BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF049I22

Length=632
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788026.1|  PREDICTED: uncharacterized protein LOC104235895    133   5e-32   Nicotiana sylvestris
ref|XP_011075041.1|  PREDICTED: uncharacterized protein LOC105159627    125   2e-29   Sesamum indicum [beniseed]
ref|XP_006351365.1|  PREDICTED: uncharacterized protein LOC102603072    122   4e-28   Solanum tuberosum [potatoes]
ref|XP_004249304.1|  PREDICTED: uncharacterized protein LOC101268442    122   4e-28   Solanum lycopersicum
ref|XP_009621585.1|  PREDICTED: uncharacterized protein LOC104113184    118   9e-27   Nicotiana tomentosiformis
ref|XP_009771625.1|  PREDICTED: uncharacterized protein LOC104222130    116   3e-26   Nicotiana sylvestris
ref|XP_009615719.1|  PREDICTED: uncharacterized protein LOC104108400    115   4e-26   Nicotiana tomentosiformis
emb|CDP14324.1|  unnamed protein product                                114   1e-25   Coffea canephora [robusta coffee]
ref|XP_002281952.1|  PREDICTED: uncharacterized protein LOC100267624    107   7e-23   Vitis vinifera
ref|XP_011078778.1|  PREDICTED: uncharacterized protein LOC105162459    105   2e-22   Sesamum indicum [beniseed]
ref|XP_004157014.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  99.0    4e-20   
ref|XP_007204249.1|  hypothetical protein PRUPE_ppa002161mg           98.6    5e-20   Prunus persica
ref|XP_007161937.1|  hypothetical protein PHAVU_001G110300g           98.2    6e-20   Phaseolus vulgaris [French bean]
ref|XP_008240478.1|  PREDICTED: uncharacterized protein LOC103338977  97.8    9e-20   Prunus mume [ume]
gb|KJB80963.1|  hypothetical protein B456_013G123300                  97.1    2e-19   Gossypium raimondii
gb|KJB80965.1|  hypothetical protein B456_013G123300                  97.1    2e-19   Gossypium raimondii
ref|XP_004147533.1|  PREDICTED: uncharacterized protein LOC101221479  96.3    3e-19   Cucumis sativus [cucumbers]
ref|XP_008441978.1|  PREDICTED: uncharacterized protein LOC103485979  96.3    3e-19   Cucumis melo [Oriental melon]
gb|EYU20664.1|  hypothetical protein MIMGU_mgv1a002165mg              95.1    7e-19   Erythranthe guttata [common monkey flower]
gb|KDP39706.1|  hypothetical protein JCGZ_02726                       94.7    9e-19   Jatropha curcas
gb|KHG27523.1|  hypothetical protein F383_15264                       94.0    2e-18   Gossypium arboreum [tree cotton]
gb|KJB82581.1|  hypothetical protein B456_013G203000                  90.9    2e-17   Gossypium raimondii
gb|KJB82580.1|  hypothetical protein B456_013G203000                  90.9    2e-17   Gossypium raimondii
gb|KJB82579.1|  hypothetical protein B456_013G203000                  90.9    2e-17   Gossypium raimondii
gb|KJB82583.1|  hypothetical protein B456_013G203000                  90.9    2e-17   Gossypium raimondii
gb|KJB82582.1|  hypothetical protein B456_013G203000                  90.9    2e-17   Gossypium raimondii
gb|KHG04306.1|  Casein kinase I-like protein                          88.6    1e-16   Gossypium arboreum [tree cotton]
ref|XP_009366444.1|  PREDICTED: uncharacterized protein LOC103956210  88.6    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_004493152.1|  PREDICTED: uncharacterized protein LOC101504...  88.6    1e-16   Cicer arietinum [garbanzo]
ref|XP_007030718.1|  Kinase family protein                            88.2    2e-16   Theobroma cacao [chocolate]
ref|XP_006443418.1|  hypothetical protein CICLE_v10019090mg           87.8    2e-16   Citrus clementina [clementine]
ref|XP_006479104.1|  PREDICTED: uncharacterized protein LOC102619...  87.8    3e-16   Citrus sinensis [apfelsine]
ref|XP_010276388.1|  PREDICTED: uncharacterized protein LOC104611151  87.4    3e-16   
gb|EYU39997.1|  hypothetical protein MIMGU_mgv1a002328mg              85.9    9e-16   Erythranthe guttata [common monkey flower]
gb|EPS68531.1|  hypothetical protein M569_06230                       84.7    3e-15   Genlisea aurea
ref|XP_011021493.1|  PREDICTED: uncharacterized protein LOC105123555  84.3    3e-15   Populus euphratica
ref|XP_002325416.1|  kinase family protein                            84.3    4e-15   
ref|XP_002525432.1|  casein kinase, putative                          84.0    5e-15   Ricinus communis
ref|XP_010088042.1|  Casein kinase I isoform delta                    83.6    6e-15   
ref|XP_010558720.1|  PREDICTED: uncharacterized protein LOC104827...  82.4    2e-14   
ref|XP_010036218.1|  PREDICTED: uncharacterized protein LOC104425268  80.9    5e-14   Eucalyptus grandis [rose gum]
ref|XP_003624626.1|  Casein kinase I isoform alpha                    80.5    6e-14   Medicago truncatula
ref|XP_010257690.1|  PREDICTED: uncharacterized protein LOC104597684  80.5    7e-14   Nelumbo nucifera [Indian lotus]
gb|KJB45108.1|  hypothetical protein B456_007G289500                  80.1    8e-14   Gossypium raimondii
gb|KHG17118.1|  Casein kinase I isoform delta                         80.1    9e-14   Gossypium arboreum [tree cotton]
ref|XP_010558719.1|  PREDICTED: uncharacterized protein LOC104827...  79.7    1e-13   Tarenaya hassleriana [spider flower]
gb|ABN09797.1|  Protein kinase                                        73.6    9e-12   Medicago truncatula
ref|XP_006408240.1|  hypothetical protein EUTSA_v10020173mg           72.8    2e-11   Eutrema salsugineum [saltwater cress]
ref|XP_003548750.1|  PREDICTED: uncharacterized protein LOC100801...  70.9    8e-11   Glycine max [soybeans]
gb|KJB46017.1|  hypothetical protein B456_007G343500                  70.1    1e-10   Gossypium raimondii
gb|KJB46016.1|  hypothetical protein B456_007G343500                  69.7    2e-10   Gossypium raimondii
ref|XP_002873876.1|  kinase family protein                            69.3    3e-10   
ref|XP_002884421.1|  kinase family protein                            68.6    4e-10   Arabidopsis lyrata subsp. lyrata
ref|NP_187044.1|  protein kinase family protein                       68.6    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102089.1|  PREDICTED: uncharacterized protein LOC103828226  67.0    2e-09   Brassica rapa
emb|CDY29971.1|  BnaC01g40370D                                        65.1    7e-09   Brassica napus [oilseed rape]
ref|XP_010516062.1|  PREDICTED: uncharacterized protein LOC104791...  64.7    8e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010516137.1|  PREDICTED: uncharacterized protein LOC104791...  64.7    8e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010672056.1|  PREDICTED: uncharacterized protein LOC104888...  63.9    2e-08   
ref|XP_010672054.1|  PREDICTED: uncharacterized protein LOC104888...  63.9    2e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_197320.1|  protein kinase                                      63.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454044.1|  PREDICTED: uncharacterized protein LOC104735873  62.8    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_008805378.1|  PREDICTED: uncharacterized protein LOC103718369  62.8    4e-08   Phoenix dactylifera
gb|KHF98002.1|  hypothetical protein F383_12939                       61.6    9e-08   Gossypium arboreum [tree cotton]
ref|XP_010463863.1|  PREDICTED: uncharacterized protein LOC104744499  61.2    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010485760.1|  PREDICTED: uncharacterized protein LOC104764...  61.2    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010485763.1|  PREDICTED: uncharacterized protein LOC104764...  60.8    1e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010908708.1|  PREDICTED: uncharacterized protein LOC105035016  60.8    1e-07   Elaeis guineensis
emb|CDY21155.1|  BnaA01g33860D                                        59.7    4e-07   Brassica napus [oilseed rape]
emb|CDY50866.1|  BnaA05g37270D                                        58.5    8e-07   Brassica napus [oilseed rape]
ref|XP_006297091.1|  hypothetical protein CARUB_v10013094mg           57.8    2e-06   Capsella rubella
ref|XP_010492820.1|  PREDICTED: uncharacterized protein LOC104770147  57.4    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006287189.1|  hypothetical protein CARUB_v10000361mg           57.0    3e-06   Capsella rubella
ref|XP_009413883.1|  PREDICTED: uncharacterized protein LOC103995100  56.6    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006400366.1|  hypothetical protein EUTSA_v10012841mg           55.8    7e-06   Eutrema salsugineum [saltwater cress]
ref|XP_010424160.1|  PREDICTED: uncharacterized protein LOC104709208  55.5    9e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009121003.1|  PREDICTED: uncharacterized protein LOC103845859  53.5    4e-05   Brassica rapa
emb|CDY38493.1|  BnaA10g16650D                                        52.0    1e-04   Brassica napus [oilseed rape]
emb|CDY25451.1|  BnaC09g39660D                                        50.1    5e-04   Brassica napus [oilseed rape]



