BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF049H12

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792116.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    143   5e-37   Nicotiana sylvestris
ref|XP_006353939.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    138   6e-35   Solanum tuberosum [potatoes]
ref|XP_004235401.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    137   6e-35   Solanum lycopersicum
ref|XP_009630493.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    134   2e-33   Nicotiana tomentosiformis
emb|CDO98567.1|  unnamed protein product                                122   3e-29   Coffea canephora [robusta coffee]
ref|XP_011072066.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    120   2e-28   Sesamum indicum [beniseed]
ref|XP_002317728.2|  hypothetical protein POPTR_0012s03370g             116   8e-28   
ref|XP_010088395.1|  E3 ubiquitin-protein ligase RING1                  117   1e-27   Morus notabilis
ref|XP_007209333.1|  hypothetical protein PRUPE_ppa008345mg             117   2e-27   
ref|XP_008240345.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    117   2e-27   Prunus mume [ume]
ref|XP_011003690.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    115   1e-26   Populus euphratica
ref|XP_008346897.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    114   1e-26   Malus domestica [apple tree]
ref|XP_010246216.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    114   2e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010249658.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    113   5e-26   Nelumbo nucifera [Indian lotus]
gb|EYU17802.1|  hypothetical protein MIMGU_mgv1a008418mg                113   5e-26   Erythranthe guttata [common monkey flower]
ref|XP_011086955.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    113   5e-26   Sesamum indicum [beniseed]
emb|CBI35278.3|  unnamed protein product                                112   9e-26   Vitis vinifera
ref|XP_009355932.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    112   1e-25   Pyrus x bretschneideri [bai li]
emb|CAN79596.1|  hypothetical protein VITISV_042386                     111   2e-25   Vitis vinifera
ref|XP_003634328.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       111   2e-25   Vitis vinifera
ref|XP_009357359.1|  PREDICTED: E3 ubiquitin-protein ligase RING1       110   3e-25   Pyrus x bretschneideri [bai li]
gb|ACT21194.1|  zinc finger protein                                     110   4e-25   Carica papaya [mamon]
ref|XP_006441411.1|  hypothetical protein CICLE_v10020902mg             109   7e-25   Citrus clementina [clementine]
gb|KDO48740.1|  hypothetical protein CISIN_1g0186891mg                  109   8e-25   Citrus sinensis [apfelsine]
ref|XP_006493415.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    108   2e-24   Citrus sinensis [apfelsine]
ref|XP_008393509.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    107   5e-24   Malus domestica [apple tree]
ref|XP_006374275.1|  hypothetical protein POPTR_0015s05600g             104   4e-23   Populus trichocarpa [western balsam poplar]
ref|XP_011047757.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    102   2e-22   Populus euphratica
ref|XP_003534093.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    100   2e-21   Glycine max [soybeans]
ref|XP_004299466.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  99.8    3e-21   Fragaria vesca subsp. vesca
ref|XP_003549174.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  99.4    3e-21   Glycine max [soybeans]
ref|XP_008467256.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  99.0    5e-21   Cucumis melo [Oriental melon]
gb|EYU22293.1|  hypothetical protein MIMGU_mgv1a006235mg              99.0    9e-21   Erythranthe guttata [common monkey flower]
ref|XP_010687250.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  95.5    8e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006495422.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  83.2    1e-16   
ref|XP_007152550.1|  hypothetical protein PHAVU_004G139600g           84.7    5e-16   Phaseolus vulgaris [French bean]
ref|XP_004515274.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  83.2    2e-15   Cicer arietinum [garbanzo]
gb|KJB31865.1|  hypothetical protein B456_005G211800                  82.4    3e-15   Gossypium raimondii
ref|XP_010541863.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  81.3    5e-15   Tarenaya hassleriana [spider flower]
ref|XP_010487953.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  81.3    6e-15   Camelina sativa [gold-of-pleasure]
gb|KJB79836.1|  hypothetical protein B456_013G068800                  80.9    1e-14   Gossypium raimondii
ref|XP_010533212.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  80.1    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_002883213.1|  zinc finger family protein                       79.7    2e-14   
gb|KHG01857.1|  E3 ubiquitin-protein ligase RING1                     79.3    3e-14   Gossypium arboreum [tree cotton]
ref|XP_006297993.1|  hypothetical protein CARUB_v10014036mg           79.0    5e-14   
ref|XP_010508254.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  78.6    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009401096.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  78.2    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_188629.1|  E3 ubiquitin-protein ligase RING1-like protein      77.4    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466163.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  77.4    2e-13   Camelina sativa [gold-of-pleasure]
dbj|BAB01310.1|  unnamed protein product                              77.8    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010069512.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  76.6    4e-13   Eucalyptus grandis [rose gum]
gb|EYU29041.1|  hypothetical protein MIMGU_mgv1a026532mg              73.6    8e-13   Erythranthe guttata [common monkey flower]
gb|KDP37541.1|  hypothetical protein JCGZ_05980                       74.3    1e-12   Jatropha curcas
ref|XP_004236843.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  74.3    1e-12   Solanum lycopersicum
ref|XP_011070454.1|  PREDICTED: E3 ubiquitin-protein ligase RING1     72.4    9e-12   Sesamum indicum [beniseed]
emb|CDP18533.1|  unnamed protein product                              70.1    5e-11   Coffea canephora [robusta coffee]
gb|ABK96352.1|  unknown                                               69.3    8e-11   Populus trichocarpa x Populus deltoides
