASAASLFVFGLIPQ  195



>emb|CDY19295.1| BnaC01g31850D [Brassica napus]
Length=304

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 154/188 (82%), Gaps = 4/188 (2%)
 Frame = +3

Query  81   MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS N   Y+ L  P+SDG V   P  ES  + ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQNDGLYEQLLHPQSDGTVPLSPSTESR-NGELERVLSDVETPLFHRLRKATMIESK  59

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINY+MSMSTQIF GHLGNLELAAASLGNTGI+ FAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYMMSMSTQIFPGHLGNLELAAASLGNTGIKTFAYGLMLGMGSAV  119

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAAL  611
            ETLCGQAFG  KYE+LGIYL+RSTVLLTL GVLL LIYVFS+PIL+FLG++P+I+SAA++
Sbjct  120  ETLCGQAFGGRKYEMLGIYLRRSTVLLTLAGVLLTLIYVFSKPILLFLGESPEIASAASI  179

Query  612  FVYGLIPK  635
            FVYGLIP+
Sbjct  180  FVYGLIPQ  187



>gb|KFK39487.1| hypothetical protein AALP_AA3G250500 [Arabis alpina]
Length=513

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 156/189 (83%), Gaps = 4/189 (2%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPH--EESEASN-ELESILMDTGIPRWQRLKLATWIEL  248
            MDSS N   Y PL    G  + PPH    +E++N ELE +L D   P + RL+ AT IE 
Sbjct  1    MDSSQNDGVYQPLLHPHGDATLPPHLPPSTESTNGELERVLSDVETPLFLRLRKATMIES  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAA  608
            VETLCGQA+G  KYE+LGIYLQRSTVLLTLTGV L LIYVFS+PIL+FLG++P+I+SAA+
Sbjct  121  VETLCGQAYGGRKYEMLGIYLQRSTVLLTLTGVFLTLIYVFSKPILLFLGESPEIASAAS  180

Query  609  LFVYGLIPK  635
            LFVYGLIP+
Sbjct  181  LFVYGLIPQ  189



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score =   235 bits (600),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = +3

Query  99   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            A  +PL  ++G  S+  HE S +  +LE IL D  +P   R+  ATWIELKLL +LAAPA
Sbjct  4    AEKEPLLTAEGTRSNSKHESS-SHGQLERILSDDTLPFLNRVGPATWIELKLLFFLAAPA  62

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V+VY+INYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  63   VIVYLINYLMSMSTQIFSGHLGNLELAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAFG  122

Query  459  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            A KY +LG+Y+QRST+LL+L GV+L +IYVFSEP+LIFLG++P I+SAAALFVYGLIP+
Sbjct  123  AQKYGMLGVYMQRSTILLSLAGVVLTVIYVFSEPMLIFLGESPRIASAAALFVYGLIPQ  181



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 153/194 (79%), Gaps = 6/194 (3%)
 Frame = +3

Query  54   PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P  QRLK A
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKPFSQRLKPA  57

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
             WIE KLL  LAAPA++VYMINY+MSMSTQIF GHLGNLELAA+SLGN GIQIFAYGL+L
Sbjct  58   LWIESKLLVVLAAPAIIVYMINYVMSMSTQIFCGHLGNLELAASSLGNNGIQIFAYGLLL  117

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDI  593
            GMGSAVETLCGQA+GA KYE+LGIYLQRS VLL   GVLL +IYVFSEPIL+ LG++P I
Sbjct  118  GMGSAVETLCGQAYGAQKYEMLGIYLQRSAVLLFFPGVLLTIIYVFSEPILLLLGESPSI  177

Query  594  SSAAALFVYGLIPK  635
            +S+AA++VYGLIP+
Sbjct  178  ASSAAVYVYGLIPQ  191



>ref|XP_009353270.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=512

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 153/194 (79%), Gaps = 6/194 (3%)
 Frame = +3

Query  54   PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P  QRLK A
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKPFSQRLKPA  57

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
             WIE KLL  LAAPA++VYMINY+MSMSTQIF GHLGNLELAA+SLGN GIQIFAYGL+L
Sbjct  58   LWIESKLLVVLAAPAIIVYMINYVMSMSTQIFCGHLGNLELAASSLGNNGIQIFAYGLLL  117

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDI  593
            GMGSAVETLCGQA+GA KYE+LGIYLQRS VLL   GVLL +IYVFSEPIL+ LG++P I
Sbjct  118  GMGSAVETLCGQAYGAQKYEMLGIYLQRSAVLLFFPGVLLTIIYVFSEPILLLLGESPSI  177

Query  594  SSAAALFVYGLIPK  635
            +S+AA++VYGLIP+
Sbjct  178  ASSAAVYVYGLIPQ  191



>ref|XP_009145463.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 156/188 (83%), Gaps = 4/188 (2%)
 Frame = +3

Query  81   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESK  59

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  119

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAAL  611
            ETLCGQAFG  KYE+LGIYLQRSTVLLTLTG+LL LIY+FS+PIL+FLG++P+I+SAA++
Sbjct  120  ETLCGQAFGGRKYEMLGIYLQRSTVLLTLTGLLLTLIYIFSKPILLFLGESPEIASAASI  179

Query  612  FVYGLIPK  635
            FVYGLIP+
Sbjct  180  FVYGLIPQ  187



>emb|CDY38631.1| BnaA05g19560D [Brassica napus]
Length=512

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 156/188 (83%), Gaps = 4/188 (2%)
 Frame = +3

Query  81   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESK  59

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  119

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAAL  611
            ETLCGQAFG  KYE+LGIYLQRSTVLLTLTG+LL LIY+FS+PIL+FLG++P+I+SAA++
Sbjct  120  ETLCGQAFGGRKYEMLGIYLQRSTVLLTLTGLLLTLIYIFSKPILLFLGESPEIASAASI  179

Query  612  FVYGLIPK  635
            FVYGLIP+
Sbjct  180  FVYGLIPQ  187



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 152/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPES-DGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MD    A  D  P+    + +     + E+  ELE IL DT +P  +R+ LATW+ELKLL
Sbjct  1    MDEPFLALNDSTPQQPSSIFTHSFGSKHESDGELERILSDTNVPFVKRIPLATWVELKLL  60

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
             YLAAPAV+VY+INY+MSMSTQIFSGHLG LELA ASLGNTGIQIFAYGLMLGMGSAVET
Sbjct  61   FYLAAPAVIVYLINYVMSMSTQIFSGHLGTLELAGASLGNTGIQIFAYGLMLGMGSAVET  120

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQAFGA KY++LGIYLQ+S+VLLTL G++L LIY+FS+PILIF+GQ+P I+SAAALFV
Sbjct  121  LCGQAFGAKKYDMLGIYLQKSSVLLTLAGLILTLIYIFSKPILIFIGQSPAIASAAALFV  180

Query  618  YGLIPK  635
            YGLIP+
Sbjct  181  YGLIPQ  186



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 158/186 (85%), Gaps = 5/186 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +S    SSP   ES ++ ELE++L D   P +QRL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQSQ---SSPSTTES-SNGELETVLSDVETPLFQRLRKATMIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQA+G  KYE+LG+YLQRSTVLLTLTG++L L+YVFSEPIL+FLG++P I+SAA+LFV
Sbjct  117  LCGQAYGGKKYEMLGVYLQRSTVLLTLTGLVLTLLYVFSEPILLFLGESPAIASAASLFV  176

Query  618  YGLIPK  635
            YGLIP+
Sbjct  177  YGLIPQ  182



>ref|XP_009109391.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 154/185 (83%), Gaps = 3/185 (2%)
 Frame = +3

Query  87   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            S N   Y PL  P+SDG V   P  ES ++ ELE +L +   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSNVETPLFHRLRKATMIESKLLF  62

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQAFG  KYE+LGIYLQRSTVLLTLTGVLL LIYVFS+PIL+FLG++P+I+SAA++FVY
Sbjct  123  CGQAFGGRKYEMLGIYLQRSTVLLTLTGVLLTLIYVFSKPILLFLGESPEIASAASIFVY  182

Query  621  GLIPK  635
            GLIP+
Sbjct  183  GLIPQ  187



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 152/185 (82%), Gaps = 8/185 (4%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESE-ASNELESILMDTGIPRWQRLKLATWIELKLLC  260
             S N A Y PL +       P    +E    ELE +L D   P  +R+  ATWIE KLL 
Sbjct  3    SSRNDAVYQPLLQ-------PVAAAAEYGGGELERVLTDAETPAMRRVGRATWIESKLLF  55

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  56   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETL  115

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQA+GAGK+E+LG+YLQRSTVLLTLTGV+L +IYVFS+PIL+FLG++P+I+SAAALFVY
Sbjct  116  CGQAYGAGKFEMLGVYLQRSTVLLTLTGVILTVIYVFSKPILLFLGESPEIASAAALFVY  175

Query  621  GLIPK  635
            GLIP+
Sbjct  176  GLIPQ  180



>ref|XP_006375529.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
 gb|ERP53326.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
Length=326

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = +3

Query  111  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P P S  +    P + + +S ELES+L DT +P ++RL+ ATWIE KLLC LAAPAVVVY
Sbjct  19   PSPFSSTI---KPKQSNHSSIELESVLSDTEMPYFKRLRRATWIESKLLCRLAAPAVVVY  75

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            MINYLMSMSTQIFSG LGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFGA KY
Sbjct  76   MINYLMSMSTQIFSGQLGNLELAAASLGNTGIQLFAYGLMLGMGSAVETLCGQAFGAHKY  135

Query  471  ELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             +LG+YLQRST+LL+LTG+LL +IY+F +PIL+ LG++ +I+SAAA+FVYGLIP+
Sbjct  136  GMLGLYLQRSTLLLSLTGILLTIIYIFCKPILVLLGESQEIASAAAVFVYGLIPQ  190



>emb|CDY69153.1| BnaAnng29470D [Brassica napus]
Length=317

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 151/186 (81%), Gaps = 6/186 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQAFG  KY++LGIYLQRS VLLTLTGV L  IYVFS+P L+FLG++P+I+SAA+LFV
Sbjct  116  LCGQAFGGRKYDMLGIYLQRSAVLLTLTGVFLTFIYVFSKPFLLFLGESPEIASAASLFV  175

Query  618  YGLIPK  635
            YGLIP+
Sbjct  176  YGLIPQ  181



>ref|XP_008342001.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=325

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 148/178 (83%), Gaps = 1/178 (1%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            +Y PLP +    S   H+E +AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  13   SYHPLPPTSTQSSKHSHDE-DASRELEQVLSDTDKPFSQRLKPALWIESKLLVILAAPAI  71

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            +VY+INY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYGL+LGMGSAVETLCGQA+GA
Sbjct  72   IVYVINYVMSMSTQIFSGHLGNLELAASSLGNNGIQMFAYGLLLGMGSAVETLCGQAYGA  131

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             KYE+LGIYLQRSTVLL   GVLL +IY+FSEPIL+ LG++P I+S+AA++VYGLIP+
Sbjct  132  QKYEMLGIYLQRSTVLLFFPGVLLTIIYIFSEPILLLLGESPSIASSAAVYVYGLIPQ  189



>gb|KFK39486.1| hypothetical protein AALP_AA3G250400 [Arabis alpina]
Length=508

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 152/186 (82%), Gaps = 3/186 (2%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   Y P  +  G  + P  E S    ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDDFYQPFLQPLGDETVPSTESS--IGELERVLSDVETPLFLRLRKATMIESKLL  58

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAVVVYMINY MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  59   FNLAAPAVVVYMINYFMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  118

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQAFG GKYE+LGIYLQRSTVLL+LTGVLL +IYVFSEPIL+FLG++P+I+SAAALFV
Sbjct  119  LCGQAFGGGKYEMLGIYLQRSTVLLSLTGVLLTVIYVFSEPILLFLGESPEIASAAALFV  178

Query  618  YGLIPK  635
            YGLIP+
Sbjct  179  YGLIPQ  184



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score =   234 bits (596),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 158/188 (84%), Gaps = 5/188 (3%)
 Frame = +3

Query  75   SVMDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            S MDSS N  AY PL +     SSP   ES ++ ELE++L D   P +QRL+ AT IE K
Sbjct  10   SAMDSSRNDGAYQPLLQPQ---SSPSTTES-SNGELETVLSDVETPLFQRLRKATMIESK  65

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAV
Sbjct  66   LLFNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAV  125

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAAL  611
            ETLCGQA+G  KYE+LGIYLQRSTVLLTLTG++L L+YVFSEPIL+FLG++P I+SAA+L
Sbjct  126  ETLCGQAYGGRKYEMLGIYLQRSTVLLTLTGLVLTLLYVFSEPILLFLGESPAIASAASL  185

Query  612  FVYGLIPK  635
            FVYGLIP+
Sbjct  186  FVYGLIPQ  193



>ref|XP_006406243.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47696.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=468

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 157/191 (82%), Gaps = 6/191 (3%)
 Frame = +3

Query  81   MDSS--NGAAYDPLPESDGVVSSPPHE---ESEASN-ELESILMDTGIPRWQRLKLATWI  242
            MDSS   G    PL +     ++PP +    +E+SN ELE +L D   P + RL+ AT I
Sbjct  1    MDSSQTTGLYQQPLLQPHADETAPPPQLSPSTESSNGELERVLSDVETPLFLRLRKATMI  60

Query  243  ELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  422
            E KLL  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG
Sbjct  61   ESKLLFKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  120

Query  423  SAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSA  602
            SAVETLCGQAFG  KYE+LG+YLQRSTVLLTLTGVLL LIYVFSEPIL+FLG++P+I+SA
Sbjct  121  SAVETLCGQAFGGRKYEMLGVYLQRSTVLLTLTGVLLTLIYVFSEPILLFLGESPEIASA  180

Query  603  AALFVYGLIPK  635
            A+LFVYGLIP+
Sbjct  181  ASLFVYGLIPQ  191



>ref|XP_008379931.1| PREDICTED: protein TRANSPARENT TESTA 12 [Malus domestica]
Length=446

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 145/178 (81%), Gaps = 1/178 (1%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            +Y PLP +    S   HEE  AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  15   SYRPLPSTKSFTSKHAHEE-HASGELEQVLCDTYKPFSQRLKPALWIESKLLVVLAAPAI  73

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            +VYMINY+MSMSTQ+F GHLGNLELAA+SLGN GIQIFAYGL+LGMGSAVETLCGQA GA
Sbjct  74   IVYMINYVMSMSTQMFCGHLGNLELAASSLGNNGIQIFAYGLLLGMGSAVETLCGQAHGA  133

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             KY++LGIYLQRSTVLL   GVLL +IYVFSEPIL+ LG++P I+S+AA++VYGLIP+
Sbjct  134  QKYKMLGIYLQRSTVLLFFPGVLLTIIYVFSEPILLLLGESPSIASSAAVYVYGLIPQ  191



>ref|XP_007045634.1| MATE efflux family protein isoform 2 [Theobroma cacao]
 gb|EOY01466.1| MATE efflux family protein isoform 2 [Theobroma cacao]
Length=424

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 152/186 (82%), Gaps = 5/186 (3%)
 Frame = +3

Query  78   VMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            +M SS  +   PL +S        + +SE S+ELE  L D  +  ++R +  TWIE KLL
Sbjct  1    MMGSSQESIQQPLLQSQ-----TSNTKSETSSELEDTLSDARLSLFERFRKGTWIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
             +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQAFGA KY++LGIYLQRS +LLTLTG+LL +IY+ S+PIL+ LG++PDI+SAAA+FV
Sbjct  116  LCGQAFGAHKYDMLGIYLQRSAILLTLTGILLTIIYILSKPILLLLGESPDIASAAAIFV  175

Query  618  YGLIPK  635
            YGLIP+
Sbjct  176  YGLIPQ  181



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 157/191 (82%), Gaps = 6/191 (3%)
 Frame = +3

Query  81   MDSS--NGAAYDPLPESDGVVSSPPHE---ESEASN-ELESILMDTGIPRWQRLKLATWI  242
            MDSS   G    PL +     ++PP +    +E+SN ELE +L D   P + RL+ AT I
Sbjct  1    MDSSQTTGLYQQPLLQPHADETAPPPQLSPSTESSNGELERVLSDVETPLFLRLRKATMI  60

Query  243  ELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  422
            E KLL  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG
Sbjct  61   ESKLLFKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  120

Query  423  SAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSA  602
            SAVETLCGQAFG  KYE+LG+YLQRSTVLLTLTGVLL LIYVFSEPIL+FLG++P+I+SA
Sbjct  121  SAVETLCGQAFGGRKYEMLGVYLQRSTVLLTLTGVLLTLIYVFSEPILLFLGESPEIASA  180

Query  603  AALFVYGLIPK  635
            A+LFVYGLIP+
Sbjct  181  ASLFVYGLIPQ  191



>gb|KEH39009.1| MATE efflux family protein [Medicago truncatula]
Length=461

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            +S  H ES+   ELE IL DT +P + R+  ATWIEL+LL  LAAPAV VY+INY+MSMS
Sbjct  20   TSQKHHESD--GELERILSDTTVPFFSRIGSATWIELRLLFLLAAPAVFVYLINYVMSMS  77

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+GA KY +LG YLQR
Sbjct  78   TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYGAEKYGMLGTYLQR  137

Query  498  StvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            ST+LLT+TG  L +IYV SEPIL+F+GQ+P I+SAAALFVYGLIP+
Sbjct  138  STILLTITGFFLTIIYVLSEPILVFIGQSPRIASAAALFVYGLIPQ  183



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +P PE      S   +   +  ELE IL +T +P  +RL  ATW+ELKLL +LAAPAV+V
Sbjct  19   EPSPEPPSCTQSFSSKHG-SDGELERILSNTSVPFAKRLGPATWVELKLLFHLAAPAVIV  77

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+INY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K
Sbjct  78   YLINYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAKK  137

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            +++LGIYLQRSTVLLTL G++L +IY+FSEPILIFLG++P I+SAAALFVYGLIP+
Sbjct  138  FDMLGIYLQRSTVLLTLAGIILTIIYIFSEPILIFLGESPRIASAAALFVYGLIPQ  193



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +3

Query  144  PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQ  323
            P     E+  ELE +L DT +P + R+  ATWIEL+LL +LAAPAV VY+INY+MSMSTQ
Sbjct  16   PGKGAHESDGELERLLSDTTVPYFTRVCSATWIELRLLFFLAAPAVFVYLINYVMSMSTQ  75

Query  324  IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRSt  503
            IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA K+E+LG YLQRST
Sbjct  76   IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAEKFEMLGTYLQRST  135

Query  504  vlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            +LLT+ G+ L +IYV SEPILIF+GQ+P I+SAAA+FVYGLIP+
Sbjct  136  ILLTIAGLFLTVIYVLSEPILIFIGQSPTIASAAAVFVYGLIPQ  179



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 154/186 (83%), Gaps = 5/186 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   Y PL        SPP  ES ++ ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGVYQPLLHPQ---PSPPTTES-SNGELETVLSDVETPLFLRLRKATTIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQA+G  KY++LG+YLQRSTVLLTLTG+LL LIYVFSEPIL+FLG++P I+SAA+LFV
Sbjct  117  LCGQAYGGRKYDMLGVYLQRSTVLLTLTGLLLTLIYVFSEPILLFLGESPAIASAASLFV  176

Query  618  YGLIPK  635
            YGLIP+
Sbjct  177  YGLIPQ  182



>ref|XP_009145464.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 151/186 (81%), Gaps = 6/186 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQAFG  KY++LGIYLQRS VLLTLTGV L  IYVFS+P L+FLG++P+I+SAA+LFV
Sbjct  116  LCGQAFGGRKYDMLGIYLQRSAVLLTLTGVFLTFIYVFSKPFLLFLGESPEIASAASLFV  175

Query  618  YGLIPK  635
            YGLIP+
Sbjct  176  YGLIPQ  181



>ref|XP_008362257.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=506

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 148/178 (83%), Gaps = 1/178 (1%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            +Y PLP +    S   H+E +AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  13   SYHPLPPTSTQSSKHSHDE-DASRELEQVLSDTDKPFSQRLKPALWIESKLLVILAAPAI  71

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            +VY+INY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYGL+LGMGSAVETLCGQA+GA
Sbjct  72   IVYVINYVMSMSTQIFSGHLGNLELAASSLGNNGIQMFAYGLLLGMGSAVETLCGQAYGA  131

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             KYE+LGIYLQRSTVLL   GVLL +IY+FSEPIL+ LG++P I+S+AA++VYGLIP+
Sbjct  132  QKYEMLGIYLQRSTVLLFFPGVLLTIIYIFSEPILLLLGESPSIASSAAVYVYGLIPQ  189