>ref|XP_009788026.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788027.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788028.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788029.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
Length=708

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRLGDLQPAP+P+GQEEN  LPTQNR RRRGGGGRGRGNA AVAKGPS 
Sbjct  1    MPELRSGARRSKRLGDLQPAPEPSGQEENWVLPTQNRGRRRGGGGRGRGNATAVAKGPSA  60

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMD  631
              R RP  AGRGRG+RLIDLDPEPP EA PQAV VGV EPA NR EGAADK+IAM+
Sbjct  61   ASRARPGGAGRGRGIRLIDLDPEPPCEAPPQAVPVGVAEPALNRAEGAADKNIAME  116



>ref|XP_011075041.1| PREDICTED: uncharacterized protein LOC105159627 [Sesamum indicum]
Length=705

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 90/116 (78%), Gaps = 4/116 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRLGDLQPAPQPT QEEN   P QN   R    GRGRGNAAAVAKGPS 
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPTNQEENFLAPAQN---RTRRRGRGRGNAAAVAKGPSA  57

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMD  631
                RP AAGRGRG+RLIDLDPEPP E  PQAV VG  EP FNRIEG ADK+IAMD
Sbjct  58   ATPTRPTAAGRGRGIRLIDLDPEPPCEVLPQAVGVGAGEPGFNRIEGVADKEIAMD  113



>ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603072 [Solanum tuberosum]
Length=709

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 99/117 (85%), Gaps = 3/117 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDLQPAPQP GQEENLALPTQN   RR GGGGRGRGNA A+ KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPVGQEENLALPTQNRTRRRGGGGGRGRGNATAIGKGPS  60

Query  464  TgvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMD  631
             G RGRP+ AGRGRG+RLIDLDPEP  E  PQA  VGV EPAFNR++GAADK IAMD
Sbjct  61   -GTRGRPSGAGRGRGIRLIDLDPEPLCEGLPQAAPVGVAEPAFNRVDGAADKKIAMD  116



>ref|XP_004249304.1| PREDICTED: uncharacterized protein LOC101268442 [Solanum lycopersicum]
Length=709

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 98/117 (84%), Gaps = 3/117 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDLQPAPQP GQEENL LPTQN   RR GGGGRGRGNA A+ KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPVGQEENLVLPTQNRTRRRGGGGGRGRGNATAIGKGPS  60

Query  464  TgvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMD  631
             G RGRP+ AGRGRG+RLIDLDPEPP E  PQ   VGV EPAFNR++GAADK IAMD
Sbjct  61   -GTRGRPSGAGRGRGIRLIDLDPEPPCEGLPQVAPVGVAEPAFNRVDGAADKRIAMD  116



>ref|XP_009621585.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621586.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621587.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
Length=714

 Score =   118 bits (295),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 90/120 (75%), Positives = 93/120 (78%), Gaps = 5/120 (4%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPA-PQPTGQEENLALP-TQNrtrrrggggrgrgN--AAAVAK  454
            MPELRSGARRSKRLGDLQPA PQP GQEENL LP TQNR RRRGGGG       A AV K
Sbjct  2    MPELRSGARRSKRLGDLQPAAPQPVGQEENLVLPPTQNRGRRRGGGGGRGRGNAATAVGK  61

Query  455  GPSTgvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMD  631
            GPS   R RP+  GRGRG+RLIDLDPE P E  PQA  VGV EPAFNRIEGAADK+IAMD
Sbjct  62   GPSGTTRARPSGGGRGRGIRLIDLDPETPREVLPQAAPVGVAEPAFNRIEGAADKNIAMD  121



>ref|XP_009771625.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771626.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771627.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
Length=714

 Score =   116 bits (290),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 90/120 (75%), Positives = 93/120 (78%), Gaps = 5/120 (4%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPA-PQPTGQEENLALP-TQNrtrrrggggrgrgN--AAAVAK  454
            MPELRSGARRSKRLGDLQPA PQP GQEENL LP TQNR RRRGGGG       A AV K
Sbjct  2    MPELRSGARRSKRLGDLQPAAPQPVGQEENLVLPPTQNRGRRRGGGGGRGRGNAATAVGK  61

Query  455  GPSTgvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMD  631
            GPS   R RP+ AGRGRG+RLIDLDPE P E  PQA  +GV EPAFNRIEGAADK IAMD
Sbjct  62   GPSGTTRARPSGAGRGRGIRLIDLDPETPCEVLPQAAPLGVAEPAFNRIEGAADKHIAMD  121



>ref|XP_009615719.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615725.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615727.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615731.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
Length=708

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MP+LR GARRSKRLGD QPAP+P+GQEEN  LPTQNR +RRGGGGRGRGNA AVAKGPS 
Sbjct  1    MPDLRRGARRSKRLGDPQPAPEPSGQEENWVLPTQNRGQRRGGGGRGRGNATAVAKGPSA  60

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMD  631
              R RP  AGRGRG+RLIDLDPEPP E  PQAV VGV EPA NR EGAADK+IAM+
Sbjct  61   ATRARPGGAGRGRGIRLIDLDPEPPCEVLPQAVPVGVAEPALNRAEGAADKNIAME  116



>emb|CDP14324.1| unnamed protein product [Coffea canephora]
Length=709

 Score =   114 bits (286),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 92/118 (78%), Positives = 95/118 (81%), Gaps = 4/118 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEEN--LALPTQNrtrrrggggrgrgNAAAVAKGP  460
            MPELRSGARRSKRLGDLQPA QP  QEEN  +  PTQN   RR GGGRGRGNAAAVAKGP
Sbjct  1    MPELRSGARRSKRLGDLQPAAQPAFQEENWLVQQPTQN-RTRRRGGGRGRGNAAAVAKGP  59

Query  461  STgvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMD  631
            S     RPAAAGRGRG+RLIDLDPEPP E  PQAVA G  EPA NR+EGAADKDIAMD
Sbjct  60   SAATPARPAAAGRGRGIRLIDLDPEPPCEVLPQAVAPGAVEPALNRVEGAADKDIAMD  117



>ref|XP_002281952.1| PREDICTED: uncharacterized protein LOC100267624 [Vitis vinifera]
 emb|CAN59733.1| hypothetical protein VITISV_003914 [Vitis vinifera]
Length=708

 Score =   107 bits (266),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 83/117 (71%), Positives = 93/117 (79%), Gaps = 2/117 (2%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrg-NAAAVAKGPS  463
            MPELRSG RRSKRL DLQP+PQP  Q EN  LP QNR RRR GGGRGRG NA  +AKGPS
Sbjct  1    MPELRSGPRRSKRLDDLQPSPQPGDQAENWLLPAQNRPRRRVGGGRGRGCNATPLAKGPS  60

Query  464  TgvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMD  631
              +  RPAAAGRGRG+RLIDLDPEPP E  P+A A+GV EPAFNR++  ADK+IAM+
Sbjct  61   AAIATRPAAAGRGRGIRLIDLDPEPPCEVHPEAGALGVAEPAFNRVDAVADKEIAME  117



>ref|XP_011078778.1| PREDICTED: uncharacterized protein LOC105162459 [Sesamum indicum]
Length=705