ref|XP_002310643.2|  hypothetical protein POPTR_0007s07510g           69.3    8e-11   
ref|XP_006359295.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.9    1e-10   Solanum tuberosum [potatoes]
ref|XP_010557559.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.6    2e-10   Tarenaya hassleriana [spider flower]
emb|CDY25360.1|  BnaA05g19240D                                        68.2    2e-10   Brassica napus [oilseed rape]
ref|XP_003555841.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    4e-10   Glycine max [soybeans]
ref|XP_008355430.1|  PREDICTED: uncharacterized protein LOC103419088  68.2    5e-10   
ref|XP_003620252.1|  RING finger protein                              67.0    7e-10   
gb|EPS73974.1|  hypothetical protein M569_00782                       66.6    7e-10   Genlisea aurea
ref|XP_007043255.1|  RING/U-box superfamily protein, putative         66.2    1e-09   Theobroma cacao [chocolate]
ref|XP_006847820.1|  hypothetical protein AMTR_s00029p00043520        65.9    2e-09   
ref|XP_003536735.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.1    2e-09   Glycine max [soybeans]
emb|CDY24592.1|  BnaC05g32760D                                        64.7    4e-09   Brassica napus [oilseed rape]
ref|XP_009135656.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  63.9    6e-09   Brassica rapa
gb|KJB77384.1|  hypothetical protein B456_012G134900                  64.3    6e-09   Gossypium raimondii
gb|KHG22497.1|  E3 ubiquitin-protein ligase RING1                     64.3    6e-09   Gossypium arboreum [tree cotton]
sp|P0CH30.1|RING1_GOSHI  RecName: Full=E3 ubiquitin-protein ligas...  64.3    6e-09   Gossypium hirsutum [American cotton]
ref|XP_008803049.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  64.3    7e-09   Phoenix dactylifera
ref|XP_011002257.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  63.5    8e-09   Populus euphratica
ref|NP_001152117.1|  RHC1A                                            63.5    1e-08   Zea mays [maize]
emb|CDX82271.1|  BnaA03g35500D                                        61.6    2e-08   
ref|XP_009383684.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  62.8    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY36069.1|  BnaC03g41290D                                        61.2    2e-08   Brassica napus [oilseed rape]
ref|XP_010940373.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  62.4    3e-08   Elaeis guineensis
ref|XP_007142767.1|  hypothetical protein PHAVU_007G015200g           62.0    4e-08   Phaseolus vulgaris [French bean]
ref|XP_010935556.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  61.6    5e-08   Elaeis guineensis
ref|XP_006406436.1|  hypothetical protein EUTSA_v10021059mg           60.1    2e-07   Eutrema salsugineum [saltwater cress]
emb|CDY22790.1|  BnaA06g02870D                                        58.9    3e-07   Brassica napus [oilseed rape]
ref|XP_009588217.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  58.9    3e-07   Nicotiana tomentosiformis
ref|XP_004137524.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  58.9    4e-07   Cucumis sativus [cucumbers]
gb|ACG33105.1|  RHC1A                                                 58.9    4e-07   Zea mays [maize]
ref|NP_001130953.1|  uncharacterized LOC100192058                     58.9    4e-07   Zea mays [maize]
ref|NP_001064906.2|  Os10g0487400                                     58.5    4e-07   
ref|XP_006661882.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  58.9    4e-07   Oryza brachyantha
ref|XP_004982780.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  58.9    4e-07   Setaria italica
ref|XP_002467049.1|  hypothetical protein SORBIDRAFT_01g018800        58.9    5e-07   Sorghum bicolor [broomcorn]
emb|CDY42507.1|  BnaC06g03510D                                        58.5    5e-07   Brassica napus [oilseed rape]
ref|XP_003574092.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  58.5    5e-07   Brachypodium distachyon [annual false brome]
ref|XP_009111341.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  58.5    6e-07   Brassica rapa
ref|XP_010034290.1|  PREDICTED: E3 ubiquitin-protein ligase RING1     58.2    7e-07   Eucalyptus grandis [rose gum]
emb|CDY72364.1|  BnaAnng40830D                                        57.0    8e-07   Brassica napus [oilseed rape]
gb|AAL59019.1|AC087182_2  putative zinc finger protein                58.2    8e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EAY78992.1|  hypothetical protein OsI_34100                        58.2    9e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010322969.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  57.8    1e-06   Solanum lycopersicum
emb|CDY33437.1|  BnaC01g32880D                                        57.0    2e-06   Brassica napus [oilseed rape]
ref|XP_008811090.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  57.0    2e-06   Phoenix dactylifera
ref|XP_006393160.1|  hypothetical protein EUTSA_v10011690mg           56.2    3e-06   Eutrema salsugineum [saltwater cress]
gb|ACF84253.1|  unknown                                               55.5    3e-06   Zea mays [maize]
gb|KJB49973.1|  hypothetical protein B456_008G147900                  55.8    5e-06   Gossypium raimondii
ref|XP_009145710.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  55.8    5e-06   Brassica rapa
ref|XP_006306505.1|  hypothetical protein CARUB_v10012493mg           54.3    1e-05   Capsella rubella
ref|XP_011022020.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  53.9    2e-05   Populus euphratica
ref|XP_003592721.1|  RING finger protein                              53.5    3e-05   Medicago truncatula
gb|KFM59559.1|  hypothetical protein X975_00622                       49.7    7e-05   Stegodyphus mimosarum
ref|XP_002307159.2|  hypothetical protein POPTR_0005s09270g           52.0    9e-05   
ref|XP_001777565.1|  predicted protein                                52.0    1e-04   
ref|XP_003529396.2|  PREDICTED: uncharacterized protein LOC100820426  51.2    2e-04   
ref|XP_004149872.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  51.2    2e-04   Cucumis sativus [cucumbers]
ref|XP_009788594.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  50.1    4e-04   Nicotiana sylvestris
ref|XP_008449154.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  49.3    5e-04   Cucumis melo [Oriental melon]
gb|EAZ16486.1|  hypothetical protein OsJ_31957                        49.7    5e-04   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_009792116.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
 ref|XP_009792117.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
Length=398