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 152/188 (81%), Gaps = 3/188 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDG---VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            M SS  ++Y  LP+++    +  +      EAS+ELE IL +T +P  +R+  ATWIE+K
Sbjct  1    MGSSGDSSYKTLPQNEKKPVLTHTQSQVRKEASDELERILSNTEVPFIKRVVPATWIEIK  60

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL +LAAPAVVVYMINYLMSM TQIFSGHLGNLE AAASLGN G+Q FAYGLMLGMGSAV
Sbjct  61   LLVHLAAPAVVVYMINYLMSMLTQIFSGHLGNLEYAAASLGNNGVQTFAYGLMLGMGSAV  120

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAAL  611
            ETLCGQA+GA +Y +LGIYLQRS +LLTLTGV L +IY+FS+PIL+ LG+APD++S AA+
Sbjct  121  ETLCGQAYGAHRYGMLGIYLQRSAILLTLTGVSLTIIYIFSKPILLLLGEAPDVASEAAI  180

Query  612  FVYGLIPK  635
            F+YGLIP+
Sbjct  181  FIYGLIPQ  188



>emb|CDY33129.1| BnaCnng07000D [Brassica napus]
Length=505

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 151/186 (81%), Gaps = 6/186 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQAFG  KY++LGIYLQRS VLLTLTGV L  IYVFS+P L+FLG++P+I+SAA+LFV
Sbjct  116  LCGQAFGGRKYDMLGIYLQRSAVLLTLTGVFLTFIYVFSKPFLLFLGESPEIASAASLFV  175

Query  618  YGLIPK  635
            YGLIP+
Sbjct  176  YGLIPQ  181



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   228 bits (581),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            +S  H ES+   ELE IL DT +P + R+  ATWIEL+LL  LAAPAV VY+INY+MSMS
Sbjct  20   TSQKHHESD--GELERILSDTTVPFFSRIGSATWIELRLLFLLAAPAVFVYLINYVMSMS  77

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+GA KY +LG YLQR
Sbjct  78   TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYGAEKYGMLGTYLQR  137

Query  498  StvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            ST+LLT+TG  L +IYV SEPIL+F+GQ+P I+SAAALFVYGLIP+
Sbjct  138  STILLTITGFFLTIIYVLSEPILVFIGQSPRIASAAALFVYGLIPQ  183



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 150/185 (81%), Gaps = 2/185 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS      P+ +S+  +SS      E S +LESIL DT +P  QRL  ATW ELKLL 
Sbjct  1    MESSRDGVDKPMLQSNPPLSS--ERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI LG++ +I+SAAA+FVY
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLGESSEIASAAAIFVY  178

Query  621  GLIPK  635
            GLIP+
Sbjct  179  GLIPQ  183



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 152/186 (82%), Gaps = 5/186 (3%)
 Frame = +3

Query  78   VMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            +M SS  +   PL +S        + +SE S+ELE  L D  +  ++R +  TWIE KLL
Sbjct  1    MMGSSQESIQQPLLQSQ-----TSNTKSETSSELEDTLSDARLSLFERFRKGTWIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
             +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQAFGA KY++LGIYLQRS +LLTLTG+LL +IY+ S+PIL+ LG++PDI+SAAA+FV
Sbjct  116  LCGQAFGAHKYDMLGIYLQRSAILLTLTGILLTIIYILSKPILLLLGESPDIASAAAIFV  175

Query  618  YGLIPK  635
            YGLIP+
Sbjct  176  YGLIPQ  181



>ref|XP_004144495.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004159201.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43525.1| hypothetical protein Csa_7G043670 [Cucumis sativus]
Length=510

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 145/168 (86%), Gaps = 2/168 (1%)
 Frame = +3

Query  138  SSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            + PP    + E S+ELESIL DT +P  QR   ATWIE+KLL YLAAPAV VY+INYLMS
Sbjct  19   TQPPVLSNKHEYSDELESILSDTHLPLLQRYTKATWIEMKLLFYLAAPAVFVYVINYLMS  78

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
            MSTQIFSGHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY++LGIYL
Sbjct  79   MSTQIFSGHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKYDMLGIYL  138

Query  492  QRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            QRS++LLTLTG +L LIY+F +PILIFLG++ +I+SAA +FVYGLIP+
Sbjct  139  QRSSILLTLTGFVLTLIYIFCKPILIFLGESKEIASAAEVFVYGLIPQ  186



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 150/185 (81%), Gaps = 2/185 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS      P+ +S+  +SS      E S +LESIL DT +P  QRL  ATW ELKLL 
Sbjct  37   MESSRDGVDKPMLQSNPPLSS--ERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLF  94

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  95   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  154

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI LG++ +I+SAAA+FVY
Sbjct  155  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLGESSEIASAAAIFVY  214

Query  621  GLIPK  635
            GLIP+
Sbjct  215  GLIPQ  219



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H +  +SNELE +L +T  P  +RLKLA WIE KLL YLA+PAV+VYMINY+M+MSTQIF
Sbjct  35   HHDLHSSNELERVLSETDRPFLERLKLALWIESKLLFYLASPAVIVYMINYVMAMSTQIF  94

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
            +GHLGNLELAAASLGN GIQ+FAYG+MLGMGSAVETLCGQA+GA KYE+LGIYLQRSTVL
Sbjct  95   AGHLGNLELAAASLGNNGIQVFAYGVMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTVL  154

Query  510  ltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LTLTGVLL ++Y+FS P+LI LGQ+P I+SAAA++VYGLIP+
Sbjct  155  LTLTGVLLTIVYIFSRPVLILLGQSPSIASAAAIYVYGLIPQ  196



>emb|CAN69305.1| hypothetical protein VITISV_021605 [Vitis vinifera]
Length=320

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 150/185 (81%), Gaps = 2/185 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--EGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI LG++ +I+SAAA+FVY
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLGESSEIASAAAIFVY  178

Query  621  GLIPK  635
            GLIP+
Sbjct  179  GLIPQ  183



>emb|CDY24250.1| BnaC03g42230D [Brassica napus]
Length=317

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 151/186 (81%), Gaps = 6/186 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   Y  L +      SP  E S  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGVYQQLLQPQ---LSPLPESS--NGELERVLSDLETPLFPRLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQAFG  KY++LG+YLQRS VLLTLTGVLL +IYVFS+PIL+FLG++P+I+SAA++FV
Sbjct  116  LCGQAFGGRKYDMLGVYLQRSAVLLTLTGVLLTIIYVFSKPILLFLGESPEIASAASIFV  175

Query  618  YGLIPK  635
            YGLIP+
Sbjct  176  YGLIPQ  181



>emb|CBI28939.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 151/192 (79%), Gaps = 2/192 (1%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            H    + M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT 
Sbjct  4    HKYLFNPMESSRDGVNEPMLQSNPPLSS--ERRSETSRQLESILSDTRLPFCQRLLAATS  61

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
             E KLL  LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGM
Sbjct  62   TESKLLFRLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGM  121

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  599
            GSAVETLCGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI L ++ +I+S
Sbjct  122  GSAVETLCGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLRESSEIAS  181

Query  600  AAALFVYGLIPK  635
            AAA+FVYGLIP+
Sbjct  182  AAAIFVYGLIPQ  193



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 153/189 (81%), Gaps = 12/189 (6%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEE--SEASN-ELESILMDTGIPRWQRLKLATWIEL  248
            MDSS N     PL +        PH +  +E+SN ELE +L D   P   RL+ AT IE 
Sbjct  1    MDSSQNDGVNQPLLQ--------PHADHGTESSNGELERVLSDVETPLSSRLRKATMIES  52

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL  LAAPAV+VYMINY MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  53   KLLFKLAAPAVIVYMINYFMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  112

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAA  608
            VETLCGQAFG  KYE+LG+YLQRSTVLLTLTGVLL +IYVFSEPIL+FLG++P+I+SAA+
Sbjct  113  VETLCGQAFGGRKYEMLGVYLQRSTVLLTLTGVLLTIIYVFSEPILLFLGESPEIASAAS  172

Query  609  LFVYGLIPK  635
            LFVYGLIP+
Sbjct  173  LFVYGLIPQ  181



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  156  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  335
            E   S++LE IL D  IP  +R ++ATWIELK L  LAAPAVVVYMINY MSMSTQIFSG
Sbjct  29   EYRWSDQLEKILTDPHIPTLKRYRMATWIELKRLFLLAAPAVVVYMINYSMSMSTQIFSG  88

Query  336  HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvllt  515
            HLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GAGKY +LGIYLQRSTV+L 
Sbjct  89   HLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAGKYGMLGIYLQRSTVILM  148

Query  516  ltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             TG+LL +IY+FS+PILI LG++ +I+SAAALFVYGLIP+
Sbjct  149  ATGILLMVIYIFSKPILIALGESSEIASAAALFVYGLIPQ  188



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 150/183 (82%), Gaps = 7/183 (4%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEA-------SNELESILMDTGIPRWQRLKLATWIELKLLCYL  266
            +PL  SD   S  P   +++         ELE IL +T +P  +R+  ATW+ELK L +L
Sbjct  12   EPLLVSDEPSSPQPPSFTQSFSSRHGSDGELERILSNTSVPFAKRIGPATWVELKFLFHL  71

Query  267  AAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG  446
            AAPAV+VY+INY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCG
Sbjct  72   AAPAVIVYLINYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCG  131

Query  447  QAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGL  626
            QA+GA K+ +LGIYLQRSTVLLTL G+LL +IY+FSEPILIFLG++P I+SAAALFVYGL
Sbjct  132  QAYGAKKFNMLGIYLQRSTVLLTLAGILLTIIYIFSEPILIFLGESPRIASAAALFVYGL  191

Query  627  IPK  635
            IP+
Sbjct  192  IPQ  194



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score =   225 bits (574),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELE IL +T +P  +R+  ATW+ELK L +LAAPAV+VY+INY+MSMSTQIFSGHLGNLE
Sbjct  41   ELERILSNTSVPFAKRIGPATWVELKFLFHLAAPAVIVYLINYVMSMSTQIFSGHLGNLE  100

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvll  533
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K+ +LGIYLQRSTVLLTL G+LL
Sbjct  101  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAKKFNMLGIYLQRSTVLLTLAGILL  160

Query  534  alIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             +IY+FSEPILIFLG++P I+SAAALFVYGLIP+
Sbjct  161  TIIYIFSEPILIFLGESPRIASAAALFVYGLIPQ  194



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   225 bits (573),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 152/185 (82%), Gaps = 3/185 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDSS     D       +  SP   ES ++ ELE++L D   P +QRL+ AT IE KLL 
Sbjct  1    MDSSRNDGVDQALLQRQL--SPKTTES-SNGELETVLSDVETPLFQRLRKATMIESKLLF  57

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAVETL
Sbjct  58   NLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAVETL  117

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQA+GA KYE+LG+YLQRSTVLLT+T +LL L+YVFSEPIL+FLG++P I+SAA+LFVY
Sbjct  118  CGQAYGARKYEMLGVYLQRSTVLLTITSLLLTLLYVFSEPILLFLGESPAIASAASLFVY  177

Query  621  GLIPK  635
            GLIP+
Sbjct  178  GLIPQ  182



>ref|XP_007215031.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
 gb|EMJ16230.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
Length=518

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H +  +SNELE +L DT  P  +RLK A WIE KLL YLAAPAV+VYMINY+MSMSTQIF
Sbjct  35   HHDLHSSNELERVLSDTNRPFLERLKPALWIESKLLFYLAAPAVIVYMINYVMSMSTQIF  94

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
            +GHLGNLELAAASLGN GI IF+YGL+LGMGSAVETLCGQA+GA KYE+LGIYLQRST+L
Sbjct  95   AGHLGNLELAAASLGNNGILIFSYGLLLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTIL  154

Query  510  ltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LTL GVLL ++Y+FS PILI LGQ+P I+SAAA++VYGLIP+
Sbjct  155  LTLGGVLLTIVYIFSRPILILLGQSPSIASAAAIYVYGLIPQ  196



>ref|XP_010930078.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Elaeis 
guineensis]
Length=494

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 148/178 (83%), Gaps = 5/178 (3%)
 Frame = +3

Query  108  DPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             PLP S  + +    PH    +   LESIL +T +P  +RL+LAT IE+KLL +LAAPAV
Sbjct  23   HPLPPSSPITADVDDPHG---SGGRLESILTETSVPWARRLRLATVIEMKLLIHLAAPAV  79

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            +VYM+NYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  80   IVYMVNYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGA  139

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             KYE+LG+YLQRST+LL  TGV LA+IY FS PIL+ LG++P+I+ AA++FVYGLIP+
Sbjct  140  HKYEMLGVYLQRSTILLMATGVPLAVIYGFSRPILVLLGESPEIAKAASIFVYGLIPQ  197



>emb|CDY65669.1| BnaCnng48120D [Brassica napus]
Length=495

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 145/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
             +     Y PL + D + + P  +  E    LE +L D   P + RL+ AT IE KLL  
Sbjct  3    SAQTDGVYQPLLQPDQLSALPESKNCE----LERVLADVETPLFLRLRKATMIETKLLFK  58

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLC
Sbjct  59   LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVETLC  118

Query  444  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYG  623
            GQAFG  KYE+LG+YLQRS VLLTLTGVLL  IYVFSE IL+FLGQ+P+I+SAA+LFVYG
Sbjct  119  GQAFGGRKYEMLGVYLQRSIVLLTLTGVLLTSIYVFSENILLFLGQSPEIASAASLFVYG  178

Query  624  LIPK  635
            LIP+
Sbjct  179  LIPQ  182



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 147/168 (88%), Gaps = 2/168 (1%)
 Frame = +3

Query  138  SSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            + PP    + E+S+ELE+IL DT +P  QR   ATWIE+KL+ YLAAPA+ VYM+NYLMS
Sbjct  19   TEPPLLSNKHESSDELEAILSDTHLPLLQRYTKATWIEMKLMFYLAAPAIFVYMVNYLMS  78

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
            MSTQIFSGHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY++LGIYL
Sbjct  79   MSTQIFSGHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKYDMLGIYL  138

Query  492  QRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            QRS++LLTLTG++L L+Y+F +PILIFLG++ +I+SAA +FVYGLIP+
Sbjct  139  QRSSILLTLTGLVLTLVYIFCKPILIFLGESKEIASAAEVFVYGLIPQ  186



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 153/180 (85%), Gaps = 8/180 (4%)
 Frame = +3

Query  117  PESDGV-------VSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
            P++DGV        SSP   ES ++ ELE++L D   P  QRL+ AT IE KLL  LAAP
Sbjct  4    PQNDGVDQPLLQPQSSPSTTES-SNGELETVLSDVETPLVQRLRKATMIESKLLFNLAAP  62

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV+VYMINYLMSMST+IFSGHLGNLELAAASLGNTGIQ+F+YGL+LGMGSAVETLCGQA+
Sbjct  63   AVIVYMINYLMSMSTRIFSGHLGNLELAAASLGNTGIQVFSYGLLLGMGSAVETLCGQAY  122

Query  456  GAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            GA KYE+LG+YLQRSTVLLTLTG++L L+YVFSEPIL+FLG++P I+SAA+LFVYGLIP+
Sbjct  123  GARKYEMLGVYLQRSTVLLTLTGLVLTLLYVFSEPILLFLGESPAIASAASLFVYGLIPQ  182



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 145/176 (82%), Gaps = 3/176 (2%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL  S+ +     HE   +  ELE +L DT +P  +R+  ATWIEL+LL +LAAPAV V
Sbjct  11   EPLLLSNNIGKPNLHE---SDGELERLLSDTTVPFLRRVGSATWIELRLLFFLAAPAVFV  67

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+INY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+ AYGLMLGMGSAVETLCGQAFGA K
Sbjct  68   YLINYVMSMSTQIFSGHLGNLELAAASLGNTGIQMLAYGLMLGMGSAVETLCGQAFGAEK  127

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            +E+LG YLQRST+LLT+ G+ L +IYV SEPILIF+GQ+P I SAAA+FVYGLIP+
Sbjct  128  FEMLGTYLQRSTILLTIAGLFLTVIYVLSEPILIFIGQSPTIVSAAAVFVYGLIPQ  183



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 148/178 (83%), Gaps = 5/178 (3%)
 Frame = +3

Query  108  DPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             PLP S  + +    PH    +   LESIL +T +P  +RL+LAT IE+KLL +LAAPAV
Sbjct  23   HPLPPSSPITADVDDPHG---SGGRLESILTETSVPWARRLRLATVIEMKLLIHLAAPAV  79

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            +VYM+NYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  80   IVYMVNYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGA  139

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             KYE+LG+YLQRST+LL  TGV LA+IY FS PIL+ LG++P+I+ AA++FVYGLIP+
Sbjct  140  HKYEMLGVYLQRSTILLMATGVPLAVIYGFSRPILVLLGESPEIAKAASIFVYGLIPQ  197



>gb|KFK39485.1| hypothetical protein AALP_AA3G250300 [Arabis alpina]
Length=510

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 150/188 (80%), Gaps = 5/188 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS N   Y PL  P  DG + SP  E    + ELE +L D   P +  L+ AT IE K
Sbjct  1    MDSSQNEGVYQPLIQPHGDGTLPSPLSESR--NGELERVLSDFEAPLFLCLRKATIIESK  58

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMIN  MSMSTQIFSGHLGNLELAAASLGNTGIQ FAYGLMLGMGSAV
Sbjct  59   LLFKLAAPAVIVYMINNFMSMSTQIFSGHLGNLELAAASLGNTGIQGFAYGLMLGMGSAV  118

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAAL  611
            ETLCGQA+G  KYE+LG+YLQRSTVLLTLTGV L LIYVFS+PIL+FLGQ+P+I+SAA+L
Sbjct  119  ETLCGQAYGGRKYEMLGVYLQRSTVLLTLTGVFLTLIYVFSKPILLFLGQSPEIASAASL  178

Query  612  FVYGLIPK  635
            FVYGLIP+
Sbjct  179  FVYGLIPQ  186



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 149/186 (80%), Gaps = 5/186 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDS+     Y PL + D +  SP  E +    ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSAQTDGVYQPLLQPDQL--SPLPESNNC--ELERVLADVETPLFLRLRKATMIETKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVET
Sbjct  57   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQAFG  KYE+LG+YLQRS VLLTLTGVLL  IYVFSE IL+FLGQ+P+I+SAA+LFV
Sbjct  117  LCGQAFGGRKYEMLGVYLQRSIVLLTLTGVLLTSIYVFSENILLFLGQSPEIASAASLFV  176

Query  618  YGLIPK  635
            YGL+P+
Sbjct  177  YGLLPQ  182



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   223 bits (568),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 147/183 (80%), Gaps = 0/183 (0%)
 Frame = +3

Query  87   SSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYL  266
            + N     PLP S     +   E   AS +LE +L D  IP  +R+ LA+ IE+KLL +L
Sbjct  15   TGNDDVDQPLPPSTPPAMADEGEAHGASGQLEIVLNDASIPWARRMWLASLIEMKLLVFL  74

Query  267  AAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG  446
            AAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG
Sbjct  75   AAPAVMVYMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG  134

Query  447  QAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGL  626
            QA+GA KYE+LGIY+QRSTVLL  TGV LA+IY FS PIL+ LG++P+I+ AA++FVYGL
Sbjct  135  QAYGAHKYEMLGIYMQRSTVLLMATGVPLAVIYAFSRPILVLLGESPEIAKAASIFVYGL  194

Query  627  IPK  635
            IP+
Sbjct  195  IPQ  197



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score =   223 bits (568),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 155/199 (78%), Gaps = 7/199 (4%)
 Frame = +3

Query  45   PRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQ  218
            P   P  L   ++  S+     PLP S  + +    PH    +S  LESIL DT +   +
Sbjct  3    PAASPEKLRTPLLGPSDDD--QPLPSSSPMAADMDDPHG---SSGRLESILTDTSLSWAR  57

Query  219  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFA  398
            RL+LAT IE+KLL +LAAPAV+VYM+NY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FA
Sbjct  58   RLQLATIIEMKLLIHLAAPAVIVYMLNYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFA  117

Query  399  YGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            YGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRST+LL  TGV LA+IY FS P+L+ LG
Sbjct  118  YGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTILLMATGVPLAVIYAFSRPLLVLLG  177

Query  579  QAPDISSAAALFVYGLIPK  635
            ++P+I+ AAA+FVYGLIP+
Sbjct  178  ESPEIAKAAAVFVYGLIPQ  196



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 153/197 (78%), Gaps = 2/197 (1%)
 Frame = +3

Query  45   PRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRL  224
            P   P  L+  ++  S+     PLP S   ++    +   +S  LE IL DT IP  +RL
Sbjct  3    PVASPEKLSTPLLVPSDDD--QPLPTSTPSMAGDVDDPHGSSGRLERILTDTSIPWARRL  60

Query  225  KLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYG  404
             LAT IE+KLL +LAAPAV+VYM+NY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYG
Sbjct  61   PLATAIEMKLLIHLAAPAVIVYMLNYVMSMSTQIFSGHLGNLELAASSLGNNGIQVFAYG  120