 Score =   105 bits (263),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 79/116 (68%), Positives = 83/116 (72%), Gaps = 4/116 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRLGDLQPAPQ   QEE    P Q    R    GRGRGNAAAVAKGPS 
Sbjct  1    MPELRSGARRSKRLGDLQPAPQTANQEEKFLAPAQ---TRTRRRGRGRGNAAAVAKGPSA  57

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMD  631
                RP AAGRGRGVRLIDLDPEPP E  P  V +   EPAFNRIEG A+K+I M+
Sbjct  58   ATPARPTAAGRGRGVRLIDLDPEPPREVLPPTVGLVAAEPAFNRIEGVANKEIPME  113



>ref|XP_004157014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221479 
[Cucumis sativus]
Length=742

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +2

Query  281  VTMPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKG  457
            +TMPELRSGARRS+RL DLQP  QP  Q ENLA+P  N   RR  GG    GNA AVAKG
Sbjct  33   LTMPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPNRTRRRVAGGRGRGGNAQAVAKG  92

Query  458  PSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
            PS  +  RP AA RGRG+RLIDLDPEP    P+A A+G  EP FNR+E  A+KD+A++
Sbjct  93   PSVAIPARPTAARRGRGIRLIDLDPEPCEVLPEAGAIGAAEPVFNRVEAVANKDMAIE  150



>ref|XP_007204249.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
 gb|EMJ05448.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
Length=707

 Score = 98.6 bits (244),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 79/116 (68%), Positives = 87/116 (75%), Gaps = 2/116 (2%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQP-TGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  463
            MPELRSG RRSKRL DLQP+ QP  GQ EN  LP QN+TRRR GGGRGRG   AVAKGPS
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQNKTRRRAGGGRGRG-GNAVAKGPS  59

Query  464  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
              +  R  AAGRGRGVRLIDLDPEP    P+A A+G  EP +NR+E  ADKDIAM+
Sbjct  60   PAIPTRATAAGRGRGVRLIDLDPEPCEVRPEAAALGAAEPIYNRVEVVADKDIAME  115



>ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
 gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
Length=708

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 72/116 (62%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDLQP P P  Q EN A P QN   RR GGG    GNA AV KGPS
Sbjct  1    MPELRSGARRSKRLGDLQPGPLPIDQGENWAQPAQNRTRRRVGGGRGRGGNATAVGKGPS  60

Query  464  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
              V  R  AAGRGRG RLIDLDPEP    P+ VA+G  EP +N +E  A+ +IAM+
Sbjct  61   PAVPTRRTAAGRGRGARLIDLDPEPCEVLPEPVALGAPEPVYNHVEVVANNNIAME  116



>ref|XP_008240478.1| PREDICTED: uncharacterized protein LOC103338977 [Prunus mume]
Length=707

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 78/116 (67%), Positives = 86/116 (74%), Gaps = 2/116 (2%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQP-TGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  463
            MPELRSG RRSKRL DLQP+ QP  GQ EN  LP QN+ RRR GGGRGRG   AVAKGPS
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQNKPRRRAGGGRGRG-GNAVAKGPS  59

Query  464  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
              +  R  AAGRGRGVRLIDLDPEP    P+A A+G  EP +NR+E  ADKDIAM+
Sbjct  60   PAIPTRATAAGRGRGVRLIDLDPEPCEVRPEAAALGAAEPIYNRVEVVADKDIAME  115



>gb|KJB80963.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80964.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80966.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=706

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 76/115 (66%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGAR+SKRLGDLQP  QP  Q EN  LP QN   RR  GGRGRG A AVAKGPS 
Sbjct  1    MPELRSGARKSKRLGDLQPPLQPVDQAENWVLPAQN-RTRRQVGGRGRGKATAVAKGPSP  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
             V  RP AAGRGRG+RLIDLDPEP    P A  +   +PAFN++E  A+KDIAMD
Sbjct  60   EVPNRPKAAGRGRGIRLIDLDPEPCQVLPGAPPLADAQPAFNQVEVVANKDIAMD  114



>gb|KJB80965.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=707

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 76/115 (66%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGAR+SKRLGDLQP  QP  Q EN  LP QN   RR  GGRGRG A AVAKGPS 
Sbjct  1    MPELRSGARKSKRLGDLQPPLQPVDQAENWVLPAQN-RTRRQVGGRGRGKATAVAKGPSP  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
             V  RP AAGRGRG+RLIDLDPEP    P A  +   +PAFN++E  A+KDIAMD
Sbjct  60   EVPNRPKAAGRGRGIRLIDLDPEPCQVLPGAPPLADAQPAFNQVEVVANKDIAMD  114



>ref|XP_004147533.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 gb|KGN53942.1| Casein kinase [Cucumis sativus]
Length=708

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 82/116 (71%), Gaps = 1/116 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRS+RL DLQP  QP  Q ENLA+P  N   RR  GG    GNA AVAKGPS
Sbjct  1    MPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPNRTRRRVAGGRGRGGNAQAVAKGPS  60

Query  464  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
              +  RP AA RGRG+RLIDLDPEP    P+A A+G  EP FNR+E  A+KD+A++
Sbjct  61   VAIPARPTAARRGRGIRLIDLDPEPCEVLPEAGAIGAAEPVFNRVEAVANKDMAIE  116



>ref|XP_008441978.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
 ref|XP_008441979.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
Length=708

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 82/116 (71%), Gaps = 1/116 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRS+RL DLQP  QP  Q ENLA+P  N   RR  GG    GNA AVAKGPS
Sbjct  1    MPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPNRTRRRVAGGRGRGGNAQAVAKGPS  60

Query  464  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
              +  RP AA RGRG+RLIDLDPEP    P+A A+G  EP FNR+E  A+KD+A++
Sbjct  61   VAIPARPTAARRGRGIRLIDLDPEPCEVLPEAGAIGAAEPVFNRVEAVANKDMAIE  116



>gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Erythranthe guttata]
Length=706

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 75/118 (64%), Positives = 82/118 (69%), Gaps = 8/118 (7%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRLGDL P PQ   QEE    P Q    R    GRGRGNA+AVAKGPST
Sbjct  2    MPELRSGARRSKRLGDLHPTPQTANQEEEFLAPAQ---TRTRRRGRGRGNASAVAKGPST  58

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIE--GAADKDIAMD  631
                RP AAGRGRGVRLIDLDPEPP E  P+ V +G  E   NR+E  G ADK++AM+
Sbjct  59   ATPTRPTAAGRGRGVRLIDLDPEPPREVLPETVGLGAAE--LNRVEGVGVADKEVAME  114



>gb|KDP39706.1| hypothetical protein JCGZ_02726 [Jatropha curcas]
Length=705

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 72/115 (63%), Positives = 79/115 (69%), Gaps = 2/115 (2%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRL DLQ   QP    EN   PTQN+TRRR GG    GNA  VAKG S 
Sbjct  1    MPELRSGARRSKRLDDLQALQQPINPTENWIQPTQNKTRRRAGGRGRGGNATGVAKGASP  60

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
             +  RP AAGRG+G+RLIDLDPEP    P   A+G  EP +NR+E  ADKDIAMD
Sbjct  61   AIPARPTAAGRGQGIRLIDLDPEPCEVEP--AALGAAEPGYNRVEVVADKDIAMD  113



>gb|KHG27523.1| hypothetical protein F383_15264 [Gossypium arboreum]
Length=706

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 73/115 (63%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGAR+SKRLGDLQP  QP  Q EN  LP QN   RR  GGRGRG A AVAK PS 
Sbjct  1    MPELRSGARKSKRLGDLQPPFQPVDQAENWVLPAQN-RTRRQVGGRGRGKATAVAKVPSP  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
             V  R  A+GRGRG+RLIDLDPEP    P A  +   +PAFN++E  A+KDIAMD
Sbjct  60   EVPNRTKASGRGRGIRLIDLDPEPCQVLPGAPPLADAQPAFNQVEVVANKDIAMD  114



>gb|KJB82581.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=654

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
             V  RP AAGRGRG+RLIDLDPEP    PQA  +    PAFNR+E  ADKDIAM+
Sbjct  60   AVPTRPTAAGRGRGIRLIDLDPEPRQVLPQAEPLAAAGPAFNRVEVVADKDIAME  114



>gb|KJB82580.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=587

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
             V  RP AAGRGRG+RLIDLDPEP    PQA  +    PAFNR+E  ADKDIAM+
Sbjct  60   AVPTRPTAAGRGRGIRLIDLDPEPRQVLPQAEPLAAAGPAFNRVEVVADKDIAME  114



>gb|KJB82579.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=706

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
             V  RP AAGRGRG+RLIDLDPEP    PQA  +    PAFNR+E  ADKDIAM+
Sbjct  60   AVPTRPTAAGRGRGIRLIDLDPEPRQVLPQAEPLAAAGPAFNRVEVVADKDIAME  114



>gb|KJB82583.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=707

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
             V  RP AAGRGRG+RLIDLDPEP    PQA  +    PAFNR+E  ADKDIAM+
Sbjct  60   AVPTRPTAAGRGRGIRLIDLDPEPRQVLPQAEPLAAAGPAFNRVEVVADKDIAME  114



>gb|KJB82582.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=696

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 83/115 (72%), Gaps = 1/115 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGPS 
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRAGGRGRGNAAGVAKGPSA  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
             V  RP AAGRGRG+RLIDLDPEP    PQA  +    PAFNR+E  ADKDIAM+
Sbjct  60   AVPTRPTAAGRGRGIRLIDLDPEPRQVLPQAEPLAAAGPAFNRVEVVADKDIAME  114



>gb|KHG04306.1| Casein kinase I-like protein [Gossypium arboreum]
Length=706

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN   RR  GGRGRGNAA VAKGP  
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN-RTRRRVGGRGRGNAAGVAKGPLA  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
             V  RP AAGRGRG+RLIDLDPEP    PQA  +    PAFNR+E  ADKDIAM+
Sbjct  60   AVPTRPTAAGRGRGIRLIDLDPEPCQVLPQAEPLAAAGPAFNRVEVVADKDIAME  114



>ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956210 [Pyrus x bretschneideri]
Length=707

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 84/116 (72%), Gaps = 2/116 (2%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQP-TGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  463
            MPELRSG RRSKRL DLQP+ QP  GQ EN  LP QN+ RRR GGGRGR    AVAKGPS
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQNKPRRRAGGGRGR-GGNAVAKGPS  59

Query  464  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
              +  R  AAGRGRGVRLIDLDPEP    P+A A+G  +P +NR +  ADKDIAM+
Sbjct  60   PAIPTRQTAAGRGRGVRLIDLDPEPCEVRPEAAALGAADPIYNRADVVADKDIAME  115



>ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 isoform X1 [Cicer 
arietinum]
 ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 isoform X2 [Cicer 
arietinum]
Length=708

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 68/116 (59%), Positives = 75/116 (65%), Gaps = 1/116 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDLQPAP P  Q EN   P QN   RR GGG    GNA  V K  S
Sbjct  1    MPELRSGARRSKRLGDLQPAPLPVDQGENWTQPAQNRTRRRVGGGRGRGGNATGVGKASS  60

Query  464  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
              V  R  AAGRGRG RLIDLDPEP    P+ VA+   EP +N +E  A+ +IAM+
Sbjct  61   PAVPTRRTAAGRGRGARLIDLDPEPCEVLPEPVALRAPEPLYNHVEVVANNNIAME  116



>ref|XP_007030718.1| Kinase family protein [Theobroma cacao]
 gb|EOY11220.1| Kinase family protein [Theobroma cacao]
Length=705

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 79/115 (69%), Positives = 84/115 (73%), Gaps = 2/115 (2%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRL DLQP PQP  Q EN  LP QNRTRRR GG     NAAAVAKGPS 
Sbjct  1    MPELRSGARRSKRLDDLQP-PQPVDQAENWVLPAQNRTRRRVGGRGRG-NAAAVAKGPSP  58

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
             V  RP AAGRGRG+RLIDLDPEP    P+A  +   EPA NR+E  ADKDIAM+
Sbjct  59   AVPTRPTAAGRGRGIRLIDLDPEPCQVLPEAAPLAAAEPALNRVEVVADKDIAME  113



>ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 ref|XP_006479105.1| PREDICTED: uncharacterized protein LOC102619111 isoform X2 [Citrus 
sinensis]
 gb|ESR56658.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 gb|KDO55047.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=704

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 85/115 (74%), Gaps = 3/115 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRL DLQP PQP  Q EN  LP QNRTRRR GGGRGRGNA AVAK P  
Sbjct  1    MPELRSGARRSKRLDDLQPPPQPVDQTENWLLPAQNRTRRRVGGGRGRGNATAVAK-PGI  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                RP AAGRGRG+RLIDLDPEP    P+A A+   EP +N +E  ADKDIAM+
Sbjct  60   --PARPTAAGRGRGIRLIDLDPEPCEVLPEAAALVAAEPVYNPLEVVADKDIAME  112



>ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619111 isoform X1 [Citrus 
sinensis]
 gb|KDO55048.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=708

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 85/115 (74%), Gaps = 3/115 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRL DLQP PQP  Q EN  LP QNRTRRR GGGRGRGNA AVAK P  
Sbjct  1    MPELRSGARRSKRLDDLQPPPQPVDQTENWLLPAQNRTRRRVGGGRGRGNATAVAK-PGI  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                RP AAGRGRG+RLIDLDPEP    P+A A+   EP +N +E  ADKDIAM+
Sbjct  60   --PARPTAAGRGRGIRLIDLDPEPCEVLPEAAALVAAEPVYNPLEVVADKDIAME  112



>ref|XP_010276388.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276389.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276390.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276391.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
Length=714

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 77/122 (63%), Positives = 82/122 (67%), Gaps = 7/122 (6%)
 Frame = +2

Query  287  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrg-NAAAVA  451
            MPELRSGAR    RSKRL +LQP+PQP  Q EN  LP  NRT RR G GRGRG NA AVA
Sbjct  1    MPELRSGARQARLRSKRLDELQPSPQPLDQAENCVLPAPNRTGRRVGAGRGRGCNATAVA  60

Query  452  KGPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVA--VGVREPAFNRIEGAADKDIA  625
            K P      RP  AGRGRGVRLIDLDPE P E    VA  VG  EPAFN++EG  DKD  
Sbjct  61   KEPLGATPSRPVGAGRGRGVRLIDLDPELPHEVLPEVAPSVGAGEPAFNQVEGVGDKDFV  120

Query  626  MD  631
            M+
Sbjct  121  ME  122



>gb|EYU39997.1| hypothetical protein MIMGU_mgv1a002328mg [Erythranthe guttata]
Length=687

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 72/115 (63%), Positives = 81/115 (70%), Gaps = 21/115 (18%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELR GARRSKRLGDLQ A     QEEN+    QN   R  G GRGRGNAAAVAKGP+ 
Sbjct  1    MPELRRGARRSKRLGDLQAA----NQEENIVASAQN---RPRGRGRGRGNAAAVAKGPT-  52

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                RP AAGRGRG+RLIDLDPEPP++          EPAFNR+EG ADK+IA++
Sbjct  53   ----RPTAAGRGRGIRLIDLDPEPPWQG---------EPAFNRVEGVADKEIAIE  94



>gb|EPS68531.1| hypothetical protein M569_06230 [Genlisea aurea]
Length=704

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 69/116 (59%), Positives = 77/116 (66%), Gaps = 5/116 (4%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRLGDLQ APQP  QE++    TQNRTRRRG G       A       +
Sbjct  1    MPELRSGARRSKRLGDLQSAPQPENQEQDFLPSTQNRTRRRGRGRGNAAAVAKGTAATPS  60

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAMD  631
                RP AAGRGRG RLIDLD + P E  PQA+  GV +PA NRIEG  DK++AMD
Sbjct  61   ----RPTAAGRGRGARLIDLDLQTPCEVQPQALGGGVGDPALNRIEGVGDKEVAMD  112



>ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123555 [Populus euphratica]
Length=707

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 76/116 (66%), Positives = 81/116 (70%), Gaps = 5/116 (4%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrt-rrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRL DLQP  QP  Q ENL +P QN+T RR GGG    GNAA VAKG S
Sbjct  1    MPELRSGARRSKRLDDLQPPQQPNNQAENLTVPVQNKTRRRAGGGRGRGGNAAGVAKGAS  60