Query  405  LMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQA  584
            LMLGMGSAVETLCGQAFGA K+E+LGIYLQRSTVLL  TGV LA+IY FS PIL+ LG++
Sbjct  121  LMLGMGSAVETLCGQAFGANKHEMLGIYLQRSTVLLMATGVPLAVIYGFSRPILVLLGES  180

Query  585  PDISSAAALFVYGLIPK  635
            P+I+ AA++FVYGLIP+
Sbjct  181  PEIARAASVFVYGLIPQ  197



>emb|CDX92916.1| BnaA03g36380D [Brassica napus]
Length=505

 Score =   222 bits (566),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 151/186 (81%), Gaps = 6/186 (3%)
 Frame = +3

Query  81   MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS     Y PL +      SP  E S  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQYDVVYQPLLQPQ---LSPLPESS--NGELERVLSDLETPLFLRLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQAFG  KY++LG+YLQRS VLLTLTGVLL +IYVFS+PIL+FLG++P+I+SAA+LFV
Sbjct  116  LCGQAFGGRKYDMLGVYLQRSAVLLTLTGVLLTIIYVFSKPILLFLGESPEIASAASLFV  175

Query  618  YGLIPK  635
            YGLIP+
Sbjct  176  YGLIPQ  181



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 146/179 (82%), Gaps = 7/179 (4%)
 Frame = +3

Query  108  DPLPESD---GVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
             PLP S    G V  P      +S  LESIL DT +P  +RL+LAT +E+KLL +LA PA
Sbjct  22   HPLPPSSPTTGTVDDP----HGSSGRLESILTDTTVPWSRRLRLATIVEMKLLLHLAGPA  77

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V VYM+NY+MSMSTQIFSGHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLCGQA+G
Sbjct  78   VTVYMLNYVMSMSTQIFSGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLCGQAYG  137

Query  459  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            A KYE+LGIYLQRST+LL  TGVLLA+IY FS PIL+ LG++P+I+ AA++FVYGLIP+
Sbjct  138  AHKYEMLGIYLQRSTILLMATGVLLAVIYAFSRPILLLLGESPEIAKAASIFVYGLIPQ  196



>ref|XP_010051023.1| PREDICTED: protein TRANSPARENT TESTA 12 [Eucalyptus grandis]
 gb|KCW89409.1| hypothetical protein EUGRSUZ_A01710 [Eucalyptus grandis]
Length=520

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 151/196 (77%), Gaps = 11/196 (6%)
 Frame = +3

Query  81   MDSSNGAA----YDPLPESDGVVSSPPHEES-------EASNELESILMDTGIPRWQRLK  227
            M SS  A     YDPLPES  V   P            E S  LES+L D  +    R++
Sbjct  1    MGSSQAAGGDRKYDPLPESTQVPPPPSPRPHRPRPDHHETSGHLESVLSDPSLTLGARVR  60

Query  228  LATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL  407
             A+ IELKLL +LAAPAVVVYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL
Sbjct  61   AASRIELKLLFHLAAPAVVVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGL  120

Query  408  MLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAP  587
            MLGMGSAVETLCGQA+GA KYE+LG+YLQR+ VLLT TG LL L+YVFS+P+L+FLG+  
Sbjct  121  MLGMGSAVETLCGQAYGAHKYEMLGVYLQRAAVLLTATGFLLTLVYVFSKPLLLFLGEPL  180

Query  588  DISSAAALFVYGLIPK  635
            +I+SAAA+FVYGLIP+
Sbjct  181  EIASAAAVFVYGLIPQ  196



>emb|CDY39493.1| BnaA01g24950D [Brassica napus]
Length=503

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 148/186 (80%), Gaps = 5/186 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDS+     Y PL + D +  SP  E +    ELE  L D   P + RL+ AT IE KLL
Sbjct  1    MDSAQTDGVYQPLLQPDQL--SPLPESNNC--ELERGLADVETPLFLRLRKATMIETKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVET
Sbjct  57   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQAFG  KYE+LG+YLQRS VLLTLTGVLL  IYVFSE IL+FLGQ+P+I+SAA+LFV
Sbjct  117  LCGQAFGGRKYEMLGVYLQRSIVLLTLTGVLLTSIYVFSENILLFLGQSPEIASAASLFV  176

Query  618  YGLIPK  635
            YGLIP+
Sbjct  177  YGLIPQ  182



>ref|XP_009135765.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 150/186 (81%), Gaps = 6/186 (3%)
 Frame = +3

Query  81   MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS     Y PL +        P  ES  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQYDVVYQPLLQPQ----LSPLPESN-NGELERVLSDLETPLFPRLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQAFG  KY++LG+YLQRS VLLTLTGVLL +IYVFS+PIL+FLG++P+I+SAA+LFV
Sbjct  116  LCGQAFGGRKYDMLGVYLQRSAVLLTLTGVLLTIIYVFSKPILLFLGESPEIASAASLFV  175

Query  618  YGLIPK  635
            YGLIP+
Sbjct  176  YGLIPQ  181



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 150/185 (81%), Gaps = 2/185 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--EGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI LG++ +I+SAAA+FVY
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLGESSEIASAAAIFVY  178

Query  621  GLIPK  635
            GLIP+
Sbjct  179  GLIPQ  183



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
             PLP S   +     +   +   LESIL D   PR +RL+LAT +E+KLL +LAAP V+V
Sbjct  22   HPLPPSSPSMDGDIDDPHGSRGRLESILTDPSFPRARRLQLATIVEMKLLVHLAAPTVIV  81

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            YM+NY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K
Sbjct  82   YMLNYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHK  141

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            Y +LGIYLQRST+LL  TGV LA+IYVFS PIL+ LGQ+ +I++AA++FVYGLIP+
Sbjct  142  YGMLGIYLQRSTILLMATGVPLAVIYVFSRPILLLLGQSSEIATAASVFVYGLIPQ  197



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 140/160 (88%), Gaps = 0/160 (0%)
 Frame = +3

Query  156  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  335
            ES AS +LESIL D  IP  +R+ +A+ +E+KLL YLAAPAV+VYM+NY+MSMSTQIFSG
Sbjct  4    ESGASQKLESILSDNSIPWARRIWMASLVEMKLLVYLAAPAVMVYMLNYVMSMSTQIFSG  63

Query  336  HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvllt  515
            HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+GA KYE+LG+YLQRSTVLL 
Sbjct  64   HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYGAHKYEMLGVYLQRSTVLLM  123

Query  516  ltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             TGV LA IY  S PIL+ LG++P+I+ AA++FVYGLIP+
Sbjct  124  ATGVPLAAIYALSRPILVLLGESPEIAKAASIFVYGLIPQ  163



>ref|XP_004159226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 146/176 (83%), Gaps = 6/176 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            YE+LGIYLQRST+LLT+   LL L+Y+FS+PIL+FLG++P+I+S+AA+FVYGLIP+
Sbjct  122  YEMLGIYLQRSTILLTMVAFLLTLLYIFSKPILLFLGESPEIASSAAIFVYGLIPQ  177



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 146/176 (83%), Gaps = 4/176 (2%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL +S    +S    ES  S+ELE +L D      +R   AT IE KLL +LAAPAV+V
Sbjct  11   EPLLQSQ---TSDTKSES-TSSELEDVLSDGNSSLLERWGKATCIESKLLFHLAAPAVIV  66

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA K
Sbjct  67   YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAHK  126

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            Y++LGIYLQRS VLLT TG+LL LIYVFS+PIL+ LG++PDI+SAAA+FVYGLIP+
Sbjct  127  YDMLGIYLQRSAVLLTFTGILLTLIYVFSKPILLLLGESPDIASAAAIFVYGLIPQ  182



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 149/185 (81%), Gaps = 2/185 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--ERRSETSRQLESILSDTRLPFCQRLLAATSTESKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI L ++ +I+SAAA+FVY
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLRESSEIASAAAIFVY  178

Query  621  GLIPK  635
            GLIP+
Sbjct  179  GLIPQ  183



>gb|KGN43522.1| Mate efflux family protein [Cucumis sativus]
Length=507

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 146/176 (83%), Gaps = 6/176 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            YE+LGIYLQRST+LLT+   LL L+Y+FS+PIL+FLG++P+I+S+AA+FVYGLIP+
Sbjct  122  YEMLGIYLQRSTILLTMVAFLLTLLYIFSKPILLFLGESPEIASSAAIFVYGLIPQ  177



>ref|XP_004144588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 146/176 (83%), Gaps = 6/176 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            YE+LGIYLQRST+LLT+   LL L+Y+FS+PIL+FLG++P+I+S+AA+FVYGLIP+
Sbjct  122  YEMLGIYLQRSTILLTMVAFLLTLLYIFSKPILLFLGESPEIASSAAIFVYGLIPQ  177



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 146/179 (82%), Gaps = 4/179 (2%)
 Frame = +3

Query  99   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            A   PL +S    +S    ES  S+ELE +L D      +R   AT IE KLL +LAAPA
Sbjct  8    AIRKPLFQSQ---TSDTKSES-TSSELEDVLSDGNSSLLERWGKATCIESKLLFHLAAPA  63

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  64   VIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAFG  123

Query  459  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            A KY++LGIYLQRS VLLT TG+LL LIYVFS+PIL+ LG++PDI+SAAA+FVYGLIP+
Sbjct  124  AHKYDMLGIYLQRSAVLLTFTGILLTLIYVFSKPILLLLGESPDIASAAAIFVYGLIPQ  182



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 149/186 (80%), Gaps = 5/186 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   + PL          P      + ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSPNDGVHQPLLHP----QPSPSPPESTNGELETVLSDVETPLFLRLRKATIIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQA+G  KYE+LG+YLQRSTVLLTLTG+LL LIYVFSEPIL+FLG++P I+SAA+LFV
Sbjct  117  LCGQAYGGRKYEMLGVYLQRSTVLLTLTGLLLTLIYVFSEPILLFLGESPAIASAASLFV  176

Query  618  YGLIPK  635
            YGLIP+
Sbjct  177  YGLIPQ  182



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 150/186 (81%), Gaps = 4/186 (2%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N     PL     +  SP   ES  + ELE++L D   P  QRL+ AT IE KLL
Sbjct  1    MDSSQNDGVSQPLLHPPQL--SPSTTESN-NGELETVLSDVETPLLQRLRKATMIESKLL  57

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  58   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  117

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQA+G  KYE+LG+YLQRSTVLLTLTG+LL L+YVFSEP L+ LG++P I+SAA+LFV
Sbjct  118  LCGQAYGGKKYEMLGVYLQRSTVLLTLTGLLLTLLYVFSEPFLLLLGESPAIASAASLFV  177

Query  618  YGLIPK  635
            YGLIP+
Sbjct  178  YGLIPQ  183



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 149/186 (80%), Gaps = 5/186 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   + PL          P      + ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSPNDGVHQPLLHP----QPSPSPPESTNGELETVLSDVETPLFLRLRKATIIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQA+G  KYE+LG+YLQRSTVLLTLTG+LL LIYVFSEPIL+FLG++P I+SAA+LFV
Sbjct  117  LCGQAYGGRKYEMLGVYLQRSTVLLTLTGLLLTLIYVFSEPILLFLGESPAIASAASLFV  176

Query  618  YGLIPK  635
            YGLIP+
Sbjct  177  YGLIPQ  182



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 151/193 (78%), Gaps = 10/193 (5%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPP--------HEESEASNELESILMDTGIPRWQRLKLAT  236
            M SS      P+ +SD   S PP           SE S +LESIL +T +   +RL+LAT
Sbjct  1    MKSSPEVVQKPILQSDD--SDPPLSSSLQSDDTRSETSAQLESILSNTQLRLSERLRLAT  58

Query  237  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  416
            W ELKLL YLA PAV+VYMI Y+MSM+TQIF GHLGNLELAAASLGN GIQIFAYGL+LG
Sbjct  59   WTELKLLFYLAGPAVLVYMIGYVMSMATQIFVGHLGNLELAAASLGNNGIQIFAYGLLLG  118

Query  417  MGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDIS  596
            MGSAVETLCGQA+GA K+++LGIYLQ+STVLLT+TGVLL  +Y+FS+PILI LG++  I+
Sbjct  119  MGSAVETLCGQAYGAKKFDMLGIYLQKSTVLLTITGVLLTFVYIFSKPILILLGESSRIA  178

Query  597  SAAALFVYGLIPK  635
            SAAA+FVYGLIP+
Sbjct  179  SAAAIFVYGLIPQ  191



>gb|KDO75455.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=444

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 146/180 (81%), Gaps = 9/180 (5%)
 Frame = +3

Query  96   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAY  117

Query  456  GAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            GAG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG++  ++SAAALFVYGLIP+
Sbjct  118  GAGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLGESTAVASAAALFVYGLIPQ  177



>tpg|DAA50098.1| TPA: putative MATE efflux family protein [Zea mays]
Length=432

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRST+
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTI  148

Query  507  lltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LL  TGV L ++Y FS PIL+ LG++P+I+SAAA+FVYGLIP+
Sbjct  149  LLMATGVPLTVLYAFSRPILVLLGESPEIASAAAVFVYGLIPQ  191



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 142/178 (80%), Gaps = 5/178 (3%)
 Frame = +3

Query  108  DPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             PLP S  V      PH    +S  LESIL DT IP  +RL+LAT IE+KLL +LA P+V
Sbjct  22   HPLPPSSPVTGDIDDPHG---SSGRLESILTDTSIPWARRLRLATIIEMKLLLHLAVPSV  78

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
             VYM+NY+MSMST I SGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  79   TVYMLNYVMSMSTTIISGHLGNLELAAASLGNAGIQVFAYGLMLGMGSAVETLCGQAYGA  138

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             KYE+LGIYLQRST+LL  T V LA+IY FS PIL+FLGQ+ +I+ AA++FVYGLIP+
Sbjct  139  HKYEMLGIYLQRSTILLMATAVPLAVIYAFSRPILLFLGQSSEIAKAASVFVYGLIPQ  196



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  156  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  335
            + E+  ELE IL ++ +P  +R++LAT +ELKLL YLAAP+V+VY++N + SMSTQIFSG
Sbjct  29   KHESDGELERILSNSSVPFIKRIQLATRVELKLLFYLAAPSVIVYLLNNVTSMSTQIFSG  88

Query  336  HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvllt  515
            H+GNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LGIYLQ+S+VLLT
Sbjct  89   HIGNLELAAASLGNNGIQVFAYGLMLGMGSAVETLCGQAFGAKKYDMLGIYLQKSSVLLT  148

Query  516  ltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            L G++L LIY+FS+PILIF+GQ+P I+SAAALFVYGLIP+
Sbjct  149  LAGLILTLIYIFSKPILIFIGQSPAIASAAALFVYGLIPQ  188



>gb|KDO75454.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=456

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 146/179 (82%), Gaps = 9/179 (5%)
 Frame = +3

Query  99   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYG  118

Query  459  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            AG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG++  ++SAAALFVYGLIP+
Sbjct  119  AGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLGESTAVASAAALFVYGLIPQ  177



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score =   218 bits (555),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            +S ELE IL D  +P  +R+  ATW+ELKLL  LAAPAV+VY++NY+MSMSTQIF GHLG
Sbjct  37   SSGELEQILTDISLPYSKRVGAATWLELKLLFNLAAPAVIVYLLNYVMSMSTQIFCGHLG  96

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY +LGIYLQRSTVLL+L G
Sbjct  97   NLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAKKYHMLGIYLQRSTVLLSLAG  156

Query  525  vllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            VLL +IYVF+EPIL+ LG++P+I+SAAALFVYGLIP+
Sbjct  157  VLLTIIYVFAEPILLMLGESPEIASAAALFVYGLIPQ  193



>gb|KGN43524.1| hypothetical protein Csa_7G043660 [Cucumis sativus]
Length=485

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 144/176 (82%), Gaps = 6/176 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+  HE    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEK----SAAKHEA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+IN LMSMST+IFSG LGNL+LAAASLGN GIQ FAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGIQSFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            YE+LGIYLQRST+LLT+   LL L+Y+FS+PIL+FLG++P+I+S+AA+FVYGLIP+
Sbjct  122  YEMLGIYLQRSTILLTMVAFLLTLLYIFSKPILLFLGESPEIASSAAIFVYGLIPQ  177



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score =   217 bits (553),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETL  120

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQA+GA KY++LGIYLQRSTVLL  TGV LA +Y FS P+L+ LG++P+I+SAAA+FVY
Sbjct  121  CGQAYGAHKYDMLGIYLQRSTVLLMATGVPLAALYAFSRPVLVLLGESPEIASAAAVFVY  180

Query  621  GLIPK  635
            GL+P+
Sbjct  181  GLVPQ  185



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score =   217 bits (553),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
             +SNELE +L DT  P  +RLK A WIE KLL YLAAPAV+VYMINY+MSMSTQIF+GHL
Sbjct  38   HSSNELERVLSDTDRPFLERLKPALWIESKLLFYLAAPAVIVYMINYVMSMSTQIFAGHL  97

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            GNLELAAASLGN GI IF+YGL+LGMGSAVETLCGQA+GA KYE+LGIYLQRST+LLTL 
Sbjct  98   GNLELAAASLGNNGILIFSYGLLLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTILLTLG  157

Query  522  gvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            GVLL ++Y++  PILI LGQ+P I+SAAA++VYGLIP+
Sbjct  158  GVLLTIVYIYYRPILILLGQSPSIASAAAIYVYGLIPQ  195



>gb|AGT17221.1| transparent testa 12 protein [Saccharum hybrid cultivar R570]
Length=524

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 143/171 (84%), Gaps = 6/171 (4%)
 Frame = +3

Query  141  SPP-----HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            +PP     H   EA S +LESIL DT +P  +R+  A+ +E++LL  LAAPAV+VYMINY
Sbjct  18   APPSPGSGHGHGEAVSGQLESILSDTSLPWGRRMVAASVVEMRLLVRLAAPAVLVYMINY  77

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
            LMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LG
Sbjct  78   LMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLG  137

Query  483  IYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            IYLQRST+LL  TGV LA+IY FS PIL+ LG++P I+SAAA+FVYGLIP+
Sbjct  138  IYLQRSTILLMATGVPLAVIYAFSRPILVLLGESPAIASAAAVFVYGLIPQ  188



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  QR+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRQRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRST+
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTI  148

Query  507  lltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LL  TGV L ++Y FS PIL+ LG++P+I+SAAA+FVYGLIP+
Sbjct  149  LLMATGVPLTVLYAFSRPILVLLGESPEIASAAAVFVYGLIPQ  191



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETL  120

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQA+GA KY++LGIYLQRSTVLL  TGV LA +Y FS P+L+ LG++P+I+SAAA+FVY
Sbjct  121  CGQAYGAHKYDMLGIYLQRSTVLLMATGVPLAALYAFSRPVLLLLGESPEIASAAAVFVY  180

Query  621  GLIPK  635
            GL+P+
Sbjct  181  GLVPQ  185



>gb|KGN43526.1| hypothetical protein Csa_7G043680 [Cucumis sativus]
Length=517

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
               + S+ELE +L DT +   +R  LA+WIE+KL+ YLAAPAV VY+INYLMSMSTQIFS
Sbjct  29   NHHKTSDELEKVLSDTQLSVLRRYSLASWIEMKLMFYLAAPAVFVYVINYLMSMSTQIFS  88

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLGNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA KY +LGIYLQRS +LL
Sbjct  89   GHLGNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYGAQKYHMLGIYLQRSIILL  148

Query  513  tltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            TLTG  +  IY+F +PILIFLG++ +I+SAA +FVYGL+P+
Sbjct  149  TLTGFAITTIYIFCKPILIFLGESKEIASAAEVFVYGLLPQ  189



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H     S  LESIL D  +P  +R+  AT +E++LL  LAAPAVVVYMINYLMSMSTQIF
Sbjct  28   HGVEAVSGRLESILSDESLPWGRRMSAATLVEMRLLVRLAAPAVVVYMINYLMSMSTQIF  87

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
            SGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRSTVL
Sbjct  88   SGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRSTVL  147

Query  510  ltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            L  TGV LA++Y FS PIL+ LG++P+I+SAAA+FVYGL+P+
Sbjct  148  LMATGVPLAVLYAFSRPILVLLGESPEIASAAAVFVYGLVPQ  189



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 146/179 (82%), Gaps = 9/179 (5%)
 Frame = +3

Query  99   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYG  118

Query  459  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            AG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG++  ++SAAALFVYGLIP+
Sbjct  119  AGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLGESTAVASAAALFVYGLIPQ  177



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS VLLT+TG
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRSAVLLTITG  133

Query  525  vllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            V LA+IY FSEPIL+F+GQ+P+I+ AAA+FVYGLIP+
Sbjct  134  VPLAVIYGFSEPILVFMGQSPEIARAAAIFVYGLIPQ  170