Query  464  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                 RP AAGRGRGVRLIDLDPEP    P   AVG  E  +NR+E  ADKDIAM+
Sbjct  61   --PATRPTAAGRGRGVRLIDLDPEPCQVEP--AAVGAAELGYNRLEVVADKDIAME  112



>ref|XP_002325416.1| kinase family protein [Populus trichocarpa]
 gb|EEE99797.1| kinase family protein [Populus trichocarpa]
Length=720

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 76/116 (66%), Positives = 81/116 (70%), Gaps = 5/116 (4%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrt-rrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRL DLQP  QP  Q ENL +P QN+T RR GGG    GNAA VAKG S
Sbjct  1    MPELRSGARRSKRLDDLQPPQQPNNQAENLTVPVQNKTRRRAGGGRGRGGNAAGVAKGAS  60

Query  464  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                 RP AAGRGRGVRLIDLDPEP    P   AVG  E  +NR+E  ADKDIAM+
Sbjct  61   --PTTRPTAAGRGRGVRLIDLDPEPCQVEP--AAVGAAELGYNRLEVVADKDIAME  112



>ref|XP_002525432.1| casein kinase, putative [Ricinus communis]
 gb|EEF36922.1| casein kinase, putative [Ricinus communis]
Length=705

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 79/115 (69%), Gaps = 2/115 (2%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRL DLQ   QP    +N   P QN+TRRR GG    GNA AVAKG S 
Sbjct  1    MPELRSGARRSKRLDDLQTLQQPVNPADNWIQPAQNKTRRRVGGRGRGGNATAVAKGASP  60

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
             +  RP AAGRGRG+RLIDLDPEP     +A A+   EP +NR+E  ADKDIAM+
Sbjct  61   AIPTRPTAAGRGRGIRLIDLDPEPC--EVEAAALRAAEPGYNRVEVVADKDIAME  113



>ref|XP_010088042.1| Casein kinase I isoform delta [Morus notabilis]
 gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis]
Length=706

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 71/116 (61%), Positives = 81/116 (70%), Gaps = 2/116 (2%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSG RRSKRLGDLQP+PQP GQ EN  LPT N+ RRR GGGRGRG     AKGPS 
Sbjct  1    MPELRSGVRRSKRLGDLQPSPQPIGQAENWPLPTPNKPRRRVGGGRGRGGNGV-AKGPSP  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQ-AVAVGVREPAFNRIEGAADKDIAMD  631
             +  R  A GRGRG++L+DLDPEP    P+ A       PA+N +E  ADKDIAM+
Sbjct  60   AIPTRQTAGGRGRGIKLLDLDPEPCEVVPEGAGLGAAAGPAYNHLEVVADKDIAME  115



>ref|XP_010558720.1| PREDICTED: uncharacterized protein LOC104827271 isoform X2 [Tarenaya 
hassleriana]
Length=704

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 75/115 (65%), Positives = 82/115 (71%), Gaps = 3/115 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRS+RL DLQP PQ   Q EN  LP Q  TRRRGGGGRGRGNAAA+A     
Sbjct  1    MPELRSGARRSRRLDDLQPNPQLIDQTENCVLPPQTGTRRRGGGGRGRGNAAALA---KG  57

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                RP AA RGRG+RLIDL+PEP    P   A+G  EPAFNR EG ADKDIA++
Sbjct  58   AAPPRPTAACRGRGIRLIDLEPEPCDLHPAGGAIGAAEPAFNRAEGVADKDIAVE  112



>ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036219.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036220.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036222.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 gb|KCW47748.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47749.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47750.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
Length=702

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 71/117 (61%), Positives = 83/117 (71%), Gaps = 9/117 (8%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRL +LQP PQ   Q +N ALPTQN+TRRRGGGGRGRGNA AV +G +T
Sbjct  1    MPELRSGARRSKRLDNLQPNPQQIEQADNWALPTQNKTRRRGGGGRGRGNATAVGRGRAT  60

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQA--VAVGVREPAFNRIEGAADKDIAMD  631
                    AGRGRG+R IDLDPEP    P+   +     +PAFNR+E   +KDIAM+
Sbjct  61   -------GAGRGRGIRFIDLDPEPCEVVPEVAALGAAAADPAFNRVEVVGEKDIAME  110



>ref|XP_003624626.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES80844.1| casein kinase I-like protein [Medicago truncatula]
Length=708

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 68/116 (59%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDLQP PQP  Q EN A P QN   RR GGG    GNA  + KG S
Sbjct  1    MPELRSGARRSKRLGDLQPGPQPVDQGENWAEPAQNRTRRRVGGGRGRGGNATGLGKGSS  60

Query  464  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
              V  R  AAGRGRG RLIDLDP+P    P+ VA+  +EP +N +E  A+ +IAM+
Sbjct  61   PAVPTRRTAAGRGRGARLIDLDPQPCDLLPEPVALRAQEPVYNNVEVVANNNIAME  116



>ref|XP_010257690.1| PREDICTED: uncharacterized protein LOC104597684 [Nelumbo nucifera]
Length=708

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 72/121 (60%), Positives = 78/121 (64%), Gaps = 11/121 (9%)
 Frame = +2

Query  287  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrg-NAAAVA  451
            MPELRSGAR    RSKRL DLQP+ Q   Q EN ALP  NRT RR G GRGRG NA AVA
Sbjct  1    MPELRSGARQARLRSKRLDDLQPSSQHPDQAENCALPAPNRTGRRVGAGRGRGCNATAVA  60

Query  452  KGPSTgvrgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAFNRIEGAADKDIAM  628
            KGPS     R   AGRGR  RLIDLDPE P E  P+A  +     A N+ EG  DKD+AM
Sbjct  61   KGPSGATPARAIPAGRGRANRLIDLDPEAPHEVLPEAAKL-----AINQAEGVGDKDLAM  115

Query  629  D  631
            +
Sbjct  116  E  116



>gb|KJB45108.1| hypothetical protein B456_007G289500 [Gossypium raimondii]
Length=706

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 73/115 (63%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRLGDL+P  QP  Q EN  LP QN   RR  GGRGRGNA  VAKGPS 
Sbjct  1    MPELRSGARRSKRLGDLEPPSQPVVQAENWVLPAQN-RSRRRVGGRGRGNAVGVAKGPSP  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
             V  RP AAGRGRG+RL D DPE     P+A  +   EP FN+ E  ADKDIAM+
Sbjct  60   AVPTRPRAAGRGRGIRLTDFDPELCQVLPEAAPLAAAEPVFNQAEVVADKDIAME  114



>gb|KHG17118.1| Casein kinase I isoform delta [Gossypium arboreum]
 gb|KHG17119.1| Casein kinase I isoform delta [Gossypium arboreum]
Length=706

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 73/115 (63%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRSKRLGDL+P  QP  Q EN  LP QN   RR  GGRGRGNA  VAKGPS 
Sbjct  1    MPELRSGARRSKRLGDLEPPSQPVVQAENWVLPAQN-RSRRRVGGRGRGNAVGVAKGPSP  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
             V  RP AAGRGRG+RL D DPE     P+A  +   EP FN+ E  ADKDIAM+
Sbjct  60   AVPTRPRAAGRGRGIRLTDFDPELCQVLPEAAPLAAAEPVFNQAEVVADKDIAME  114



>ref|XP_010558719.1| PREDICTED: uncharacterized protein LOC104827271 isoform X1 [Tarenaya 
hassleriana]
Length=703

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 56/128 (44%), Positives = 63/128 (49%), Gaps = 30/128 (23%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQ-------------Nrtrrrggggrg  427
            MPELRSGARRS+RL DLQP PQ   Q EN  LP Q             N      G    
Sbjct  1    MPELRSGARRSRRLDDLQPNPQLIDQTENCVLPPQTGTRRRGGGRGRGNAAALAKGAAPP  60

Query  428  rgNAAAVAKGPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGA  607
            R  AA   +G                 +RLIDL+PEP    P   A+G  EPAFNR EG 
Sbjct  61   RPTAACRGRG-----------------IRLIDLEPEPCDLHPAGGAIGAAEPAFNRAEGV  103

Query  608  ADKDIAMD  631
            ADKDIA++
Sbjct  104  ADKDIAVE  111



>gb|ABN09797.1| Protein kinase [Medicago truncatula]
Length=573

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDLQP PQP  Q EN A P QN   RR GGG    GNA  + KG S
Sbjct  1    MPELRSGARRSKRLGDLQPGPQPVDQGENWAEPAQNRTRRRVGGGRGRGGNATGLGKGSS  60

Query  464  TgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
              V  R  AAGRGRG RLIDLDP+P    P+ VA+  +EP +N +E  A+ +IAM+
Sbjct  61   PAVPTRRTAAGRGRGARLIDLDPQPCDLLPEPVALRAQEPVYNNVEVVANNNIAME  116



>ref|XP_006408240.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
 gb|ESQ49693.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
Length=701

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 73/120 (61%), Gaps = 16/120 (13%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKG---  457
            MPELRSGARRS+RL D QP PQ   Q EN+ALP Q  TRRRGGG       AA+AKG   
Sbjct  1    MPELRSGARRSRRLDD-QPNPQLVEQAENIALPPQTATRRRGGGRGRGN--AALAKGAVP  57

Query  458  --PSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
              P+   RGR           L DL+PEP    P A A+G  EPA NR EGAADKDIA++
Sbjct  58   PRPTAAGRGRGIR--------LTDLEPEPCEVRPAAGALGAAEPALNRAEGAADKDIAVE  109



>ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine 
max]
 ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine 
max]
 gb|KHN46781.1| Casein kinase I like hhp1 [Glycine soja]
Length=709

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 65/101 (64%), Gaps = 2/101 (2%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPT--QNrtrrrggggrgrgNAAAVAKGP  460
            MPELRSGARRSKRLGDLQP P P  Q EN   P       RR GGG    GNA AV KGP
Sbjct  1    MPELRSGARRSKRLGDLQPGPLPVDQGENWQQPAAPNRTRRRVGGGRGRGGNATAVGKGP  60

Query  461  STgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREP  583
            S  V  R  AAGRGRG RLIDLDPEP    P+ VA+G  EP
Sbjct  61   SPAVPTRRTAAGRGRGARLIDLDPEPCEVLPEPVALGAPEP  101



>gb|KJB46017.1| hypothetical protein B456_007G343500 [Gossypium raimondii]
Length=739

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 73/120 (61%), Positives = 80/120 (67%), Gaps = 6/120 (5%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTG----QEENLALPTQNrtrrrggggrgrgNAAAVAK  454
            MP+LRSGARRSKR+ DLQP P        Q EN  L  QNRTRRR GG      AA VAK
Sbjct  1    MPDLRSGARRSKRIDDLQPPPPAHPQPVEQPENCVLLAQNRTRRRVGGRGRGN-AAGVAK  59

Query  455  GPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREP-AFNRIEGAADKDIAMD  631
            GPS  V  RP AAGRGRG+RLIDLDPEP    P A+ +   EP AFNR+E  ADKDIAM+
Sbjct  60   GPSAVVPTRPTAAGRGRGIRLIDLDPEPCQVLPGALPLVAAEPAAFNRVEVVADKDIAME  119



>gb|KJB46016.1| hypothetical protein B456_007G343500 [Gossypium raimondii]
Length=711

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 75/120 (63%), Positives = 82/120 (68%), Gaps = 6/120 (5%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTG----QEENLALPTQNrtrrrggggrgrgNAAAVAK  454
            MP+LRSGARRSKR+ DLQP P        Q EN  L  QN   RR  GGRGRGNAA VAK
Sbjct  1    MPDLRSGARRSKRIDDLQPPPPAHPQPVEQPENCVLLAQN-RTRRRVGGRGRGNAAGVAK  59

Query  455  GPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREP-AFNRIEGAADKDIAMD  631
            GPS  V  RP AAGRGRG+RLIDLDPEP    P A+ +   EP AFNR+E  ADKDIAM+
Sbjct  60   GPSAVVPTRPTAAGRGRGIRLIDLDPEPCQVLPGALPLVAAEPAAFNRVEVVADKDIAME  119



>ref|XP_002873876.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50135.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=691

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 68/115 (59%), Positives = 78/115 (68%), Gaps = 14/115 (12%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARR +     QP+PQ TGQ +N+ LP Q  TRRRGGGGRGRGNAAA    P  
Sbjct  1    MPELRSGARRLR-----QPSPQVTGQADNIELPPQPVTRRRGGGGRGRGNAAAKGAAP--  53

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                    AGRGRG+RLIDL+ EP    P   AVG  EPAFN++EG A+KDIAM+
Sbjct  54   --PRPTGGAGRGRGIRLIDLEAEPCEVRP---AVG--EPAFNQVEGVAEKDIAME  101



>ref|XP_002884421.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60680.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=702

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 67/116 (58%), Positives = 73/116 (63%), Gaps = 7/116 (6%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRS+RL D QP PQ   Q EN+ LP Q  TRRRGGG      A A       
Sbjct  1    MPELRSGARRSRRL-DEQPNPQLVEQAENIVLPPQTATRRRGGGRGRGNAALA-----KA  54

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAV-GVREPAFNRIEGAADKDIAMD  631
                RP AAGRGRG+RL DL+PEP    P A AV G  EPA NR+EG ADKDIA +
Sbjct  55   APPPRPTAAGRGRGIRLTDLEPEPCEVRPAAGAVIGATEPALNRVEGVADKDIAAE  110



>ref|NP_187044.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAF05853.1|AC011698_4 putative casein kinase [Arabidopsis thaliana]
 gb|AEE74014.1| protein kinase family protein [Arabidopsis thaliana]
Length=701

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 76/113 (67%), Gaps = 6/113 (5%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRS+RL D QP P    Q EN+ LP Q  TRRRGGG       AA+AKG + 
Sbjct  1    MPELRSGARRSRRL-DEQPNPPLVEQAENIVLPPQTATRRRGGGRGRGN--AALAKGAA-  56

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIA  625
                RP AAGRGRG+RL DL+PEP    P A A+G  EPA NR+EG ADKDIA
Sbjct  57   --PPRPTAAGRGRGIRLTDLEPEPCEVRPAAGAIGATEPALNRVEGVADKDIA  107



>ref|XP_009102089.1| PREDICTED: uncharacterized protein LOC103828226 [Brassica rapa]
Length=704

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 69/117 (59%), Positives = 77/117 (66%), Gaps = 8/117 (7%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPA--PQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGP  460
            MPELRSGARRS+RL D QP   PQ   Q EN+ALP Q  TRRRGGG     NAA      
Sbjct  1    MPELRSGARRSRRLED-QPNSNPQLVEQAENIALPPQTATRRRGGGRGRG-NAALA----  54

Query  461  STgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
               V  RPAAAGRGRG+RL DL+PEP    P A A+G  EPA NR+EG AD+DIA +
Sbjct  55   KAAVPPRPAAAGRGRGIRLRDLEPEPCEVLPAAGALGGAEPALNRVEGVADQDIAAE  111



>emb|CDY29971.1| BnaC01g40370D [Brassica napus]
Length=703

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 70/117 (60%), Gaps = 13/117 (11%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAA----AVAK  454
            MPELRSGARRS+RL D QP PQ   Q +N+ALP      RR GGGRGRGNAA    AV  
Sbjct  1    MPELRSGARRSRRLED-QPNPQVVEQADNIALPLPQTATRRRGGGRGRGNAALAKAAVPP  59

Query  455  GPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIA  625
             P+   RGR           L DL+PEP    P A  +G  EPA NR+EG AD+DIA
Sbjct  60   RPTAAGRGRGIR--------LRDLEPEPCEVLPAAGDLGATEPALNRVEGVADQDIA  108



>ref|XP_010516062.1| PREDICTED: uncharacterized protein LOC104791759 isoform X1 [Camelina 
sativa]
Length=700

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 72/113 (64%), Gaps = 7/113 (6%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRS+RL D QP PQ   Q E +  P    T  R  GG      AA+AKGP+ 
Sbjct  1    MPELRSGARRSRRL-DEQPNPQLVEQPEIIVSP---PTATRRRGGGRGRGNAALAKGPA-  55

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIA  625
                RP AAGRGRG+RL DLDPEP    P A A+G  EPA NR+EG ADKD+A
Sbjct  56   --PPRPTAAGRGRGIRLTDLDPEPCEVRPAAGALGATEPAINRVEGVADKDLA  106