>gb|ABF97220.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
Length=495

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS VLLT+TG
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRSAVLLTITG  133

Query  525  vllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            V LA+IY FSEPIL+F+GQ+P+I+ AAA+FVYGLIP+
Sbjct  134  VPLAVIYGFSEPILVFMGQSPEIARAAAIFVYGLIPQ  170



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS VLLT+TG
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRSAVLLTITG  133

Query  525  vllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            V LA+IY FSEPIL+F+GQ+P+I+ AAA+FVYGLIP+
Sbjct  134  VPLAVIYGFSEPILVFMGQSPEIARAAAIFVYGLIPQ  170



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 141/163 (87%), Gaps = 3/163 (2%)
 Frame = +3

Query  147  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            PH    +   LESIL +  +P  +RL+LAT +E+KLL  +AAPAV+VYM+N+LMSMSTQI
Sbjct  7    PHG---SRGRLESILTNPSVPWVRRLQLATIVEMKLLIRIAAPAVMVYMVNFLMSMSTQI  63

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            FSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRST+
Sbjct  64   FSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTI  123

Query  507  lltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LLT TGV LA+IY FS PIL+ LG++P+I+ AA++FVYGLIP+
Sbjct  124  LLTTTGVPLAVIYAFSRPILVLLGESPEIAKAASIFVYGLIPQ  166



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 146/179 (82%), Gaps = 9/179 (5%)
 Frame = +3

Query  99   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASCRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+G
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYG  118

Query  459  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            AG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG++  ++SAAALFVYGLIP+
Sbjct  119  AGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLGESTAVASAAALFVYGLIPQ  177



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = +3

Query  120  ESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  299
            ++  + S   H +   SNELE IL +   P  +RL+LA+W+ELKLL  LAAPAV+VY++N
Sbjct  4    DTSRLSSKVSHHDETVSNELEEILTNNQSPYSKRLRLASWVELKLLFQLAAPAVIVYLLN  63

Query  300  YLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELL  479
             ++SMSTQIF GHLGNLELAA SLGNTGIQ+FAYGL+LGMGSAVETLCGQA+GA +YE+L
Sbjct  64   NVISMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLLLGMGSAVETLCGQAYGANRYEIL  123

Query  480  GIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            GIYLQRST+LL LT + L +IY+FS+PILI LG+  +I+SAAA+FV GLIP+
Sbjct  124  GIYLQRSTILLMLTALPLMVIYIFSKPILILLGEPVNIASAAAVFVRGLIPQ  175



>tpg|DAA50100.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRST+
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTI  148

Query  507  lltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LL  TGV L ++Y FS PIL+ LG++P+I+SAAA+FVYGLIP+
Sbjct  149  LLMATGVPLTVLYAFSRPILVLLGESPEIASAAAVFVYGLIPQ  191



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H E+  S +LESIL D  +P   R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIF
Sbjct  26   HGETAVSGQLESILGDASVPWGTRMASASAVEMRLLVRLAAPAVLVYMINYLMSMSTQIF  85

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
            SGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRSTVL
Sbjct  86   SGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTVL  145

Query  510  ltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            L  TGV LA +Y FS P+L+ LG++P+I+SAAA+FVYGL+P+
Sbjct  146  LMATGVPLAALYAFSRPVLLLLGESPEIASAAAVFVYGLVPQ  187



>tpg|DAA50097.1| TPA: putative MATE efflux family protein, partial [Zea mays]
Length=167

 Score =   204 bits (520),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = +3

Query  159  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            ++AS  LESIL             A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGH
Sbjct  7    ADASERLESILTAE---AAASPWAAAAIELRLLTRLAAPAVVMYMINYLMSMSTQIFSGH  63

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltl  518
            LGNLELAAASLGN G+Q+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS VLL +
Sbjct  64   LGNLELAAASLGNAGVQMFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSAVLLCV  123

Query  519  tgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            TGV LA+IY FSEPIL+FLGQ+P+I+ AA++FVYGLIP+
Sbjct  124  TGVPLAVIYAFSEPILVFLGQSPEIARAASVFVYGLIPQ  162



>ref|XP_008455433.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=515

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            + S+ELE IL DT +   +R   ATWIE+KL+ YLAAPAV VY+INYLMSMSTQ+FSGHL
Sbjct  33   KTSDELEKILSDTQLSVVRRYSQATWIEMKLMFYLAAPAVFVYVINYLMSMSTQVFSGHL  92

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            GNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA KY +LGIYLQRST+LLTLT
Sbjct  93   GNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYGAQKYNMLGIYLQRSTILLTLT  152

Query  522  gvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            G +L +IY+F +PILIFLG++ +I+SAA +FVYGL+P+
Sbjct  153  GFVLTIIYIFCKPILIFLGESEEIASAAEVFVYGLLPQ  190



>ref|XP_008676828.1| PREDICTED: transparent testa 12 protein isoform X1 [Zea mays]
 tpg|DAA50099.1| TPA: putative MATE efflux family protein [Zea mays]
Length=537

 Score =   215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRST+
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTI  148

Query  507  lltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LL  TGV L ++Y FS PIL+ LG++P+I+SAAA+FVYGLIP+
Sbjct  149  LLMATGVPLTVLYAFSRPILVLLGESPEIASAAAVFVYGLIPQ  191



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLG+TGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGHTGIQVFAYGLMLGMGSAVETL  120

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQA+GA KY++LGIYLQRSTVLL  TGV LA +Y FS P+L+ LG++P+I+SAAA+FVY
Sbjct  121  CGQAYGAHKYDMLGIYLQRSTVLLMATGVPLAALYAFSRPVLLLLGESPEIASAAAVFVY  180

Query  621  GLIPK  635
            GL+P+
Sbjct  181  GLVPQ  185



>emb|CDM85992.1| unnamed protein product [Triticum aestivum]
Length=512

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
             ASNELE+IL D  +P  +R+  AT +E ++L  LAAPAV+VYMINY+MSMSTQIF+GHL
Sbjct  30   RASNELEAILNDDSVPWARRMCAATAVETRMLLRLAAPAVLVYMINYMMSMSTQIFAGHL  89

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            G LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K+++LGIY+QRSTVLL  T
Sbjct  90   GTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGANKFDMLGIYMQRSTVLLMAT  149

Query  522  gvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            G+ LA+IYVF  PILI LGQ P+I+ AAA+FVYGLIP+
Sbjct  150  GIPLAVIYVFCRPILILLGQTPEIARAAAIFVYGLIPQ  187



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 139/162 (86%), Gaps = 1/162 (1%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H+E+  S+ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQIF
Sbjct  15   HDETR-SSELEQILADTEAPYFKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQIF  73

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
             GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQAFGA +YE+LG+YLQRST+L
Sbjct  74   CGHLGNLELAAVSLGNTGIQMFAYGLMLGMGSAVETLCGQAFGAHRYEMLGVYLQRSTIL  133

Query  510  ltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            L  T + L +IY+F EP+L+ LG+   I+SAAA+FVYGLIP+
Sbjct  134  LMATAIPLMVIYIFCEPLLMLLGEPVSIASAAAVFVYGLIPQ  175



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H+E+  S+ELE IL DT  P ++R++ A+W+E+KLL  LAAPAV+VY++N ++SMSTQIF
Sbjct  15   HDETR-SSELEQILADTEAPYFKRIRSASWVEMKLLFRLAAPAVIVYLLNNVVSMSTQIF  73

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
             GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQAFGA +YE+LG+YLQRST+L
Sbjct  74   CGHLGNLELAAVSLGNTGIQMFAYGLMLGMGSAVETLCGQAFGAHRYEMLGVYLQRSTIL  133

Query  510  ltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            L    + L +IY+FSEP+L+ LG+   I+SAAA+FVYGLIP+
Sbjct  134  LMAAAIPLMVIYIFSEPLLMLLGEPVSIASAAAVFVYGLIPQ  175



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H++ E  S+ELE IL DT  P  +R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQI
Sbjct  15   HDDHETVSDELEQILTDTEAPYSKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQI  74

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            F GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA ++E+LGIYLQRSTV
Sbjct  75   FCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGANRHEMLGIYLQRSTV  134

Query  507  lltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LL   G+ L +IY+FS+PILI LG+  +I+SAAA+FV+GLIP+
Sbjct  135  LLMAAGIPLMMIYIFSKPILILLGEPVNIASAAAVFVFGLIPQ  177



>gb|KDP20755.1| hypothetical protein JCGZ_21226 [Jatropha curcas]
Length=359

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            ++ELE IL DT    + R++LA+W+ELKLL  +A PAV+VY++N ++SMSTQIF GHLGN
Sbjct  19   NSELEEILTDTETSSFTRIQLASWVELKLLFRIAGPAVIVYLLNNVVSMSTQIFVGHLGN  78

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAA SLGNTGIQIFAYGL+LGMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL    +
Sbjct  79   LELAAVSLGNTGIQIFAYGLLLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTVLLMAASI  138

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             L L+YVFS+P+LI LG+  DI+SAAALFVYGLIP+
Sbjct  139  PLTLLYVFSKPLLILLGEPNDIASAAALFVYGLIPQ  174



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 145/179 (81%), Gaps = 9/179 (5%)
 Frame = +3

Query  99   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAPA
Sbjct  8    AQYQPIIES---------EATDASCRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAPA  58

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGMGSAVETLCGQA+G
Sbjct  59   VFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGMGSAVETLCGQAYG  118

Query  459  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            AG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG++  ++SAAALFVYGLIP+
Sbjct  119  AGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLGESTAVASAAALFVYGLIPQ  177



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S  LESIL DT  P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLGN
Sbjct  15   SGRLESILSDTSTPLARRAWAATAIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLGN  74

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS VLLTLTGV
Sbjct  75   LELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRSAVLLTLTGV  134

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             LA++Y FSEP+L+F+GQ+P I+ A+A+FVYGLIP+
Sbjct  135  PLAVVYAFSEPLLVFMGQSPAIARASAIFVYGLIPQ  170



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/206 (61%), Positives = 153/206 (74%), Gaps = 18/206 (9%)
 Frame = +3

Query  33   EQAAPRFPPHHLTNSVMDSSNG---AAYDPLP--ESDGVVSSPPHEESEASNELESILMD  197
            E ++P   P H      D  +G    A  PLP   +DG            S +LESIL D
Sbjct  9    ELSSPLIFPAH------DDGHGLPLQASTPLPPVAADGTAHG-------TSGKLESILND  55

Query  198  TGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGN  377
            T IP  +R+ LA+ IE++LL  LAAPA++VY+IN++MSMSTQIFSGHLGN+ELAAASLGN
Sbjct  56   TSIPWLRRVGLASLIEMRLLLSLAAPAIIVYLINFVMSMSTQIFSGHLGNVELAAASLGN  115

Query  378  TGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSE  557
            TGIQIFAYG+MLGMGSAVETLCGQA+GA KYE+LG+YLQRSTVLL  TGV LA+IY  S 
Sbjct  116  TGIQIFAYGIMLGMGSAVETLCGQAYGAHKYEMLGVYLQRSTVLLMATGVPLAVIYALSR  175

Query  558  PILIFLGQAPDISSAAALFVYGLIPK  635
            PIL+ LG++ DI+ AA++FVYGLIP+
Sbjct  176  PILVLLGESRDIARAASVFVYGLIPQ  201



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATEVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvll  533
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRSTVLL  TGV L
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRSTVLLMATGVPL  163

Query  534  alIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            A+IY FS PIL+ LG++P+I+SAAA+FVYGL+P+
Sbjct  164  AVIYAFSRPILVLLGESPEIASAAAVFVYGLVPQ  197



>gb|AAS01962.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
Length=534

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATGVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvll  533
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRSTVLL  TGV L
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRSTVLLMATGVPL  163

Query  534  alIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            A+IY FS PIL+ LG++P+I+SAAA+FVYGL+P+
Sbjct  164  AVIYAFSRPILVLLGESPEIASAAAVFVYGLVPQ  197



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATGVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvll  533
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRSTVLL  TGV L
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRSTVLLMATGVPL  163

Query  534  alIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            A+IY FS PIL+ LG++P+I+SAAA+FVYGL+P+
Sbjct  164  AVIYAFSRPILVLLGESPEIASAAAVFVYGLVPQ  197



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
             LESIL D   P  +R   A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGHLGNLE
Sbjct  16   RLESILTDASSPWTRRAWAAGGIELRLLARLAAPAVVMYMINYLMSMSTQIFSGHLGNLE  75

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvll  533
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS VLL  TG+ L
Sbjct  76   LAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAYGAQKYEMLGIYLQRSAVLLCGTGIPL  135

Query  534  alIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            A+IY FSEPIL+ LGQ+P+I+ AA++FVYGLIP+
Sbjct  136  AVIYAFSEPILVLLGQSPEIARAASIFVYGLIPQ  169



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H++    +ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+ Y++N ++SMSTQIF
Sbjct  15   HDDETVGDELEQILTDTEAPYFKRIRSASWVELKLLLHLAAPAVIDYLLNNVVSMSTQIF  74

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
             GHLGNLELAA SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA ++E+LGIYLQRS VL
Sbjct  75   CGHLGNLELAAVSLGNNGIQVFAYGLMLGMGSAVETLCGQAYGANRHEMLGIYLQRSAVL  134

Query  510  ltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            L  TG+ L +IY+FS+PILI LG+  +I+SAAA+FV+GLIP+
Sbjct  135  LMATGIPLMMIYIFSKPILILLGEPVNIASAAAVFVFGLIPQ  176



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  120  ESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  299
            ++  + S   H +   SNELE IL +   P  +R++LA+W+ELKLL  LAAPAV+VY++N
Sbjct  4    DTSRLSSKVSHHDETVSNELEEILTNNQSPYSKRVRLASWVELKLLFQLAAPAVIVYLLN  63

Query  300  YLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELL  479
             ++SMSTQIF GHLGNLELAA SLGN GIQ+FAYGL+LGMGSAVETLCGQA+GA  YE+L
Sbjct  64   NVISMSTQIFCGHLGNLELAAVSLGNNGIQVFAYGLLLGMGSAVETLCGQAYGANSYEIL  123

Query  480  GIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            GIYLQRST+LL L  + L +IY+FS+PILI LG+  +I+SAAA+FV GLIP+
Sbjct  124  GIYLQRSTILLMLAALPLLVIYIFSKPILILLGEPVNIASAAAVFVRGLIPQ  175



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLAAPA++VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELETLLSNTHLPLLHRYTQATWIEMKLLFYLAAPAILVYMMNYLMTMFTQIFS  71

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLGNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA K+E+LGIYLQRS +LL
Sbjct  72   GHLGNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYGAEKHEMLGIYLQRSAILL  131

Query  513  tltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            TLTG +L ++Y+F +PILI LG++  I+SAA +FVYGLIP+
Sbjct  132  TLTGFVLTIVYIFCKPILIILGESNQIASAAEVFVYGLIPQ  172



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 144/177 (81%), Gaps = 4/177 (2%)
 Frame = +3

Query  117  PESDG----VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            P SD     ++S  P    E+S ELE IL DT  P  +RL  A  +E +LL +LA PAV+
Sbjct  16   PPSDHASPPLLSPSPKTSHESSGELERILTDTTRPFLRRLGPALLMESRLLFHLAGPAVI  75

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYMINYLMSMSTQI SGHLGNLELAA+SLGN G+QIFAYGLMLGMGSAVETLCGQA+GA 
Sbjct  76   VYMINYLMSMSTQIVSGHLGNLELAASSLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAQ  135

Query  465  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            KY +LGIYLQRST+LLTLTG+LL ++Y+FS+PIL+FLG++  I+SAAALF+YGLIP+
Sbjct  136  KYGMLGIYLQRSTILLTLTGILLTVVYIFSKPILLFLGESEKIASAAALFIYGLIPQ  192



>gb|KJB57729.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=357

 Score =   206 bits (524),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 149/192 (78%), Gaps = 2/192 (1%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
              L + ++++S    +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  5    QELNHPILNNSMDDDHQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  599
            GSAVETLCGQA+GA +Y++LGIYLQRS ++LTLTG+ L L Y+FS+PIL+ LG+  +++S
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRSIIVLTLTGIPLMLAYIFSKPILMLLGEPAEVAS  182

Query  600  AAALFVYGLIPK  635
            AAA+FVYGLIP+
Sbjct  183  AAAIFVYGLIPQ  194



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = +3

Query  117  PESDGVVSSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P S  ++SS          + ELE IL DT I    R + ATWIE+KLL YLAAPAV VY
Sbjct  16   PASAALLSSHSLCSNHHGGNEELERILSDTEISVMDRYRRATWIEIKLLFYLAAPAVFVY  75

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            +INY MS STQIFSGHLGNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA ++
Sbjct  76   IINYTMSTSTQIFSGHLGNLELAASSLGNNGIQVFAYGLMLGMGSAVETLCGQAYGAERF  135

Query  471  ELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            E+LGIYLQRST+LLT+TG+ L + Y+F +PIL+FLG++ DI+SAA +FVYGLIP+
Sbjct  136  EMLGIYLQRSTILLTITGIFLTIPYIFCKPILLFLGESKDIASAAEIFVYGLIPQ  190



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 139/175 (79%), Gaps = 2/175 (1%)
 Frame = +3

Query  117  PESDGVVSSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P S  ++SS          + ELE IL DT +   +R   ATWIE+KLL YLAAPAV VY
Sbjct  16   PASAALLSSHSLCSNHHGGNEELERILSDTEMSAMERYSRATWIEIKLLFYLAAPAVFVY  75

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            +INY MS STQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA ++
Sbjct  76   IINYAMSTSTQIFSGHLGNLELAAASLGNNGIQVFAYGLMLGMGSAVETLCGQAYGAERF  135

Query  471  ELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            E+LGIYLQRS +LLT+TG+ L + YVF +PIL+FLG++ DI+SAA +FVYGLIP+
Sbjct  136  EMLGIYLQRSAILLTITGLFLTIPYVFCKPILLFLGESKDIASAAEVFVYGLIPQ  190



>ref|XP_003562350.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=512

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +3

Query  171  NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNL  350
             +LESIL D  +P  +R+  AT +EL++L  LAAPAV+VYMINYLMSMSTQIFSGHLG L
Sbjct  33   RQLESILSDESVPWGRRMCAATAVELRMLIRLAAPAVLVYMINYLMSMSTQIFSGHLGTL  92

Query  351  ELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvl  530
            ELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K+++LGIY+QRSTVLL  TGV 
Sbjct  93   ELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGASKFDMLGIYMQRSTVLLMATGVP  152

Query  531  lalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LA++Y FS PIL+ LG++P+I+ AAA+FVYGLIP+
Sbjct  153  LAVLYAFSRPILVLLGESPEIARAAAIFVYGLIPQ  187



>ref|XP_004173828.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=307

 Score =   204 bits (518),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLA PA+ VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELENLLSNTHLPLLHRYTQATWIEMKLLFYLATPAIFVYMMNYLMTMFTQIFS  71

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA K+E+LGIYLQ+S +LL
Sbjct  72   GHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKHEMLGIYLQKSAILL  131

Query  513  tltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            TLTG +L ++Y+  +PILI LG++  I+SAA +FVYGLIP+
Sbjct  132  TLTGFVLTIVYISCKPILIILGESNKIASAAEVFVYGLIPQ  172



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  132  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            ++S         S+ELE  L +T +P + RL+ ATW+ELK+L  LAAPAVVVY++N ++S
Sbjct  15   LISKRSSSVQPVSSELEETLSNTELPYFHRLRRATWVELKILFRLAAPAVVVYLLNNVIS  74

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
            MSTQI+ GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYL
Sbjct  75   MSTQIYCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYL  134

Query  492  QRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            QRST+LL  TG+ +  IY+FS+P+L+ LG++  I+SAAA+FVYGLIP+
Sbjct  135  QRSTILLMATGIPVMFIYIFSKPLLLALGESSTIASAAAIFVYGLIPQ  182



>ref|XP_006389634.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
 gb|ERP48548.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
Length=486

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 150/194 (77%), Gaps = 7/194 (4%)
 Frame = +3

Query  60   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  4    NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  58

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
            T+IELK L  LA PAVVVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  59   TFIELKTLFQLAGPAVVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  118

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDI  593
            GMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL  TG+ L +IY+FS+ +LI LG++  I
Sbjct  119  GMGSAVETLCGQAYGAHKYEILGIYLQRSTVLLMATGIPLMMIYIFSKSLLILLGESDTI  178

Query  594  SSAAALFVYGLIPK  635
            +SAAA+FVYGLIP+
Sbjct  179  ASAAAIFVYGLIPQ  192



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 145/177 (82%), Gaps = 4/177 (2%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            DP P  D  +S   H++    +ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+V
Sbjct  4    DP-PRLDFKLSY--HDDETVGDELEQILTDTEAPYFKRIRSASWVELKLLFHLAAPAVIV  60

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N ++SMSTQIF GHLGNLELAA SLGN GIQ+FAYGLMLGMGSAVETLCGQA+G+ +
Sbjct  61   YLLNNVVSMSTQIFCGHLGNLELAAVSLGNNGIQMFAYGLMLGMGSAVETLCGQAYGSNR  120

Query  468  YELLGIYLQRStvlltltgvl-lalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            +E+LGIYLQRSTVLL  TG+  L +IY+FS+PILI LG+  +I+SAAA+FV+GLIP+
Sbjct  121  HEMLGIYLQRSTVLLMATGIFPLMMIYIFSKPILILLGEPANIASAAAVFVFGLIPQ  177



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 148/195 (76%), Gaps = 10/195 (5%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESD---GVVSSPPHEES-------EASNELESILMDTGIPRWQRLKL  230
            M ++  AA D  P         S+PP   +       E S +LESIL D  +P  +R+  
Sbjct  1    MGNAAEAAGDSKPLQSPLLAACSAPPPATTSGGGGGHEVSGQLESILSDGSLPWPRRVLA  60

Query  231  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLM  410
            A+ +EL+LL  LAAPAVVVYMINYLMSMSTQIFSGHLG LELAAASLGN GIQ+FAYGLM
Sbjct  61   ASAVELRLLARLAAPAVVVYMINYLMSMSTQIFSGHLGTLELAAASLGNNGIQMFAYGLM  120

Query  411  LGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPD  590
            LGMGSAVETLCGQA+GA K+++LGIYLQR+T+LL  TGV LA+IY FS PILI LG++P+
Sbjct  121  LGMGSAVETLCGQAYGALKHDMLGIYLQRATILLMATGVPLAVIYAFSRPILILLGESPE  180

Query  591  ISSAAALFVYGLIPK  635
            I+ AAA+FVYGLIP+
Sbjct  181  IAGAAAVFVYGLIPQ  195



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 149/192 (78%), Gaps = 2/192 (1%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
              L + ++++S    +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  5    QELNHPILNNSMDDDHQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  599
            GSAVETLCGQA+GA +Y++LGIYLQRS ++LTLTG+ L L Y+FS+PIL+ LG+  +++S
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRSIIVLTLTGIPLMLAYIFSKPILMLLGEPAEVAS  182

Query  600  AAALFVYGLIPK  635
            AAA+FVYGLIP+
Sbjct  183  AAAIFVYGLIPQ  194



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +3

Query  147  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            P  E      LESIL D+ +P  +R   AT +EL  L  L APAVV+YMINYLMSMSTQI
Sbjct  3    PGGEDGGGGRLESILTDSSLPLGERAWAATRVELGTLARLVAPAVVMYMINYLMSMSTQI  62

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            FSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRS V
Sbjct  63   FSGHLGNLELAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAYGAQKYDMLGVYLQRSAV  122

Query  507  lltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LL+ TG+ LA+IY FSEPIL+FLGQ+ +I+ AA++FVYGLIP+
Sbjct  123  LLSCTGIPLAVIYAFSEPILLFLGQSLEIARAASIFVYGLIPQ  165



>ref|XP_011048000.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=505

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 150/194 (77%), Gaps = 7/194 (4%)
 Frame = +3

Query  60   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  22   NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  76

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
            T+IELK L  LA PA+VVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  77   TFIELKTLFQLAGPAIVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  136

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDI  593
            GMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL  TG+ L +IY+FS+ +LI LG++  I
Sbjct  137  GMGSAVETLCGQAYGAQKYEMLGIYLQRSTVLLMATGIPLMMIYIFSKSLLILLGESDTI  196

Query  594  SSAAALFVYGLIPK  635
            +SAAA+FVYGLIP+
Sbjct  197  ASAAAIFVYGLIPQ  210



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score =   207 bits (527),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 149/192 (78%), Gaps = 2/192 (1%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
              L + ++++S    +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  5    QELNHPILNNSMDDDHQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  599
            GSAVETLCGQA+GA +Y++LGIYLQRS ++LTLTG+ L L Y+FS+PIL+ LG+  +++S
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRSIIVLTLTGIPLMLAYIFSKPILMLLGEPAEVAS  182

Query  600  AAALFVYGLIPK  635
            AAA+FVYGLIP+
Sbjct  183  AAAIFVYGLIPQ  194



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score =   206 bits (525),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERVWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G  KY++LG YLQRS V+L
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYGGHKYDMLGTYLQRSAVIL  124

Query  513  tltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
              TG+ LA+IY FSEPIL+ LGQ+P+I+ AA++FVYGLIP+
Sbjct  125  CCTGIPLAVIYAFSEPILLLLGQSPEIARAASIFVYGLIPQ  165



>ref|XP_011047999.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=534

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 150/194 (77%), Gaps = 7/194 (4%)
 Frame = +3

Query  60   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  22   NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  76

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
            T+IELK L  LA PA+VVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  77   TFIELKTLFQLAGPAIVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  136

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDI  593
            GMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL  TG+ L +IY+FS+ +LI LG++  I
Sbjct  137  GMGSAVETLCGQAYGAQKYEMLGIYLQRSTVLLMATGIPLMMIYIFSKSLLILLGESDTI  196

Query  594  SSAAALFVYGLIPK  635
            +SAAA+FVYGLIP+
Sbjct  197  ASAAAIFVYGLIPQ  210



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = +3

Query  141  SPPHEESEASN-ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            +P       SN ELE IL D  +P  +R+  A  +E +LL +LAAPAVVVY+INY+MSMS
Sbjct  19   TPRSNSKHGSNGELERILTDDTLPFLRRVGAALCVEFRLLFFLAAPAVVVYLINYVMSMS  78

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            TQIFSGHLGNLELAA++LGN GIQ+FAYGLMLGMGSAVETLCGQA+GA K+ +LG+Y+QR
Sbjct  79   TQIFSGHLGNLELAASALGNNGIQVFAYGLMLGMGSAVETLCGQAYGARKFGMLGVYMQR  138

Query  498  StvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            STVLL+L G+++ +IY FSE IL+FLGQ+ +I++AAALFVYGLIP+
Sbjct  139  STVLLSLAGIVVTVIYAFSERILLFLGQSEEIAAAAALFVYGLIPQ  184



>ref|XP_008664995.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
 tpg|DAA50101.1| TPA: putative MATE efflux family protein [Zea mays]
Length=500

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 133/158 (84%), Gaps = 5/158 (3%)
 Frame = +3

Query  165  ASNELESILMDTGIPR-WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            AS +LES+L  +     W     A  IEL+LL  LAAPAVV YMINYLMSMSTQIFSGHL
Sbjct  11   ASAQLESVLTSSSSSFPWA----AAAIELRLLTRLAAPAVVTYMINYLMSMSTQIFSGHL  66

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            GNLELAAASLGNTG+QIFAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS VLL  T
Sbjct  67   GNLELAAASLGNTGVQIFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSAVLLCAT  126

Query  522  gvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            GV LA+IY FSEPIL+FLGQ+P+I+ AAA+FVYGLIP+
Sbjct  127  GVPLAVIYAFSEPILVFLGQSPEIARAAAIFVYGLIPQ  164



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 150/192 (78%), Gaps = 2/192 (1%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
              L + ++++S    +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  5    QELNHPILNNSMDDDHQHLLPSDG--SSGASHGHEVDSGLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  599
            GSAVETLCGQA+GA +Y++LGIYLQRST++LTLTG+ L L Y+FS+PIL+ LG+  +++S
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRSTIVLTLTGIPLMLAYIFSKPILMLLGEPAEVAS  182

Query  600  AAALFVYGLIPK  635
            AAA+FVYGLIP+
Sbjct  183  AAAVFVYGLIPQ  194



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERMWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G  KY++LG YLQRS V+L
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYGGHKYDMLGTYLQRSAVIL  124

Query  513  tltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
              TG+ LA+IY FSEP+L+ LGQ+P+I+ AA++FVYGLIP+
Sbjct  125  CCTGIPLAVIYAFSEPLLLLLGQSPEIARAASIFVYGLIPQ  165



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERMWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G  KY++LG YLQRS V+L
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYGGHKYDMLGTYLQRSAVIL  124

Query  513  tltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
              TG+ LA+IY FSEP+L+ LGQ+P+I+ AA++FVYGLIP+
Sbjct  125  CCTGIPLAVIYAFSEPLLLLLGQSPEIARAASIFVYGLIPQ  165



>ref|XP_006449716.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62956.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=508

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 146/190 (77%), Gaps = 6/190 (3%)
 Frame = +3

Query  66   LTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIE  245
            + +S  D +N   ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIE
Sbjct  1    MDSSNTDINNNNVHEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIE  54

Query  246  LKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGS  425
            LK L  LAAPA++VYM+N L+SMSTQIF GHLGNLELAA SLG+TGIQ+FA+GLMLGMGS
Sbjct  55   LKNLFRLAAPAILVYMLNNLVSMSTQIFCGHLGNLELAAVSLGSTGIQVFAFGLMLGMGS  114

Query  426  AVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAA  605
            A ETLCGQA+GA KY++LG+YLQRS V+LT TG+ L +IY+FS+ IL+ LG++  I+SAA
Sbjct  115  ATETLCGQAYGAQKYDMLGVYLQRSAVILTATGIPLMVIYIFSKQILLLLGESSAIASAA  174

Query  606  ALFVYGLIPK  635
             +FV+GLIP+
Sbjct  175  TIFVFGLIPQ  184



>gb|KCW76957.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=458

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 139/184 (76%), Gaps = 14/184 (8%)
 Frame = +3

Query  126  DGVVSSPPHEESE--------------ASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
            DG+++S   ++ +               S+ LE +L DT +PR++RL  AT IEL  L  
Sbjct  7    DGIIASDESDQHQEPLLQPKQQPTAETVSSALEDMLSDTELPRFRRLSRATRIELNTLFR  66

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPAVVVY++N + SMSTQIF GHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLC
Sbjct  67   LAAPAVVVYLLNNVTSMSTQIFCGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLC  126

Query  444  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYG  623
            GQA+GA KYE+LG+YLQRST+LL  T + +  IY+FS+ +L+ LG++  I+SAAA+FVYG
Sbjct  127  GQAYGAHKYEMLGVYLQRSTILLMATAIPVMFIYIFSKQLLLLLGESTSIASAAAVFVYG  186

Query  624  LIPK  635
            LIP+
Sbjct  187  LIPQ  190



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 139/177 (79%), Gaps = 7/177 (4%)
 Frame = +3

Query  111  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P P SD V        S +S+ELE +L D  +P  +R + ATWIELKLL  LAAPAV++Y
Sbjct  18   PPPPSDAV-------ASHSSSELEKVLSDADLPCLKRYRKATWIELKLLFKLAAPAVMMY  70

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            +IN  MSMST+IFSGHLGNLE AAA LGN GIQ+FAYGL+LGMGSAVETLCGQA+GAG+Y
Sbjct  71   LINNAMSMSTRIFSGHLGNLEFAAACLGNQGIQLFAYGLLLGMGSAVETLCGQAYGAGRY  130

Query  471  ELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPKSL  641
            E+LG+YLQR+TV+L +  + + ++YV S P+L+F+G++  +++ A++FVYGLIP+ L
Sbjct  131  EMLGVYLQRATVVLMMFSLPIVVVYVLSRPLLLFIGESKQVATLASVFVYGLIPQVL  187



>gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLA PA+ VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELENLLSNTHLPLLHRYTQATWIEMKLLFYLATPAIFVYMMNYLMTMFTQIFS  71

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA K+E+LGIYLQ+S +LL
Sbjct  72   GHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKHEMLGIYLQKSAILL  131

Query  513  tltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            TLTG +L ++Y+  +PILI LG++  I+SAA +FVYGLIP+
Sbjct  132  TLTGFVLTIVYISCKPILIILGESNKIASAAEVFVYGLIPQ  172



>ref|XP_010052837.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76956.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=514

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 139/184 (76%), Gaps = 14/184 (8%)
 Frame = +3

Query  126  DGVVSSPPHEESE--------------ASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
            DG+++S   ++ +               S+ LE +L DT +PR++RL  AT IEL  L  
Sbjct  7    DGIIASDESDQHQEPLLQPKQQPTAETVSSALEDMLSDTELPRFRRLSRATRIELNTLFR  66

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPAVVVY++N + SMSTQIF GHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLC
Sbjct  67   LAAPAVVVYLLNNVTSMSTQIFCGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLC  126

Query  444  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYG  623
            GQA+GA KYE+LG+YLQRST+LL  T + +  IY+FS+ +L+ LG++  I+SAAA+FVYG
Sbjct  127  GQAYGAHKYEMLGVYLQRSTILLMATAIPVMFIYIFSKQLLLLLGESTSIASAAAVFVYG  186

Query  624  LIPK  635
            LIP+
Sbjct  187  LIPQ  190



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +3

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM
Sbjct  41   IELRLLTRLAAPAVVMYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  100

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  599
            GSAVETLCGQA+GA KY++LGIYLQRS VLL  TGV LA++Y FSEPIL+FLGQ+P+I+ 
Sbjct  101  GSAVETLCGQAYGAQKYDMLGIYLQRSAVLLCATGVPLAVVYAFSEPILVFLGQSPEIAR  160

Query  600  AAALFVYGLIPK  635
            AA++FVYGLIP+
Sbjct  161  AASIFVYGLIPQ  172



>gb|KDP20756.1| hypothetical protein JCGZ_21227 [Jatropha curcas]
Length=999

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE IL +T     QR + AT +ELK L YLAAPA+VVY++N ++SMSTQI  GHLGN
Sbjct  30   SDELEQILCNTQFTYLQRTRKATLVELKTLFYLAAPAIVVYLLNNVVSMSTQILVGHLGN  89

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GAGKY++LG+YLQRST+LLT TG+
Sbjct  90   LELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAGKYDMLGVYLQRSTILLTATGI  149

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             + LIYVFS+PILI LG++ +I+SAAA+FVYGLIP+
Sbjct  150  PITLIYVFSKPILILLGESKEIASAAAVFVYGLIPQ  185


 Score =   196 bits (499),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 143/201 (71%), Gaps = 13/201 (6%)
 Frame = +3

Query  33   EQAAPRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPR  212
            E+   +F  +   N + ++ N       P        PP      S+ELE IL +  +  
Sbjct  488  EEKREKFSTYRKINHMANNQNSLLRKHSP--------PP-----VSSELEDILSNMELSY  534

Query  213  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQI  392
             QRLK A  +ELK L  LA PAV+VY++N ++SMSTQIF GHLGNLELAAASLGNTGIQ+
Sbjct  535  SQRLKSAVLVELKTLFLLAGPAVIVYLLNNVVSMSTQIFCGHLGNLELAAASLGNTGIQV  594

Query  393  FAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIF  572
            FAYGLMLGMGSAVETLCGQA+GA KYE+LG+YLQRSTV+LT  G+ L LIY FS+ IL+ 
Sbjct  595  FAYGLMLGMGSAVETLCGQAYGAHKYEMLGVYLQRSTVILTAAGIPLTLIYAFSKQILLL  654

Query  573  LGQAPDISSAAALFVYGLIPK  635
            LG++ +I++ AA+FVYGLIP+
Sbjct  655  LGESKEIAAQAAVFVYGLIPQ  675



>gb|KJB69294.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=497

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 145/198 (73%), Gaps = 13/198 (7%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES-------------EASNELESILMDTGIPRWQR  221
            MDS     + PL  S      PP                 +  ++LE +L+D  +P ++R
Sbjct  1    MDSQQEQLHQPLQNSMHGHRQPPQTPELSSSESSDAGSVYDVDSKLEKVLLDNELPYFKR  60

Query  222  LKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAY  401
            L+LA+WIEL+LL +LA PAV VY+IN  MS+ST+I+ GHLGNLELAAASLGN+GIQ+ AY
Sbjct  61   LRLASWIELRLLFHLAGPAVFVYLINNFMSLSTRIYCGHLGNLELAAASLGNSGIQLLAY  120

Query  402  GLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQ  581
            GLMLGMGSAVETLCGQA+GA +Y +LG+YLQRST++LTLTG+ L L+YVFS+PI+I LG+
Sbjct  121  GLMLGMGSAVETLCGQAYGAHRYSMLGVYLQRSTIVLTLTGIPLVLVYVFSKPIMIVLGE  180

Query  582  APDISSAAALFVYGLIPK  635
            +  ++S  A+FVYGLIP+
Sbjct  181  STAVASGTAVFVYGLIPQ  198



>ref|XP_008664994.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
Length=493

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 134/161 (83%), Gaps = 3/161 (2%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            + ++AS  LESIL             A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFS
Sbjct  5    DGADASERLESILTAEAA---ASPWAAAAIELRLLTRLAAPAVVMYMINYLMSMSTQIFS  61

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLGNLELAAASLGN G+Q+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS VLL
Sbjct  62   GHLGNLELAAASLGNAGVQMFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSAVLL  121

Query  513  tltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             +TGV LA+IY FSEPIL+FLGQ+P+I+ AA++FVYGLIP+
Sbjct  122  CVTGVPLAVIYAFSEPILVFLGQSPEIARAASVFVYGLIPQ  162



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 145/198 (73%), Gaps = 13/198 (7%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES-------------EASNELESILMDTGIPRWQR  221
            MDS     + PL  S      PP                 +  ++LE +L+D  +P ++R
Sbjct  1    MDSQQEQLHQPLQNSMHGHRQPPQTPELSSSESSDAGSVYDVDSKLEKVLLDNELPYFKR  60

Query  222  LKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAY  401
            L+LA+WIEL+LL +LA PAV VY+IN  MS+ST+I+ GHLGNLELAAASLGN+GIQ+ AY
Sbjct  61   LRLASWIELRLLFHLAGPAVFVYLINNFMSLSTRIYCGHLGNLELAAASLGNSGIQLLAY  120

Query  402  GLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQ  581
            GLMLGMGSAVETLCGQA+GA +Y +LG+YLQRST++LTLTG+ L L+YVFS+PI+I LG+
Sbjct  121  GLMLGMGSAVETLCGQAYGAHRYSMLGVYLQRSTIVLTLTGIPLVLVYVFSKPIMIVLGE  180

Query  582  APDISSAAALFVYGLIPK  635
            +  ++S  A+FVYGLIP+
Sbjct  181  STAVASGTAVFVYGLIPQ  198



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL DT  P  +R   A  +EL+LL  LAAPAVVVYMIN++MSMSTQI  GHLG
Sbjct  13   ASCRLESILTDTSAPLAERAWAAGTVELRLLARLAAPAVVVYMINFVMSMSTQILCGHLG  72

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
             LELAAASLGNTG+Q FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRS +LL LTG
Sbjct  73   TLELAAASLGNTGVQTFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSVILLALTG  132

Query  525  vllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            + LA++Y FSEP+L+ +GQ+P+I+ AA++FVYGLIP+
Sbjct  133  IPLAVMYAFSEPLLLLMGQSPEIARAASIFVYGLIPQ  169



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            +D +    + PL       S  P      S+ LE  L D  +  + R++ ATWIEL +L 
Sbjct  9    IDCAENEVHQPLLHYYKSFSPEPC----VSDLLEDTLSDNSLSLFWRIQRATWIELGILF  64

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAVVVY+ N L+SMSTQIF GHLGNLELAAASLGN GIQ FAYGLMLGMGSAVETL
Sbjct  65   HLAAPAVVVYLFNNLISMSTQIFCGHLGNLELAAASLGNNGIQTFAYGLMLGMGSAVETL  124

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQA+GA KY +LGIYLQRST+LL  TG+ L +IY+FS+PIL+ LG++P I+SAAA+F Y
Sbjct  125  CGQAYGANKYGMLGIYLQRSTILLMATGIPLMIIYIFSKPILLLLGESPTIASAAAVFTY  184

Query  621  GLIPK  635
            GLIP+
Sbjct  185  GLIPQ  189



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 133/163 (82%), Gaps = 1/163 (1%)
 Frame = +3

Query  150  HE-ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            HE E  AS  LESIL DT  P   R  LA  +EL+LL  LA PAVVVYMIN++MSMSTQI
Sbjct  7    HEHEHAASCRLESILTDTSAPLATRAWLAGAVELRLLARLATPAVVVYMINFVMSMSTQI  66

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
              GHLG LELAAASLGNTG+Q  AYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRS +
Sbjct  67   LCGHLGTLELAAASLGNTGVQTMAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSVI  126

Query  507  lltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LL LTG+ LA++Y FSEP+L+ +GQ+P+I+ AA++FVYGLIP+
Sbjct  127  LLGLTGIPLAVMYAFSEPLLLLMGQSPEIARAASIFVYGLIPQ  169