>ref|XP_010516137.1| PREDICTED: uncharacterized protein LOC104791759 isoform X2 [Camelina 
sativa]
 ref|XP_010516215.1| PREDICTED: uncharacterized protein LOC104791759 isoform X3 [Camelina 
sativa]
Length=699

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 72/113 (64%), Gaps = 7/113 (6%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRS+RL D QP PQ   Q E +  P    T  R  GG      AA+AKGP+ 
Sbjct  1    MPELRSGARRSRRL-DEQPNPQLVEQPEIIVSP---PTATRRRGGGRGRGNAALAKGPA-  55

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIA  625
                RP AAGRGRG+RL DLDPEP    P A A+G  EPA NR+EG ADKD+A
Sbjct  56   --PPRPTAAGRGRGIRLTDLDPEPCEVRPAAGALGATEPAINRVEGVADKDLA  106



>ref|XP_010672056.1| PREDICTED: uncharacterized protein LOC104888715 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=711

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 68/120 (57%), Positives = 76/120 (63%), Gaps = 5/120 (4%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDL-QPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDL QP+P+   Q EN   PTQN+TRRRGGG     NAAA     +
Sbjct  1    MPELRSGARRSKRLGDLQQPSPELNDQGENCHPPTQNKTRRRGGGRGRGANAAAGLAKGA  60

Query  464  Tgv--rgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAF-NRIEGAADKDIAMD  631
                   +   AGRGRGVR+IDLDPE P E  PQ         A  NR+EG ADKDIAM+
Sbjct  61   QAAVGARQTGGAGRGRGVRVIDLDPEIPGEVLPQVAPAVGAAGAAQNRVEGGADKDIAME  120



>ref|XP_010672054.1| PREDICTED: uncharacterized protein LOC104888715 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=713

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 68/120 (57%), Positives = 76/120 (63%), Gaps = 5/120 (4%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDL-QPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPS  463
            MPELRSGARRSKRLGDL QP+P+   Q EN   PTQN+TRRRGGG     NAAA     +
Sbjct  1    MPELRSGARRSKRLGDLQQPSPELNDQGENCHPPTQNKTRRRGGGRGRGANAAAGLAKGA  60

Query  464  Tgv--rgrpaaagrgrgvrLIDLDPEPPFEA-PQAVAVGVREPAF-NRIEGAADKDIAMD  631
                   +   AGRGRGVR+IDLDPE P E  PQ         A  NR+EG ADKDIAM+
Sbjct  61   QAAVGARQTGGAGRGRGVRVIDLDPEIPGEVLPQVAPAVGAAGAAQNRVEGGADKDIAME  120



>ref|NP_197320.1| protein kinase [Arabidopsis thaliana]
 dbj|BAB09477.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AED92517.1| protein kinase [Arabidopsis thaliana]
Length=691

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 64/115 (56%), Positives = 74/115 (64%), Gaps = 16/115 (14%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARR +     QP+PQ TGQ +N+ LP Q  TRRRGGGGRGRGNA   A     
Sbjct  1    MPELRSGARRLR-----QPSPQVTGQADNIELPPQPVTRRRGGGGRGRGNAKGAA-----  50

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                     GRGRG+RLIDL+ EP    P   AVG  EPAFN++E  A+KDIAM+
Sbjct  51   -PPRPAGGVGRGRGIRLIDLEAEPCEVRP---AVG--EPAFNQVEAVAEKDIAME  99



>ref|XP_010454044.1| PREDICTED: uncharacterized protein LOC104735873 [Camelina sativa]
Length=692

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 66/115 (57%), Positives = 74/115 (64%), Gaps = 15/115 (13%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARR +     QP+PQ   Q EN+ LP Q    RR GGGRGRGNAAA     S 
Sbjct  1    MPELRSGARRLR-----QPSPQVIDQAENIELPPQ-PVTRRRGGGRGRGNAAA----KSP  50

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                   AAGRGRG+RLIDL+ EP    P   AVG  EPAFN++EG ADKDIAM+
Sbjct  51   APPRPAGAAGRGRGIRLIDLEAEPIEVRP---AVG--EPAFNQVEGVADKDIAME  100



>ref|XP_008805378.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
 ref|XP_008805379.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
Length=718

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 72/127 (57%), Gaps = 13/127 (10%)
 Frame = +2

Query  287  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVA  451
            MPELRSGAR    +SK+L D+ P PQ   Q EN  LPT N   RR G G     NAAAV 
Sbjct  1    MPELRSGARQARLKSKKLDDIPPPPQRIDQAENWVLPTTNRTGRRGGAGRGRGSNAAAVV  60

Query  452  KGPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAV------GVREPAFNR-IEGAA  610
            KGPS     RP   GRGRG+ LIDLDP+ P E     AV      G +    N+  EG A
Sbjct  61   KGPSA-TPVRPTVGGRGRGITLIDLDPDQPCEILPGAAVGGAAVPGAQGFILNQAAEGIA  119

Query  611  DKDIAMD  631
            DKD+AMD
Sbjct  120  DKDLAMD  126



>gb|KHF98002.1| hypothetical protein F383_12939 [Gossypium arboreum]
Length=668

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 82/123 (67%), Gaps = 9/123 (7%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTG-------QEENLALPTQNrtrrrggggrgrgNAAA  445
            MP+LRSGARRSKR+ DLQP P P         Q EN  L  QN   RR  GGRGRGNAA 
Sbjct  1    MPDLRSGARRSKRIDDLQPPPPPHPPHPQPVEQPENCVLLAQN-RTRRRVGGRGRGNAAG  59

Query  446  VAKGPSTgvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREP-AFNRIEGAADKDI  622
            VAKGP   V  RP AAGRGRG+RLIDLDPEP    P A+ +   EP AFNR+E  ADKDI
Sbjct  60   VAKGPLAVVPTRPTAAGRGRGIRLIDLDPEPCQVLPGALPLVAAEPAAFNRVEVVADKDI  119

Query  623  AMD  631
            AM+
Sbjct  120  AME  122



>ref|XP_010463863.1| PREDICTED: uncharacterized protein LOC104744499 [Camelina sativa]
Length=701

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 74/113 (65%), Gaps = 6/113 (5%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRS+RL D QP PQ   Q E +  P    TRRRGGG       AA+AKG + 
Sbjct  1    MPELRSGARRSRRL-DEQPNPQLVEQPEIIVSPPPTATRRRGGGRGRGN--AALAKGAA-  56

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIA  625
                RP AAGRGRG+RL DLDPEP    P A A+G  EPA NR+EG ADKD+A
Sbjct  57   --PPRPTAAGRGRGIRLTDLDPEPCEVRPAAGALGATEPALNRVEGVADKDLA  107



>ref|XP_010485760.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485761.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485762.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
Length=701

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 74/113 (65%), Gaps = 6/113 (5%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRS+RL D QP PQ   Q E +  P    TRRRGGG       AA+AKG + 
Sbjct  1    MPELRSGARRSRRL-DEQPNPQLVEQPEIIVSPPPTATRRRGGGRGRGN--AALAKGAA-  56

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIA  625
                RP AAGRGRG+RL DLDPEP    P A A+G  EPA NR+EG ADKD+A
Sbjct  57   --PPRPTAAGRGRGIRLTDLDPEPCEVRPAAGALGATEPALNRVEGVADKDLA  107



>ref|XP_010485763.1| PREDICTED: uncharacterized protein LOC104764028 isoform X2 [Camelina 
sativa]
Length=700

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 74/113 (65%), Gaps = 6/113 (5%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRS+RL D QP PQ   Q E +  P    TRRRGGG       AA+AKG + 
Sbjct  1    MPELRSGARRSRRL-DEQPNPQLVEQPEIIVSPPPTATRRRGGGRGRGN--AALAKGAA-  56

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIA  625
                RP AAGRGRG+RL DLDPEP    P A A+G  EPA NR+EG ADKD+A
Sbjct  57   --PPRPTAAGRGRGIRLTDLDPEPCEVRPAAGALGATEPALNRVEGVADKDLA  107



>ref|XP_010908708.1| PREDICTED: uncharacterized protein LOC105035016 [Elaeis guineensis]
Length=718

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 72/131 (55%), Gaps = 21/131 (16%)
 Frame = +2