>ref|XP_007212447.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
 gb|EMJ13646.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
Length=490

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 142/173 (82%), Gaps = 7/173 (4%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P     EASN+       LE +L DT +P ++RL+LATWIEL LL  LAAPAV+VY++
Sbjct  15   SEPDSTALEASNQGDGLESPLEKVLSDTQLPSFKRLRLATWIELNLLFRLAAPAVLVYVV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  476
            N  MS+ST++F+GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA KY++
Sbjct  75   NNFMSLSTRVFAGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGAEKYDM  134

Query  477  LGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LGIYLQR+T++LTLTG+ L LI++ S+PILI  G+ P +++ AA+FVYGLIP+
Sbjct  135  LGIYLQRATIVLTLTGLPLLLIFLLSKPILILFGETPKLAAEAAVFVYGLIPQ  187



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 138/181 (76%), Gaps = 4/181 (2%)
 Frame = +3

Query  93   NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAA  272
            N     PL E+      PP    E S++LE IL D G+    R K ATW+ELKLL  LAA
Sbjct  7    NRRLKQPLVENQ----PPPPVGEEVSSDLEQILTDDGLTFSTRYKKATWVELKLLTRLAA  62

Query  273  PAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA  452
            PA++VY++N L++MSTQIF G LGNLELA ++L N GIQ+F YG+MLGMGSAVETLCGQA
Sbjct  63   PAIIVYLLNNLLNMSTQIFCGQLGNLELAGSALANNGIQLFVYGVMLGMGSAVETLCGQA  122

Query  453  FGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIP  632
            +GA KYE+LGIYLQRST+LL  TG+ L  +Y+FS+P+L+ LG++ D+++AAALFVYGLIP
Sbjct  123  YGAHKYEMLGIYLQRSTILLVATGIPLLFLYIFSKPLLLLLGESRDVAAAAALFVYGLIP  182

Query  633  K  635
            +
Sbjct  183  Q  183



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 140/172 (81%), Gaps = 6/172 (3%)
 Frame = +3

Query  138  SSPPHE------ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  299
            S P +E        E S+ LE +L DT +P ++RL+LATWIELKLL  LAAPAV VY++N
Sbjct  13   SEPAYESLASASHGEESSSLEKVLSDTQLPYFKRLRLATWIELKLLFRLAAPAVFVYVVN  72

Query  300  YLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELL  479
              MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA  Y++L
Sbjct  73   NTMSVSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYGAQMYDML  132

Query  480  GIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            GIYLQR+TV+L++TG+ L  +++ S+PIL+  G++  ++S AA+FVYGLIP+
Sbjct  133  GIYLQRATVVLSITGIPLLAVFILSKPILLLFGESSALASVAAVFVYGLIPQ  184



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = +3

Query  147  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            PH+     ++LE++L D  +  + RL+LATWIELKLL YLAAPAV+VYMIN  MS+ST+I
Sbjct  32   PHQ---VDSKLETVLTDMELTYFNRLRLATWIELKLLFYLAAPAVMVYMINNFMSLSTRI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+G+ +Y +LGIY+QR+ V
Sbjct  89   FAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYGSSRYNMLGIYMQRAMV  148

Query  507  lltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            +LT TG+ L +IYV S+P+L+ LG++ +++SAAA+FVYGLIP+
Sbjct  149  VLTATGIPLTIIYVLSKPLLLLLGESTEVASAAAVFVYGLIPQ  191



>ref|XP_010093281.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB53806.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=534

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 144/185 (78%), Gaps = 2/185 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+S N   ++P+  +    S    E    S+ELE  L ++ +  ++R + AT +ELK L 
Sbjct  1    MESINNDLHEPILATKEASSILSPEA--ISSELEETLSNSDLSYFRRFQAATCLELKTLY  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VY++N + SMSTQI  GHLGNL+LAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  59   RLAAPAVIVYLLNNVTSMSTQILCGHLGNLQLAAASLGNTGIQVFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQA+GA KYELLG+YLQRST+LL  TGV L LIY+FS+PILIFLG++  I+SAAA+FVY
Sbjct  119  CGQAYGAHKYELLGVYLQRSTILLMATGVPLTLIYIFSKPILIFLGESESIASAAAVFVY  178

Query  621  GLIPK  635
            GLIP+
Sbjct  179  GLIPQ  183



>gb|EYU29855.1| hypothetical protein MIMGU_mgv1a004845mg [Erythranthe guttata]
Length=507

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 140/186 (75%), Gaps = 9/186 (5%)
 Frame = +3

Query  84   DSSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
             S N    +PL  P S+G          E S+ELE +L DT +  W+R + A  IEL+ L
Sbjct  3    SSKNKGVSEPLLEPNSNG-------GTEEVSSELEDVLCDTTLSGWRRFQKAIVIELRYL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LA PAVVVY++N ++SMSTQIF GHLGNLELAA++LGN G+Q+ AYGLMLGMGSAVET
Sbjct  56   LRLAGPAVVVYLLNSVISMSTQIFCGHLGNLELAASALGNNGVQLLAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFV  617
            LCGQA+GA +YE+LGIY+QRS +LL  TG+ L LIY+FS+P+LI LG++  ++SAAALFV
Sbjct  116  LCGQAYGAQQYEMLGIYMQRSIILLMATGIPLMLIYIFSKPLLILLGESDRVASAAALFV  175

Query  618  YGLIPK  635
            YGLIP+
Sbjct  176  YGLIPQ  181



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 137/166 (83%), Gaps = 0/166 (0%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            ++P  ++ + + +LE IL DT +   +RL+ A  IELKLL +LA PA  VYMINY+MSMS
Sbjct  15   TNPDSDQPQNNEQLERILSDTQLSTLKRLQSAIVIELKLLFHLATPAAFVYMINYVMSMS  74

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T++FSGHLGNLELAA SLGN+GIQ+ AYGLMLGMGSAVETLCGQA+G  +YE+LGIYLQR
Sbjct  75   TRVFSGHLGNLELAAVSLGNSGIQLLAYGLMLGMGSAVETLCGQAYGGRRYEMLGIYLQR  134

Query  498  StvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            ST++L  TG+ +A++Y+FS+PILIFL +  +I+SAAA+F YGLIP+
Sbjct  135  STIILMATGIPIAVLYIFSKPILIFLHEPVEIASAAAVFTYGLIPQ  180



>ref|XP_009618512.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=418

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 139/177 (79%), Gaps = 6/177 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            +PL ES+     PP   +E  S ELE IL DT +   QR   A+ IEL+ L  LAAPA++
Sbjct  12   EPLLESE-----PPTLAAEQISPELEEILSDTSLSHLQRFGRASVIELRNLFRLAAPAII  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VY++N   SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+GA 
Sbjct  67   VYLLNNTTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGAH  126

Query  465  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            KYE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LGQ+  ++SAAALFVYGLIP+
Sbjct  127  KYEMLGIYLQRSTILLMLTGIPLTVAYLFSKPILILLGQSKKLASAAALFVYGLIPQ  183



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 140/176 (80%), Gaps = 5/176 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL ES+      P    + S+ELE IL DT + R QR + A+ IEL+ L  LAAP+++V
Sbjct  5    EPLLESE-----EPILAEQISSELEEILSDTSLSRIQRFRRASVIELRNLFRLAAPSIIV  59

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+G  K
Sbjct  60   YLLNNVTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGGHK  119

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            YE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LGQ+  ++SAAALFVYGLIP+
Sbjct  120  YEMLGIYLQRSTILLMLTGIPLMVAYLFSKPILILLGQSKKVASAAALFVYGLIPQ  175



>gb|EYU29854.1| hypothetical protein MIMGU_mgv1a005159mg [Erythranthe guttata]
Length=495

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 138/184 (75%), Gaps = 2/184 (1%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
              + GA   PL ES     + P    E S+ELE IL D  +  W+R + A+ IEL+    
Sbjct  4    SENKGAVNQPLLESYK--PALPEAAEEVSSELEEILSDATLSWWRRYQKASVIELRYFFR  61

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LA PAV+VY++N + SMSTQIF GHLGNLELAA+SLGN GIQ+ AYGLMLGMGSAVETLC
Sbjct  62   LAGPAVIVYLLNNVTSMSTQIFCGHLGNLELAASSLGNNGIQLLAYGLMLGMGSAVETLC  121

Query  444  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYG  623
            GQA+GA KYE+LGIY+QRS VLL +TG+ L L+Y+F +PIL+ LG++  ++SAAALFVYG
Sbjct  122  GQAYGAHKYEMLGIYMQRSVVLLMVTGLPLMLVYIFCKPILLLLGESKSVASAAALFVYG  181

Query  624  LIPK  635
            LIP+
Sbjct  182  LIPQ  185



>gb|EPS61219.1| hypothetical protein M569_13580, partial [Genlisea aurea]
Length=159

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            E S++LE  L +T +P+W+RL+ A  IEL++L  LA PAV+ Y++  ++S STQIF GH+
Sbjct  2    EVSSDLEDALSNTAVPQWRRLERAVRIELRILSRLAGPAVISYLLGNVISTSTQIFCGHI  61

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            GNLELAA+SLGN G+Q+ AYG+MLGMGSAVETLCGQA+GA +YE+LG+Y+QRST+LL  T
Sbjct  62   GNLELAASSLGNNGVQLLAYGVMLGMGSAVETLCGQAYGAHRYEMLGMYMQRSTILLMAT  121

Query  522  gvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            G+ L L Y FS P+L+ LG++  ++SAAALFVYGLIP+
Sbjct  122  GIPLMLFYAFSRPLLVLLGESERVASAAALFVYGLIPQ  159



>ref|XP_009798076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=509

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
                G   +PL ES+     P    ++ S+ELE IL DT +   QR   A+ +EL+ L  
Sbjct  5    SQDKGPPNEPLLESE----PPTLAAAKISSELEEILSDTSLSHLQRFGRASVVELRNLFR  60

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPA++VY++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLC
Sbjct  61   LAAPAIIVYLLNNITSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLC  120

Query  444  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYG  623
            GQA+GA KYE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LGQ+  ++SAAALFVYG
Sbjct  121  GQAYGAHKYEMLGIYLQRSTILLMLTGIPLTVAYLFSKPILILLGQSKKVASAAALFVYG  180

Query  624  LIPK  635
            LIP+
Sbjct  181  LIPQ  184



>ref|XP_011048004.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
 ref|XP_011048005.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE IL +  + R +RL  ATW+ELK+L  LAAPA+VVYM+N+L+S+STQ+F GHLGN
Sbjct  34   SSELEDILSNMELSRSKRLLRATWVELKILFPLAAPAIVVYMLNFLVSISTQMFCGHLGN  93

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAAASLGNTG+Q F +G+MLGMGSAVETLCGQA+GA KYE+LG+Y+QRST+LLTLTG+
Sbjct  94   LELAAASLGNTGVQGFVFGIMLGMGSAVETLCGQAYGANKYEMLGVYMQRSTILLTLTGL  153

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            +L  IY+F +PIL+ L ++P I+SAAALFVYGLIP+
Sbjct  154  ILMFIYIFCKPILLGLHESPAIASAAALFVYGLIPQ  189



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL ES+  + +    E + S+ELE IL DT +   QR K A+ IEL+ L  LAAPA++V
Sbjct  5    EPLLESESPILASAATE-KISSELEEILSDTSLSCIQRFKRASVIELRNLFRLAAPAIIV  63

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+G  K
Sbjct  64   YLLNNVTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGGHK  123

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            YE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LGQ+  ++SAAALFVYGLIP+
Sbjct  124  YEMLGIYLQRSTILLMLTGLPLMVAYLFSKPILILLGQSKKVASAAALFVYGLIPQ  179



>ref|XP_009618511.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=439

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 139/177 (79%), Gaps = 6/177 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            +PL ES+     PP   +E  S ELE IL DT +   QR   A+ IEL+ L  LAAPA++
Sbjct  12   EPLLESE-----PPTLAAEQISPELEEILSDTSLSHLQRFGRASVIELRNLFRLAAPAII  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VY++N   SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+GA 
Sbjct  67   VYLLNNTTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGAH  126

Query  465  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            KYE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LGQ+  ++SAAALFVYGLIP+
Sbjct  127  KYEMLGIYLQRSTILLMLTGIPLTVAYLFSKPILILLGQSKKLASAAALFVYGLIPQ  183



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 141/171 (82%), Gaps = 7/171 (4%)
 Frame = +3

Query  144  PPHEESEAS-------NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            PP  ES AS       + LE +L D  +  ++RL+LA+WIEL+L+  LAAPA+ VYMIN 
Sbjct  21   PPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIFSLAAPAIFVYMINN  80

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
             MS+ST++F GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA +Y +LG
Sbjct  81   AMSLSTRVFCGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGALRYNMLG  140

Query  483  IYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            +YLQRST++LTLTG+ LAL YVFS+PILI LG++  ++SA+A+FVYGLIP+
Sbjct  141  VYLQRSTIVLTLTGIPLALAYVFSKPILILLGESAMVASASAVFVYGLIPQ  191



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score =   199 bits (506),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 141/171 (82%), Gaps = 7/171 (4%)
 Frame = +3

Query  144  PPHEESEAS-------NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            PP  ES AS       + LE +L D  +  ++RL+LA+WIEL+L+  LAAPA+ VYMIN 
Sbjct  21   PPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIFSLAAPAIFVYMINN  80

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
             MS+ST++F GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA +Y +LG
Sbjct  81   AMSLSTRVFCGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGALRYNMLG  140

Query  483  IYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            +YLQRST++LTLTG+ LAL YVFS+PILI LG++  ++SA+A+FVYGLIP+
Sbjct  141  VYLQRSTIVLTLTGIPLALAYVFSKPILILLGESAMVASASAVFVYGLIPQ  191



>gb|EYU29852.1| hypothetical protein MIMGU_mgv1a004818mg [Erythranthe guttata]
Length=508

 Score =   199 bits (505),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 139/184 (76%), Gaps = 5/184 (3%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
              + G   DPL ES     S      E S+ELE +L DT +  W+R + A  IEL+ L  
Sbjct  4    SKNKGETTDPLLES-----SYGGGVEEVSSELEDVLCDTTLSGWRRFQKAIVIELRYLLR  58

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LA PAV+VY++N ++SMSTQIF GHLGNLELAA++LGN G+Q+ AYGLMLGMGSAVETLC
Sbjct  59   LAGPAVLVYLLNSVVSMSTQIFCGHLGNLELAASALGNNGVQLLAYGLMLGMGSAVETLC  118

Query  444  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYG  623
            GQA+GA +YE+LGIY+QRS +LL LTG+ L  +Y+FS+P+L+ LG++  ++SAAALFVYG
Sbjct  119  GQAYGAQQYEMLGIYMQRSVILLMLTGIPLTFVYIFSKPLLVLLGESDRVASAAALFVYG  178

Query  624  LIPK  635
            LIP+
Sbjct  179  LIPQ  182



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   198 bits (504),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL DT  P  +R  LA  +EL+LL  LAAPAVVVYMIN++MSMSTQI  GHLG
Sbjct  15   ASCLLESILTDTSAPLARRAWLAGAVELRLLARLAAPAVVVYMINFVMSMSTQILCGHLG  74

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
             LELAAASLGN G+Q FA+GLMLGMGSAVETLCGQA+GA KY++LGIYLQRS +LL LTG
Sbjct  75   TLELAAASLGNCGVQTFAFGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSVILLGLTG  134

Query  525  vllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            + LA++Y FSEP+L+ +GQ+P+I+ AA++FVYGLIP+
Sbjct  135  IPLAVMYAFSEPLLLLMGQSPEIARAASIFVYGLIPQ  171



>ref|XP_006389636.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
 gb|ERP48550.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
Length=513

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE IL +  + R +R+  ATW+ELK+L  LAAPA+VVYM+NYL+S+STQ+F GHLGN
Sbjct  34   SSELEDILSNMELSRSKRILRATWVELKILFPLAAPAIVVYMLNYLVSISTQMFCGHLGN  93

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAAASLGN G+Q F +G+MLGMGSAVETLCGQA+GA KYE+LG+Y+QRST+LLTLTG+
Sbjct  94   LELAAASLGNMGVQGFVFGIMLGMGSAVETLCGQAYGANKYEMLGVYMQRSTILLTLTGL  153

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            +L  IY+F +PIL+ L ++P I+SAAALFVYGLIP+
Sbjct  154  ILMFIYIFCKPILLGLHESPTIASAAALFVYGLIPQ  189



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +3

Query  132  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            +++S  H    A + LE +L D  +P  +R+  ATWIEL LL  LAAPA++VY+ N LMS
Sbjct  14   LINSTHHHHHSADSRLEEVLSDPTLPWSKRILSATWIELNLLFPLAAPAILVYVFNNLMS  73

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
              T+ F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+
Sbjct  74   NVTRAFAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYGANKYEMLGIYM  133

Query  492  QRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            QR+ ++LT+TG+ L ++Y+F +PIL+ LG+ P+++S AA+FVYGLIP+
Sbjct  134  QRAIIVLTITGIPLTVVYIFCKPILLLLGEPPEVASVAAMFVYGLIPQ  181



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +3

Query  132  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            +++S  H    A + LE +L D  +P  +R+  ATWIEL LL  LAAPA++VY+ N LMS
Sbjct  13   LINSTHHHHHSADSRLEEVLSDPTLPWSKRILSATWIELNLLFPLAAPAILVYVFNNLMS  72

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
              T+ F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+
Sbjct  73   NVTRAFAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYGANKYEMLGIYM  132

Query  492  QRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            QR+ ++LT+TG+ L ++Y+F +PIL+ LG+ P+++S AA+FVYGLIP+
Sbjct  133  QRAIIVLTITGIPLTVVYIFCKPILLLLGEPPEVASVAAMFVYGLIPQ  180



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE +L DT +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDTQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQR+TV+L++TG+
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRATVVLSVTGI  140

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             L ++Y+FS+ IL+ LG++  ++SAAA+FVYGLIP+
Sbjct  141  PLTVVYLFSKNILLALGESKLVASAAAVFVYGLIPQ  176



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE +L DT +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDTQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQR+TV+L++TG+
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRATVVLSVTGI  140

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             L ++Y+FS+ IL+ LG++  ++SAAA+FVYGLIP+
Sbjct  141  PLTVVYLFSKNILLALGESKLVASAAAVFVYGLIPQ  176



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S  LESIL D  +   +RL  AT +E++LL  LAAPAVVVYM+N L+S+ TQ+FSGHLGN
Sbjct  14   SRRLESILADLTMSWPRRLWSATTVEMQLLFPLAAPAVVVYMLNNLLSLGTQVFSGHLGN  73

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL  TG+
Sbjct  74   LELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTVLLMATGI  133

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             LA++Y FS P+L+ LGQ+P+I++AA++FVYGLIP+
Sbjct  134  PLAVVYAFSRPLLLLLGQSPEIATAASIFVYGLIPQ  169



>gb|EPS67796.1| hypothetical protein M569_06975, partial [Genlisea aurea]
Length=484

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            E S+ LE +L +  + RW+RL+ AT IELK+LC LA PAVV Y++  ++SMSTQIF GH+
Sbjct  13   EISSHLEDVLSNAEMARWRRLQKATSIELKILCRLAGPAVVSYLLGNVISMSTQIFCGHV  72

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            GNLELAA+SLGN G+Q+ AYG+MLGMGSAVETLCGQA+GA +YE+LGIY+QRS VLL  T
Sbjct  73   GNLELAASSLGNNGVQLLAYGVMLGMGSAVETLCGQAYGAHRYEMLGIYMQRSAVLLMAT  132

Query  522  gvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            G+ + LIY FSEP+L+ LG++  ++SAAALFVYGLIP+
Sbjct  133  GIPMMLIYAFSEPLLLLLGESERVASAAALFVYGLIPQ  170



>ref|XP_011048008.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Populus 
euphratica]
Length=485

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 147/192 (77%), Gaps = 3/192 (2%)
 Frame = +3

Query  66   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  599
            GSAVETLCGQ++GA ++E+LG +LQR+TV+LTLTG+ LA +YVF++PILI LG+   ++S
Sbjct  120  GSAVETLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYVFAKPILILLGEPTTVAS  179

Query  600  AAALFVYGLIPK  635
            +AA+FVYGL+P+
Sbjct  180  SAAVFVYGLLPQ  191



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 141/173 (82%), Gaps = 7/173 (4%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P     EASN        LE +L DT +P ++RL+ ATWIEL LL  LAAPAV+VY++
Sbjct  15   SEPDSTAPEASNHGDGLESPLEKVLSDTQLPFFKRLRSATWIELNLLFRLAAPAVLVYVV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  476
            N  MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA KY++
Sbjct  75   NNSMSLSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYGAEKYDM  134

Query  477  LGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LGIYLQR+T++LTLTG+ L LI++ S+PILI  G+ P ++++AA+FVYGLIP+
Sbjct  135  LGIYLQRATIVLTLTGLPLLLIFLLSKPILILFGETPKLAASAAVFVYGLIPQ  187



>ref|XP_010468355.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=438

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 124/132 (94%), Gaps = 0/132 (0%)
 Frame = +3

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE KLL  LAAPAV+VYMINYLMSMSTQIF GHLGNLELAAASLGNTGIQ+FAYGL+LGM
Sbjct  2    IESKLLFNLAAPAVIVYMINYLMSMSTQIFPGHLGNLELAAASLGNTGIQVFAYGLLLGM  61

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  599
            GSAVETLCGQA+GA KYE+LG+YLQRSTVLLTLT ++L L+YVFSEPIL+FLG++P I+S
Sbjct  62   GSAVETLCGQAYGARKYEMLGVYLQRSTVLLTLTSLVLTLLYVFSEPILLFLGESPAIAS  121

Query  600  AAALFVYGLIPK  635
            AA+LFVYGLIP+
Sbjct  122  AASLFVYGLIPQ  133



>gb|EMT19998.1| hypothetical protein F775_52364 [Aegilops tauschii]
Length=957

 Score =   201 bits (512),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 104/135 (77%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  231  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLM  410
            AT +E+++L  LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLM
Sbjct  4    ATAVEMRMLVRLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLM  63

Query  411  LGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPD  590
            LGMGSAVETLCGQA+GA K+++LGIY+QRSTVLL  TG+ LA++Y FS PILI LG++P+
Sbjct  64   LGMGSAVETLCGQAYGANKFDMLGIYMQRSTVLLMATGIPLAVLYAFSRPILILLGESPE  123

Query  591  ISSAAALFVYGLIPK  635
            I+SAAA+FVYGLIP+
Sbjct  124  IASAAAIFVYGLIPQ  138



>ref|XP_002518493.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43880.1| multidrug resistance pump, putative [Ricinus communis]
Length=510

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = +3

Query  159  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            S  S+ELE IL +T +  +QRLK A  +ELK+L  LA PAV VY++N ++SMSTQIF GH
Sbjct  28   SPVSSELEEILSNTNLSCFQRLKKAALLELKILFRLAGPAVFVYLLNNVVSMSTQIFCGH  87

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltl  518
            LGNL+LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LG+YLQRS +LL  
Sbjct  88   LGNLQLAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGVYLQRSAILLAA  147

Query  519  tgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            TG+ L +IY FS+ IL+ LG++ +I+S AA+FVYGLIP+
Sbjct  148  TGIPLTIIYSFSKQILLLLGESKEIASEAAIFVYGLIPQ  186



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score =   197 bits (500),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 147/192 (77%), Gaps = 3/192 (2%)
 Frame = +3

Query  66   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  599
            GSAVETLCGQ++GA ++E+LG +LQR+TV+LTLTG+ LA +YVF++PILI LG+   ++S
Sbjct  120  GSAVETLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYVFAKPILILLGEPTTVAS  179

Query  600  AAALFVYGLIPK  635
            +AA+FVYGL+P+
Sbjct  180  SAAVFVYGLLPQ  191



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 147/192 (77%), Gaps = 3/192 (2%)
 Frame = +3

Query  66   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISS  599
            GSAVETLCGQ++GA ++E+LG +LQR+TV+LTLTG+ LA +YVF++PILI LG+   ++S
Sbjct  120  GSAVETLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYVFAKPILILLGEPTTVAS  179

Query  600  AAALFVYGLIPK  635
            +AA+FVYGL+P+
Sbjct  180  SAAVFVYGLLPQ  191



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score =   196 bits (499),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  81   MDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKL  254
            MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+WIELKL
Sbjct  1    MDSKESRGELQEPLVLSSTEPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASWIELKL  59

Query  255  LCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVE  434
            L  LAAPAV VY+IN  +S+ST+IFSGHLGNLE AA SL N+G+Q+F YGLMLGMGSAVE
Sbjct  60   LFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFAAVSLANSGVQLFVYGLMLGMGSAVE  119

Query  435  TLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALF  614
            TLCGQ++GA ++E+LG +LQR+TV+LTLTG+ LA +YVF++PILI LG+   ++SAAA+F
Sbjct  120  TLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYVFAKPILILLGEPTTVASAAAVF  179

Query  615  VYGLIPK  635
            VYGL+P+
Sbjct  180  VYGLLPQ  186



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE +L D+ +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDSQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQR+TV+L+LTG+
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRATVVLSLTGI  140

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             LA++Y+FS+ IL+ LG++  ++SAAA+FVYGLIP+
Sbjct  141  PLAVVYLFSKNILLALGESKLVASAAAVFVYGLIPQ  176



>ref|XP_006348109.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Solanum 
tuberosum]
Length=427

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRST++L++TG
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRSTIVLSITG  138

Query  525  vllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            + LA++Y+FS+ IL+ LG++  ++S AA+FVYGLIP+
Sbjct  139  IPLAVVYLFSKNILLALGESKQVASEAAVFVYGLIPQ  175



>ref|XP_002518495.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43882.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 135/169 (80%), Gaps = 3/169 (2%)
 Frame = +3

Query  138  SSPP---HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLM  308
            SSP    H   E ++ LE IL DT +P  +RL+LA+ IELKLL  LAAPAV VYMIN  M
Sbjct  14   SSPEPELHAHCEVNSRLEKILNDTQLPYLKRLRLASVIELKLLFRLAAPAVFVYMINNFM  73

Query  309  SMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIY  488
            S+ST++F+GHLGNLELAAA+LGN+GIQ+ AYG MLGMGSAVETLCGQA+GA + E+LGIY
Sbjct  74   SLSTRVFAGHLGNLELAAAALGNSGIQLLAYGFMLGMGSAVETLCGQAYGAHRNEMLGIY  133

Query  489  LQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LQR+TV+LT+T + +  IY+ S+ IL+ LG+   ++SAAA+FVYGLIP+
Sbjct  134  LQRATVVLTITAIPMTAIYLVSKQILLLLGEPTSVASAAAVFVYGLIPQ  182



>gb|ABK24492.1| unknown [Picea sitchensis]
Length=513

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 129/159 (81%), Gaps = 1/159 (1%)
 Frame = +3

Query  162  EASNELESILMDTGIPRW-QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            +  N LE IL +     W + ++ A ++E KLLC LA PAV+VYM+NY+MSM+TQIFSGH
Sbjct  20   DDKNRLEVILSNADDQPWIKMMRDAVFLESKLLCRLALPAVIVYMVNYIMSMATQIFSGH  79

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltl  518
            LGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA  Y++LGIYLQRSTVLL  
Sbjct  80   LGNLELAAASLGNRGIQVFAYGLMLGMGSAVETLCGQAYGAKNYDMLGIYLQRSTVLLMA  139

Query  519  tgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
              + L LIYVFS+P+L+ L ++  I+SAAA+FVYGLIP+
Sbjct  140  AAIPLTLIYVFSKPLLLLLRESEKIASAAAIFVYGLIPQ  178



>emb|CDY33130.1| BnaCnng07010D [Brassica napus]
Length=308

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 140/188 (74%), Gaps = 19/188 (10%)
 Frame = +3

Query  81   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPFFHRLREATMIESK  59

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMI               GNLELAAASLGNTGIQI AYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMI---------------GNLELAAASLGNTGIQISAYGLMLGMGSAV  104

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAAL  611
            ETLCGQAFG  KYE+LGIYLQRSTVLLTLTG+LL LIYVFS+PIL+FLG++P+I+SAA++
Sbjct  105  ETLCGQAFGGRKYEMLGIYLQRSTVLLTLTGLLLTLIYVFSKPILLFLGESPEIASAASI  164

Query  612  FVYGLIPK  635
            FVYGLIP+
Sbjct  165  FVYGLIPQ  172



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 148/185 (80%), Gaps = 1/185 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S +   + P+ ES    SS      E+S+ELE +L D  +P  +RL+ ATWIELKLL 
Sbjct  1    MGSQDDQLHTPILESMQR-SSSTGSTFESSSELEKVLSDLQLPWLRRLRTATWIELKLLF  59

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VY+IN  MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETL
Sbjct  60   RLAAPAVLVYLINNAMSLSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETL  119

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVY  620
            CGQA+GA + E+LGIYLQR+TV+LT TG  L +IYVF++PIL+ LG++  ++SAAA+FVY
Sbjct  120  CGQAYGANRSEMLGIYLQRATVVLTATGFPLTVIYVFAKPILLLLGESSAVASAAAVFVY  179

Query  621  GLIPK  635
            GLIP+
Sbjct  180  GLIPQ  184



>gb|KDP20757.1| hypothetical protein JCGZ_21228 [Jatropha curcas]
Length=301

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            + E   S+ELE IL ++ IP +QR + ATW+ELK +  LAAPA VVY++N ++SMST I 
Sbjct  3    NNEKPVSSELEQILSNSEIPCFQRPRRATWLELKTVFSLAAPAAVVYLLNNVVSMSTLIL  62

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
             GHLGNL+LA+ASL N GIQ+FA+GL+LGMGSAVETLCGQA+GA KYE+LGIYLQRST++
Sbjct  63   CGHLGNLQLASASLSNNGIQLFAFGLLLGMGSAVETLCGQAYGAQKYEMLGIYLQRSTIV  122

Query  510  ltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            L  T + L LIY  S+PIL+ LG++ +I+S+AA+F YG+IP+
Sbjct  123  LMATSIPLTLIYALSKPILVLLGESKEIASSAAIFAYGIIPQ  164



>ref|XP_008347106.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12-like 
[Malus domestica]
Length=508

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE  L +T +  +QRL+ ATW+E K+L  LAAPAVVVY++N ++SMSTQIF GHLGN
Sbjct  26   SSELEDTLNNTDLSNFQRLRTATWLETKILYRLAAPAVVVYLLNNVISMSTQIFCGHLGN  85

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST+LL  TG+
Sbjct  86   LELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLLATGI  145

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             L  +Y+FS+P+L+ LG++  IS+AAA+FVYGLIP+
Sbjct  146  PLXXVYIFSKPLLLALGESASISAAAAVFVYGLIPQ  181



>ref|XP_011037658.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 145/190 (76%), Gaps = 6/190 (3%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESE-----ASNELESILMDTGIPRWQRLKLATWIE  245
            M +SNG   D   + D       HE         S+ELE IL +  + R +R+  AT++E
Sbjct  1    MGTSNGCRID-YADLDESYQPILHERRSFSGETVSSELEEILSNMELSRSRRILRATFLE  59

Query  246  LKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGS  425
            LK+L  LAAPA+VVY++N+L+S+STQIF GHLGNL+LA ASLG TGIQ+F +G+MLGMGS
Sbjct  60   LKILFPLAAPAIVVYLLNFLISISTQIFCGHLGNLQLAGASLGTTGIQVFIFGIMLGMGS  119

Query  426  AVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAA  605
            AVETLCGQA+GA KYE+LGIY+QRST+LLTL+G++L  IY+F +PIL+ L ++P I+SAA
Sbjct  120  AVETLCGQAYGAHKYEMLGIYMQRSTILLTLSGLVLMFIYIFCKPILLGLHESPSIASAA  179

Query  606  ALFVYGLIPK  635
            A+FVYGLIP+
Sbjct  180  AIFVYGLIPQ  189



>ref|XP_009614258.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=432

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 139/176 (79%), Gaps = 4/176 (2%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E    V +  H     S+ELE+IL DT +  +++L  A+ +ELK L  LAAP+++V
Sbjct  12   EPLLEPKEPVVAVEH----VSSELENILSDTSLSNFEQLGRASVVELKNLFRLAAPSIIV  67

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N + SMSTQIF GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+GA K
Sbjct  68   YLLNNITSMSTQIFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYGAHK  127

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            YE LGIYLQRST+LL L+G+ + + Y+FS+PILI LG++  ++SAAALFVYGLIP+
Sbjct  128  YESLGIYLQRSTILLMLSGIPIMVAYLFSKPILILLGESEKVASAAALFVYGLIPQ  183



>ref|XP_010546899.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546908.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Tarenaya 
hassleriana]
Length=503

 Score =   194 bits (493),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +3

Query  123  SDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            ++ ++ SP  +ESEA + LES+L DT +P ++RL LA+ +E+K L +LAAPAV VY+IN 
Sbjct  10   NNPLLDSPKPQESEADHRLESVLSDTHLPYFRRLYLASMLEMKFLFHLAAPAVFVYLINN  69

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
             MS+ T+IF+GHLG+LELAA+SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE++G
Sbjct  70   GMSILTRIFAGHLGSLELAASSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMMG  129

Query  483  IYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            +YLQRSTV+L LTG+ + L++VFS+PIL FLG+  +++S A++FVYG+IP+
Sbjct  130  VYLQRSTVVLALTGLPMTLLFVFSKPILTFLGEPAEVASMASVFVYGMIPQ  180



>ref|XP_006467446.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Citrus 
sinensis]
 ref|XP_006467447.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Citrus 
sinensis]
Length=488

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 141/177 (80%), Gaps = 6/177 (3%)
 Frame = +3

Query  105  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+GA 
Sbjct  67   VYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYGAQ  126

Query  465  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            KY++LG+YLQRS V+LT TG+ L +IY+FS+ IL+ LG++  I+SAAA+FV+GLIP+
Sbjct  127  KYDMLGVYLQRSAVILTATGIPLMVIYIFSKQILLLLGESSAIASAAAIFVFGLIPQ  183



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score =   194 bits (492),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D+ +P +QRL+ A+WI+ +LL  LAAPAV VYMIN  MS+ST+IFSG LG
Sbjct  23   ASSELEEVLSDSQLPYFQRLRSASWIKFQLLFRLAAPAVAVYMINNAMSISTRIFSGQLG  82

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NL+LAAASLG+ GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQRST++L+LTG
Sbjct  83   NLQLAAASLGDQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRSTIVLSLTG  142

Query  525  vllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            + LA++Y+FS+ +L+ LG+A  ++SA ++FVYGLIP+
Sbjct  143  IPLAVVYLFSKNLLLALGEAKPVASATSVFVYGLIPQ  179



>ref|XP_006651561.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=497

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +3

Query  141  SPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMST  320
            + P    E S  LE IL D   P  +R+  A  +E++LL  +AAPA+VVY++N ++S+ST
Sbjct  6    ASPSSSHELSRRLEGILRDGEAPWARRVCKAAVVEVRLLMPIAAPAIVVYVLNNVLSIST  65

Query  321  QIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            QIF GHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY++LG+Y+QRS
Sbjct  66   QIFCGHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYMQRS  125

Query  501  tvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            TVLL  TGV LA++Y FS PIL+ LG++P+I+ AAA+FVYGLIP+
Sbjct  126  TVLLMATGVPLAVLYAFSRPILVLLGESPEIAGAAAVFVYGLIPQ  170



>ref|XP_006651562.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=539

 Score =   194 bits (493),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  225  KLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYG  404
            ++ + ++++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYG
Sbjct  80   RVVSQVDMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYG  139

Query  405  LMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQA  584
            LMLGMGSAVETLCGQA+GA KY++LG+YLQRSTVLL  TGV LA++Y FS PIL+ LG++
Sbjct  140  LMLGMGSAVETLCGQAYGAHKYDMLGVYLQRSTVLLMATGVPLAVLYAFSRPILVLLGES  199

Query  585  PDISSAAALFVYGLIPK  635
            P+I+SAAA+FVYGLIP+
Sbjct  200  PEIASAAAVFVYGLIPQ  216



>ref|XP_006348108.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=499

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRST++L++TG
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRSTIVLSITG  138

Query  525  vllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            + LA++Y+FS+ IL+ LG++  ++S AA+FVYGLIP+
Sbjct  139  IPLAVVYLFSKNILLALGESKQVASEAAVFVYGLIPQ  175



>ref|XP_011037659.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 143/188 (76%), Gaps = 5/188 (3%)
 Frame = +3

Query  72   NSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            +S ++ +    Y+P+       S  P      S+ELE IL     PR QR+  AT +ELK
Sbjct  7    DSRIEYAEDEPYEPILHDKRSFSGEP-----VSSELEEILSVMEFPRSQRILRATRLELK  61

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            +L  LAAPA+VVY++N+L+S+ST +F GHLGNL+LAAASLGNTG+Q F YG++ GMGSAV
Sbjct  62   ILSRLAAPAIVVYLLNFLISISTHVFCGHLGNLQLAAASLGNTGVQGFVYGIVFGMGSAV  121

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAAL  611
            ETLCGQA+GA +YE+LGIY+QRST+LLTL+G++L  IY+F +PIL+ L ++P I+SAAA+
Sbjct  122  ETLCGQAYGARRYEMLGIYMQRSTILLTLSGLVLMFIYIFCKPILLGLHESPSIASAAAI  181

Query  612  FVYGLIPK  635
            FVYGLIP+
Sbjct  182  FVYGLIPQ  189



>ref|XP_006348110.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Solanum 
tuberosum]
Length=499

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRST++L++TG
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRSTIVLSITG  138

Query  525  vllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            + LA++Y+FS+ IL+ LG++  ++S AA+FVYGLIP+
Sbjct  139  IPLAVVYLFSKNILLALGESKQVASEAAVFVYGLIPQ  175



>ref|XP_004232715.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   193 bits (491),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 136/171 (80%), Gaps = 5/171 (3%)
 Frame = +3

Query  138  SSPPHEESEA-----SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            S P  EE EA     S+ELE IL+D  +  +QRL+ A+ +E   L  LAAPA++VY++N 
Sbjct  8    SEPLIEEKEATVEHVSSELEDILLDARLSHFQRLRRASAVEFSNLFRLAAPAIIVYLLNN  67

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
            + S+STQIF GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+GA KYE LG
Sbjct  68   VTSVSTQIFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYGAHKYETLG  127

Query  483  IYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            IYLQRST+LL L+G+ + + Y++S+PILI LG++  ++SAAALFVYGLIP+
Sbjct  128  IYLQRSTILLMLSGIPIMVAYLYSKPILILLGESEKVASAAALFVYGLIPQ  178



>ref|XP_006348111.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=509

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 134/166 (81%), Gaps = 5/166 (3%)
 Frame = +3

Query  153  EESEA-----SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            E+ EA     S+ELE IL DT +  +QRL  A+ +E + L  LAAPA++VY++N + SMS
Sbjct  18   EQKEAAVEHVSSELEDILSDTRLSHFQRLGRASAVEFRNLFRLAAPAIIVYLLNNVTSMS  77

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            TQIF GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+GA KYE LGIYLQR
Sbjct  78   TQIFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYGAHKYETLGIYLQR  137

Query  498  StvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            ST+LL L+G+ + + Y+FS+PILI LG++  ++SAAALFVYGLIP+
Sbjct  138  STILLMLSGIPIMVAYLFSKPILILLGESEKVASAAALFVYGLIPQ  183



>gb|KDO78208.1| hypothetical protein CISIN_1g010561mg [Citrus sinensis]
Length=507

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 141/177 (80%), Gaps = 6/177 (3%)
 Frame = +3

Query  105  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+GA 
Sbjct  67   VYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYGAQ  126

Query  465  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            KY++LG+YLQRS V+LT TG+ L +IY+FS+ IL+ LG++  I+SAAA+FV+GLIP+
Sbjct  127  KYDMLGVYLQRSAVILTATGIPLMVIYIFSKQILLLLGESSAIASAAAIFVFGLIPQ  183



>ref|XP_006467445.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
Length=507

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 141/177 (80%), Gaps = 6/177 (3%)
 Frame = +3

Query  105  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+GA 
Sbjct  67   VYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYGAQ  126

Query  465  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            KY++LG+YLQRS V+LT TG+ L +IY+FS+ IL+ LG++  I+SAAA+FV+GLIP+
Sbjct  127  KYDMLGVYLQRSAVILTATGIPLMVIYIFSKQILLLLGESSAIASAAAIFVFGLIPQ  183



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = +3

Query  159  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            + +S+ELE +L DT +P   R K ATWIEL+LL  LAAPAV++YMIN  MSMST+IFSGH
Sbjct  34   THSSSELEKVLSDTDLPFLTRYKKATWIELRLLFKLAAPAVMMYMINNAMSMSTRIFSGH  93

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltl  518
            LGNLE AAA LGN GIQ+FAYGL+LGMGSAVETLCGQA+GA +YE+LG+YLQR+TV+L L
Sbjct  94   LGNLEFAAACLGNQGIQLFAYGLLLGMGSAVETLCGQAYGARRYEMLGVYLQRATVVLML  153

Query  519  tgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
              + +  +Y+ S  IL+ +G+   +++ A++FVYGLIP+
Sbjct  154  FSLPIVAVYLLSRQILLLIGEEEQVATPASVFVYGLIPQ  192