Query  287  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQN-rtrrrggggrgrgNAAAVA  451
            MPELRSGAR    +SK+L D+   PQP  Q EN  LPT N   RR G G     NAAAVA
Sbjct  1    MPELRSGARQARLKSKKLDDIPLPPQPIDQAENWVLPTTNRTGRRGGAGRGRGSNAAAVA  60

Query  452  KGPSTgvrgrpaaagrgrgvrLIDLDPEPPFE-----------APQAVAVGVREPAFNRI  598
            KGPS     RP   GRGRG+ LIDLDP+ P E            P A    + + A    
Sbjct  61   KGPSA-TPVRPTVGGRGRGITLIDLDPDQPCEILAGAAVRGAAVPGAQGFILNQAA----  115

Query  599  EGAADKDIAMD  631
            EG ADKD+AMD
Sbjct  116  EGIADKDLAMD  126



>emb|CDY21155.1| BnaA01g33860D [Brassica napus]
Length=704

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRS+RL D    PQ   Q EN+  P      RR GGGRGRGNAA        
Sbjct  1    MPELRSGARRSRRLEDQPNNPQVVEQAENIVPPPPQTATRRRGGGRGRGNAALAKAAVPP  60

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIA  625
                     G      L DL+PEP    P A A+G  EPA NR+EG AD+DIA
Sbjct  61   RPAAAGRGRGIR----LRDLEPEPCEVRPAAGALGATEPALNRVEGVADQDIA  109



>emb|CDY50866.1| BnaA05g37270D [Brassica napus]
Length=798

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 50/115 (43%), Positives = 58/115 (50%), Gaps = 8/115 (7%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            M ELRSGARRS+R+ D QP PQ   Q   L  P Q  T RR GG      AAAV   P+T
Sbjct  1    MRELRSGARRSRRIEDHQPNPQLL-QNILLPPPPQTATTRRRGGYAALAKAAAVPPRPTT  59

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                            L DL+PEP    P A  +G  E A NR+ G ADKD+A +
Sbjct  60   AAGRGRGIR-------LTDLEPEPCEVCPSAGVLGAAEAALNRVGGVADKDLAAE  107



>ref|XP_006297091.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
 gb|EOA29989.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
Length=701

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 74/113 (65%), Gaps = 6/113 (5%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARRS+RL D QP PQ   Q E +  P    TRRRGGG       AA+AKG + 
Sbjct  1    MPELRSGARRSRRL-DEQPNPQLVEQAEVIVSPPPTGTRRRGGGRGRGN--AALAKGAA-  56

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIA  625
                RP AAGRGRG+RL DL+PEP    P A A+G  EPA NR++G ADKD+A
Sbjct  57   --PPRPTAAGRGRGIRLTDLEPEPCEVRPAAGALGATEPAINRVDGVADKDLA  107



>ref|XP_010492820.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
 ref|XP_010492821.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
Length=692

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 61/115 (53%), Positives = 70/115 (61%), Gaps = 15/115 (13%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARR +     QP+PQ   Q EN+ LP Q  TRRRGGG      AA      + 
Sbjct  1    MPELRSGARRLR-----QPSPQVIDQAENIELPPQPVTRRRGGGRGRGNAAAK-----AP  50

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                   AAGRGRG+RLIDL+ EP    P   AVG  EPAFN++EG ADKDIAM+
Sbjct  51   APPRPTGAAGRGRGIRLIDLEAEPIEVRP---AVG--EPAFNQVEGVADKDIAME  100



>ref|XP_006287189.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
 gb|EOA20087.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
Length=692

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 62/115 (54%), Positives = 70/115 (61%), Gaps = 15/115 (13%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARR +     QP+PQ   Q EN+ LP Q  TRRRGGG      AA  A  P  
Sbjct  1    MPELRSGARRLR-----QPSPQVIDQAENIELPPQPVTRRRGGGRGRGNAAAKAAAPPR-  54

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                   AAGRGRG+RLIDL+ EP    P   AVG  EPA N++EG ADKDIAM+
Sbjct  55   ----PTGAAGRGRGIRLIDLEAEPCEIRP---AVG--EPALNQVEGVADKDIAME  100



>ref|XP_009413883.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413884.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 52/91 (57%), Positives = 56/91 (62%), Gaps = 6/91 (7%)
 Frame = +2

Query  287  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAK  454
            MPELRSGAR    RSK+L D+   PQP GQ EN  LP  N  RR G G      AAAVAK
Sbjct  1    MPELRSGARQGRLRSKKLEDIPVPPQPFGQAENPILPAPN-RRRGGAGRGRGSKAAAVAK  59

Query  455  GPSTgvrgrpaaagrgrgvrLIDLDPEPPFE  547
            GPS     RP   GRGRG+ LIDLDP+ P E
Sbjct  60   GPSV-APARPTFGGRGRGIALIDLDPDQPCE  89



>ref|XP_006400366.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
 gb|ESQ41819.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
Length=695

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 69/115 (60%), Positives = 77/115 (67%), Gaps = 12/115 (10%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARR +     QP+PQ   Q EN+ LP Q  TRRRGGGGRGRG AAA+AK    
Sbjct  1    MPELRSGARRLR-----QPSPQVIDQAENIELPPQTVTRRRGGGGRGRGTAAALAK--GA  53

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                   AAGRGRG+RLIDL+ EP    P   AVG  E AFN+ EGAADKDIAM+
Sbjct  54   APPRPAGAAGRGRGIRLIDLEAEPCEARP---AVG--EAAFNQAEGAADKDIAME  103



>ref|XP_010424160.1| PREDICTED: uncharacterized protein LOC104709208 [Camelina sativa]
Length=647

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 69/115 (60%), Gaps = 15/115 (13%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARR +     QP+PQ   Q EN+ LP Q  TRRRGGG      AA      + 
Sbjct  1    MPELRSGARRLR-----QPSPQVIDQAENIELPPQPVTRRRGGGRGRGNAAAK-----AP  50

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                   AAGRGRG+RLIDL+ EP    P   AVG  EP FN++EG ADKDIAM+
Sbjct  51   APPRPTGAAGRGRGIRLIDLEAEPIEVRP---AVG--EPVFNQVEGVADKDIAME  100



>ref|XP_009121003.1| PREDICTED: uncharacterized protein LOC103845859 [Brassica rapa]
Length=691

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 68/115 (59%), Gaps = 16/115 (14%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MP+LRSGARR +     QP PQ   Q EN+ LP Q  TRRRGGGG GRG   A A   + 
Sbjct  1    MPDLRSGARRLR-----QPNPQAIEQAENIELPRQTTTRRRGGGGGGRGRGTAAALAKAA  55

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                   A GRGRG+RLIDL+ EP           V EPAFN+++G ADK IAM+
Sbjct  56   APPRPTGATGRGRGIRLIDLEAEP-----------VGEPAFNQVQGVADKGIAME  99



>emb|CDY38493.1| BnaA10g16650D [Brassica napus]
Length=690

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 57/115 (50%), Positives = 67/115 (58%), Gaps = 17/115 (15%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARR +     QP PQ   Q EN+ LP Q  TRRRGGGG      AA     + 
Sbjct  1    MPELRSGARRLR-----QPNPQAIEQAENIELPRQTTTRRRGGGGGRGRGTAAALAK-AA  54

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                   AAGRGRG+RLIDL+ EP           V EPAFN+++G ADK+IAM+
Sbjct  55   APPRPTGAAGRGRGIRLIDLEAEP-----------VGEPAFNQVQGVADKNIAME  98



>emb|CDY25451.1| BnaC09g39660D [Brassica napus]
Length=690

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 55/115 (48%), Positives = 65/115 (57%), Gaps = 17/115 (15%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQNrtrrrggggrgrgNAAAVAKGPST  466
            MPELRSGARR +     QP PQ   Q EN+ LP Q  TRRRGGGG      AA     + 
Sbjct  1    MPELRSGARRLR-----QPNPQAIEQAENIELPRQTTTRRRGGGGGRGRGTAAALAK-AA  54

Query  467  gvrgrpaaagrgrgvrLIDLDPEPPFEAPQAVAVGVREPAFNRIEGAADKDIAMD  631
                   A GRGRG+RLIDL+ EP           + EPAFN+++G ADK IAM+
Sbjct  55   APPRPTGATGRGRGIRLIDLEAEP-----------IGEPAFNQVQGVADKGIAME  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875