>ref|XP_009361725.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=509

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI  GHLGN
Sbjct  26   SSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQILCGHLGN  85

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST+LL  TG+
Sbjct  86   LELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLVATGI  145

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             L +IY+FS+P+L+ LG++  IS+AAA+FVYGLIP+
Sbjct  146  PLMIIYIFSKPLLLALGESASISAAAAVFVYGLIPQ  181



>ref|XP_009361804.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=509

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI  GHLGN
Sbjct  26   SSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQILCGHLGN  85

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST+LL  TG+
Sbjct  86   LELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLVATGI  145

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             L +IY+FS+P+L+ LG++  IS+AAA+FVYGLIP+
Sbjct  146  PLMIIYIFSKPLLLALGESASISAAAAVFVYGLIPQ  181



>ref|XP_009614257.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=509

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 139/176 (79%), Gaps = 4/176 (2%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E    V +  H     S+ELE+IL DT +  +++L  A+ +ELK L  LAAP+++V
Sbjct  12   EPLLEPKEPVVAVEH----VSSELENILSDTSLSNFEQLGRASVVELKNLFRLAAPSIIV  67

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N + SMSTQIF GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+GA K
Sbjct  68   YLLNNITSMSTQIFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYGAHK  127

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            YE LGIYLQRST+LL L+G+ + + Y+FS+PILI LG++  ++SAAALFVYGLIP+
Sbjct  128  YESLGIYLQRSTILLMLSGIPIMVAYLFSKPILILLGESEKVASAAALFVYGLIPQ  183



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPAV VY+IN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAVAVYLINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRST++L++TG
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRSTIVLSITG  138

Query  525  vllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            + LA++Y+FS+ IL+ LG++  ++S AA+FVYGLIP+
Sbjct  139  IPLAVVYIFSKNILLALGESKLVASEAAVFVYGLIPQ  175



>ref|XP_010533821.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X5 [Tarenaya 
hassleriana]
 ref|XP_010533822.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Tarenaya 
hassleriana]
Length=313

 Score =   187 bits (474),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 134/166 (81%), Gaps = 4/166 (2%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  498  StvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            STV+L LTG+ + ++YV S+PIL FLG+  D++S A++FVYG+IP+
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLGEPADVASMASVFVYGMIPQ  178



>ref|XP_010533819.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Tarenaya 
hassleriana]
Length=320

 Score =   187 bits (474),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 134/166 (81%), Gaps = 4/166 (2%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  498  StvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            STV+L LTG+ + ++YV S+PIL FLG+  D++S A++FVYG+IP+
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLGEPADVASMASVFVYGMIPQ  178



>ref|XP_009345545.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAVVVY++N ++SMSTQI  GHLGN
Sbjct  26   SSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAVVVYLLNNVISMSTQILCGHLGN  85

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST+LL  TG+
Sbjct  86   LELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLVATGI  145

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             L +IY+FS+P+L+ LG++  IS+AAA+FVYGLIP+
Sbjct  146  PLMIIYIFSKPLLLALGESASISAAAAIFVYGLIPQ  181



>ref|XP_011048003.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=516

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY---MINYLMSMSTQIFSGH  338
            S+ELE IL +  + R  R+  ATW+ELK+L  LAAPA+VVY   M+N+L+S+STQ+F GH
Sbjct  34   SSELEDILCNMELSRSHRILKATWVELKILFPLAAPAIVVYLLNMLNFLVSISTQMFCGH  93

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltl  518
            LGNLELAAASLGN GIQ   +G+MLGMGSAVETLCGQAFGA KYE+LG+Y+QRST+LLTL
Sbjct  94   LGNLELAAASLGNNGIQGLVFGVMLGMGSAVETLCGQAFGANKYEMLGVYMQRSTILLTL  153

Query  519  tgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             GV+L  IY+F +PIL+ L ++P ISSAAA+F+YGLIP+
Sbjct  154  AGVVLMFIYIFCKPILLGLHESPAISSAAAIFIYGLIPQ  192



>gb|EYU29853.1| hypothetical protein MIMGU_mgv1a004772mg [Erythranthe guttata]
Length=511

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 135/183 (74%), Gaps = 11/183 (6%)
 Frame = +3

Query  120  ESDGVVSSPPHEES-----------EASNELESILMDTGIPRWQRLKLATWIELKLLCYL  266
            E+ G V + P  ES           E S+ELE IL D  +  W+R + A+ IEL+ L  L
Sbjct  5    ENKGAVVNEPLLESYKPAPPEAAAEEVSSELEEILSDATLSWWRRYRKASVIELRYLFRL  64

Query  267  AAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG  446
            A PAV+VY++N L S ST IF GHLGNLELAA+SLGN GIQ+ AYGLMLGMGSAVETLCG
Sbjct  65   AGPAVIVYLLNNLTSTSTIIFCGHLGNLELAASSLGNNGIQLLAYGLMLGMGSAVETLCG  124

Query  447  QAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGL  626
            QA+GA KYE+LGIY+QRS VLL  TG+ L L+Y+F +PIL+ LG++  ++SAAALFVYGL
Sbjct  125  QAYGAHKYEMLGIYMQRSVVLLMATGLPLMLVYIFCKPILLLLGESKSVASAAALFVYGL  184

Query  627  IPK  635
            IP+
Sbjct  185  IPQ  187



>ref|XP_010533820.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Tarenaya 
hassleriana]
Length=315

 Score =   186 bits (473),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 134/166 (81%), Gaps = 4/166 (2%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  498  StvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            STV+L LTG+ + ++YV S+PIL FLG+  D++S A++FVYG+IP+
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLGEPADVASMASVFVYGMIPQ  178



>ref|XP_009345550.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   191 bits (485),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE  L +T    +QRL+ ATW+E K LC LAAPAVVVY++N ++++STQIF GHLGN
Sbjct  26   SSELEDTLNNTDFSYFQRLRTATWLEAKTLCRLAAPAVVVYLLNNVITLSTQIFCGHLGN  85

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAA+SLGN GIQ+F +GLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST+LL  TG+
Sbjct  86   LELAASSLGNIGIQVFTFGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLVATGI  145

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             L +IY+FS+P+L+ LG++  IS+AAA+FVYGLIP+
Sbjct  146  PLMIIYIFSKPLLLALGESASISAAAAVFVYGLIPQ  181



>ref|XP_010533818.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Tarenaya 
hassleriana]
Length=328

 Score =   186 bits (473),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 134/166 (81%), Gaps = 4/166 (2%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  498  StvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            STV+L LTG+ + ++YV S+PIL FLG+  D++S A++FVYG+IP+
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLGEPADVASMASVFVYGMIPQ  178



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D+ +P +QRL+ A+WIE +LL  LAAPAV VYMIN  MS+ST+IFSG LG
Sbjct  23   ASSELEEVLSDSQLPYFQRLRSASWIEFQLLFRLAAPAVAVYMINNAMSISTRIFSGQLG  82

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NL+LAAASLG+ GIQ+FAYGLMLGMGSAVETLCGQA+ A ++E+LG+YLQRSTV+L+LTG
Sbjct  83   NLQLAAASLGDQGIQLFAYGLMLGMGSAVETLCGQAYXAHRHEMLGVYLQRSTVVLSLTG  142

Query  525  vllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            + LA++Y+FS+ +L+ LG+A  ++SA ++FVYGLIP+
Sbjct  143  IPLAVVYLFSKNLLLALGEAKPVASATSVFVYGLIPQ  179



>ref|XP_008371177.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 139/176 (79%), Gaps = 5/176 (3%)
 Frame = +3

Query  123  SDGVVSSP---PHEESE--ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            SD  +S P   P    +   S+ELE  L +T    +QRL+ ATW+E K L  LAAPAVVV
Sbjct  5    SDNDLSEPMLVPKTSLQQIVSSELEDTLNNTEFSYFQRLRTATWLETKTLYRLAAPAVVV  64

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N +++MSTQIF GHLGNLELAA+SLGN GIQ+FA+GLMLGMGSAVETLCGQA+GA K
Sbjct  65   YLLNNVITMSTQIFCGHLGNLELAASSLGNIGIQVFAFGLMLGMGSAVETLCGQAYGAHK  124

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            YE+LGIY+QRST+LL  TG+ L + Y+FS+P+L+ LG++  IS+AAA+FVYGLIP+
Sbjct  125  YEMLGIYMQRSTILLXATGIPLXIXYIFSKPLLLALGESASISAAAAVFVYGLIPQ  180



>ref|XP_008371097.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE  L +T    +QRL+ ATW+E K L  LAAPAVVVY++N +++MSTQIF GHLGN
Sbjct  25   SSELEDTLNNTEFSYFQRLRTATWLETKTLYRLAAPAVVVYLLNNVITMSTQIFCGHLGN  84

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAA+SLGN GIQ+FA+GLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST+LL  TG+
Sbjct  85   LELAASSLGNIGIQVFAFGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLXATGI  144

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             L + Y+FS+P+L+ LG++  IS+AAA+FVYGLIP+
Sbjct  145  PLXIXYIFSKPLLLALGESASISAAAAVFVYGLIPQ  180



>ref|XP_010533817.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Tarenaya 
hassleriana]
Length=351

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 134/166 (81%), Gaps = 4/166 (2%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  498  StvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            STV+L LTG+ + ++YV S+PIL FLG+  D++S A++FVYG+IP+
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLGEPADVASMASVFVYGMIPQ  178



>ref|XP_007212986.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
 gb|EMJ14185.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
Length=487

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
             S ELE  L +T +  +QRL+  TW+ELK+L  LAAPAVVVY++N ++SMSTQIF GHLG
Sbjct  4    VSRELEDTLNNTELSYFQRLRTGTWLELKILFRLAAPAVVVYLLNNVISMSTQIFCGHLG  63

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIY+QRST+LL  T 
Sbjct  64   NLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYMQRSTILLLATS  123

Query  525  vllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            + L +IY+F + IL+ LG++  I++AAA+FVYGLIP+
Sbjct  124  IPLMIIYIFCKQILLGLGESASIAAAAAIFVYGLIPQ  160



>ref|XP_009760619.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=509

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 136/176 (77%), Gaps = 4/176 (2%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E    V +  H  SE    LE IL DT +  +Q L  A+ IELK L  LAAP+V+V
Sbjct  12   EPLLEPKEPVVAVEHINSE----LEDILSDTSLSNFQMLGRASVIELKNLFRLAAPSVIV  67

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N + SMSTQ+F GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+GA K
Sbjct  68   YLLNNITSMSTQLFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYGAHK  127

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            Y  LGIYLQRST+LL L+G+ + + Y+FS+PILIFLG++  ++SAAALFVYGLIP+
Sbjct  128  YGSLGIYLQRSTILLMLSGIPIMVAYLFSKPILIFLGESEKVASAAALFVYGLIPQ  183



>gb|ADE77677.1| unknown [Picea sitchensis]
Length=517

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 131/159 (82%), Gaps = 1/159 (1%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRL-KLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            +  N LE IL +     W+++ + A ++E KLL  LA PA+VVYM+NY+MSM+TQIF GH
Sbjct  23   DDKNRLELILSNADNLPWRKMMRAAVFLESKLLWSLALPAIVVYMVNYIMSMATQIFCGH  82

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltl  518
            LGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA  Y +LGIYLQRST+LL +
Sbjct  83   LGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAKTYGMLGIYLQRSTILLMV  142

Query  519  tgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            TG+ L +IY FS+P+L+ LG++  I++AAA+FVYGLIP+
Sbjct  143  TGIPLTIIYAFSKPLLVLLGESETIAAAAAIFVYGLIPQ  181



>gb|KDO78210.1| hypothetical protein CISIN_1g043801mg, partial [Citrus sinensis]
Length=215

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  198  TGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGN  377
            T +  +QR+K ATWIELK L  LAAPA++VYM+N L++MSTQIF GHLGNLELAA SLGN
Sbjct  10   TSLSFFQRIKKATWIELKSLFRLAAPAILVYMLNNLVAMSTQIFCGHLGNLELAAVSLGN  69

Query  378  TGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSE  557
            TGIQ+FAYGLMLGMGSA ETLCGQA+GA KY++LG+YLQRS V+LT TG+ L +IY+FS+
Sbjct  70   TGIQVFAYGLMLGMGSATETLCGQAYGAQKYDMLGVYLQRSAVILTATGIPLMVIYIFSK  129

Query  558  PILIFLGQAPDISSAAALFVYGLIPK  635
             IL+ LG++  I+SAAA+FV+GLIP+
Sbjct  130  QILLLLGESSAIASAAAIFVFGLIPQ  155



>gb|EEC75604.1| hypothetical protein OsI_12313 [Oryza sativa Indica Group]
Length=500

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            E S  LE IL D   P  +R   A  +E++LL  +AAPA+VVY++N ++S+STQIF GHL
Sbjct  15   ELSGRLEGILADGEAPWARRACKAAALEVRLLAPIAAPAIVVYVLNNVLSISTQIFCGHL  74

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            GNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+G  KY++LG+Y+QRSTVLL  T
Sbjct  75   GNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGVHKYDMLGVYMQRSTVLLMAT  134

Query  522  gvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            GV LA+IY FS PIL+ LG++P+I+SAAA+FVYGL+P+
Sbjct  135  GVPLAVIYAFSRPILVLLGESPEIASAAAVFVYGLVPQ  172



>ref|XP_002518492.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43879.1| multidrug resistance pump, putative [Ricinus communis]
Length=497

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 136/162 (84%), Gaps = 2/162 (1%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            HE+ +  +ELE IL DT    ++RLK A+ +EL+LL  LAAPAVVVY++N ++SMSTQIF
Sbjct  14   HEDVD--SELEEILSDTQSSPFKRLKSASCVELRLLFKLAAPAVVVYLLNNVVSMSTQIF  71

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
             GHLGNLELAA SLGNTGIQIFAYGL+LGMGSAVETLCGQA+GA KYE+LG YLQRSTVL
Sbjct  72   CGHLGNLELAAVSLGNTGIQIFAYGLLLGMGSAVETLCGQAYGAHKYEMLGTYLQRSTVL  131

Query  510  ltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            L  TG+ L LIY FS+PILI LG+  DI+SAAALFVYGLIP+
Sbjct  132  LMATGIPLTLIYAFSKPILILLGEPIDIASAAALFVYGLIPQ  173



>ref|XP_008224822.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=507

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 136/178 (76%), Gaps = 5/178 (3%)
 Frame = +3

Query  117  PESDGVVSSP-----PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            P SD  +S P            S ELE  L +T +  +QR +  TW+ELK L  LAAPAV
Sbjct  3    PSSDNELSEPLLLSKSSSMHIVSRELEDTLNNTELSYFQRFRTGTWLELKTLFRLAAPAV  62

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            VVY++N ++SMSTQIF GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  63   VVYLLNNVISMSTQIFCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGA  122

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
             KY++LGIY+QRST+LL  T + L +IY+F + IL+ LG++  I++AAA+FVYGLIP+
Sbjct  123  HKYDMLGIYMQRSTILLLATSIPLMIIYIFCKEILLGLGESASIAAAAAIFVYGLIPQ  180



>ref|XP_006389635.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
 gb|ERP48549.1| hypothetical protein POPTR_0021s00850g [Populus trichocarpa]
Length=513

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE IL +  + R  R+  ATW+ELK+L  LAAPA+VVY++N+ +S+STQ+F GHLGN
Sbjct  34   SSELEDILCNMELSRSHRILRATWVELKILFPLAAPAIVVYLLNFFVSISTQMFCGHLGN  93

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELA  SLGN GIQ   +G+MLGMGSAVETLCGQA+GA K+E+LG+Y+QRST+LLTL G+
Sbjct  94   LELAGVSLGNNGIQGLVFGVMLGMGSAVETLCGQAYGANKFEMLGVYMQRSTILLTLAGL  153

Query  528  llalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            +L  IY+F +PIL+ L ++P ISSAAA+FVYGLIP+
Sbjct  154  VLMFIYIFCKPILLGLHESPAISSAAAIFVYGLIPQ  189



>ref|XP_007211777.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
 gb|EMJ12976.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
Length=525

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 144/173 (83%), Gaps = 7/173 (4%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P    +EAS         LE +L DT +  ++RL+LA+WIELKLL  LAAPAV+VY++
Sbjct  15   SEPDSAAAEASGHGDGLESLLEKVLSDTQLSSFKRLRLASWIELKLLFRLAAPAVLVYIV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  476
            NYLMS+ST++F+GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA KY++
Sbjct  75   NYLMSLSTRVFAGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGAEKYDM  134

Query  477  LGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            LGIYLQR+T++LTLTG+ L LI++ S+PILI  G+ P +++AAA++VYGLIP+
Sbjct  135  LGIYLQRATIVLTLTGLPLLLIFLLSKPILILFGETPKLAAAAAVYVYGLIPQ  187



>ref|XP_002464323.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
 gb|EER91321.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
Length=501

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            E S +LE IL D   P  +R   A  IEL+LL  +AAPAVVVY++N ++S+STQIFSGHL
Sbjct  19   ELSGQLEGILADREAPWARRASKAAMIELRLLAPIAAPAVVVYVLNNVLSISTQIFSGHL  78

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            GNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LGIYLQRST+LL   
Sbjct  79   GNLELAASSLGNNGIQVFAYGLMLGMGSAVETLCGQAYGAHRYEMLGIYLQRSTILLVAV  138

Query  522  gvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            GV L++IY FSEPIL+FLG++P+I+ AAA+FVYGLIP+
Sbjct  139  GVPLSVIYAFSEPILVFLGESPEIAKAAAVFVYGLIPQ  176



>ref|NP_001147791.1| transparent testa 12 protein [Zea mays]
 gb|ACF88403.1| unknown [Zea mays]
 gb|ACG28718.1| transparent testa 12 protein [Zea mays]
 gb|ACG37262.1| transparent testa 12 protein [Zea mays]
 tpg|DAA62912.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 132/190 (69%), Gaps = 8/190 (4%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSS-----PPHEESEASNELESILMDTGIPRWQRLKLATWIE  245
            MDS+  A   PL +     S       P +  E S ELE+IL D   P   R      +E
Sbjct  1    MDSTTTA---PLLQPSAASSKEGPGPAPAQHGEGSRELEAILADASKPWAWRAWEGARLE  57

Query  246  LKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGS  425
            L LL  +A PAV VYMIN++MSMSTQIF G LGNLELAA+SLGNTGIQ  AYGLMLGMGS
Sbjct  58   LPLLLRVALPAVAVYMINFVMSMSTQIFCGQLGNLELAASSLGNTGIQPLAYGLMLGMGS  117

Query  426  AVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLGQAPDISSAA  605
            AVETLCGQA+GA K+ +LG+YLQRSTVLL  T V L ++Y FSE IL+ LG++  IS AA
Sbjct  118  AVETLCGQAYGAHKHRMLGVYLQRSTVLLMATAVPLTVVYAFSERILVLLGESERISRAA  177

Query  606  ALFVYGLIPK  635
            A+FVYGLIP+
Sbjct  178  AVFVYGLIPQ  187



>gb|AGT17223.1| MATE efflux family protein [Saccharum hybrid cultivar R570]
Length=516

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            E S +LE IL D   P  +R   A  IEL+LL  +AAPAVVVY++N ++S+STQIFSGHL
Sbjct  18   ELSGQLEGILADREAPWARRASKAAMIELRLLAPIAAPAVVVYVLNNVLSISTQIFSGHL  77

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            GNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LGIYLQRST+LL   
Sbjct  78   GNLELAASSLGNNGIQVFAYGLMLGMGSAVETLCGQAYGAHRYEMLGIYLQRSTILLVAV  137

Query  522  gvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            GV L++IY FSEPIL+FLG++P+I+ AAA+FVYGLIP+
Sbjct  138  GVPLSVIYAFSEPILVFLGESPEIAKAAAVFVYGLIPQ  175



>ref|NP_001050520.1| Os03g0570800 [Oryza sativa Japonica Group]
 gb|ABF97202.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12434.1| Os03g0570800 [Oryza sativa Japonica Group]
 dbj|BAG95165.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            E S  LE IL D   P  +R   A  +E++LL  +AAPA+VVY+ N ++S+STQIF GHL
Sbjct  15   ELSGRLEGILADGEAPWARRACKAAALEVRLLAPIAAPAIVVYVPNNVLSISTQIFCGHL  74

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            GNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+G  KY++LG+Y+QRSTVLL  T
Sbjct  75   GNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGVHKYDMLGVYMQRSTVLLMAT  134

Query  522  gvllalIYVFSEPILIFLGQAPDISSAAALFVYGLIPK  635
            GV LA+IY FS PIL+ LG++P+I+SAAA+FVYGL+P+
Sbjct  135  GVPLAVIYAFSRPILVLLGESPEIASAAAVFVYGLVPQ  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000