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 107/176 (61%), Gaps = 13/176 (7%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ+Y CY CE+TVTITP PNSEL CPNCNG FLEE+ETAPP +  NN   FP   A    
Sbjct  21   PQNYHCYQCEQTVTITPSPNSELTCPNCNGTFLEESETAPPPSNPNNPDNFPFFSAATTD  80

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAA--------GRSPNQFHPLLFL  465
                GG G        + + +GG +A DDLSAL  G+A          RSPNQF P  FL
Sbjct  81   DLPFGGGGFPIVFSSSAASPAGGAVAFDDLSALLSGIAGGAGGAAFPSRSPNQFDPFAFL  140

Query  466  QNYLQTMRASGANIQLVFXNSgggggvpgnl-----gDYFVGPGLEQLIQQLMEND  618
             NY+ TMRA GANIQLVF N  GG G          GDYF GPGLEQLIQQL END
Sbjct  141  NNYMSTMRAGGANIQLVFENHPGGSGGGEFRFPGNFGDYFHGPGLEQLIQQLAEND  196



>ref|XP_006353939.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum tuberosum]
Length=387

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 107/177 (60%), Gaps = 19/177 (11%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ+Y CY CE+TVTITP PNSEL CPNCNG FLEE+ETAPP+NP+ N   F  A      
Sbjct  17   PQNYHCYQCEQTVTITPSPNSELSCPNCNGTFLEESETAPPSNPNPNTHPFFSAATTDDL  76

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAG------RSPNQFHPLLFLQN  471
              GGG           + + +GG +  DDLSALFGGMA G      RSPNQF P  FL N
Sbjct  77   PFGGGFPIVFSSN---AASPAGGAVGFDDLSALFGGMAGGSAALPGRSPNQFDPFAFLNN  133

Query  472  YLQTMRASGANIQLVFXNSgggggvpgnlg--------DYFVGPGLEQLIQQLMEND  618
            Y  +MR  G NIQL+F N   GGG              DYF+GPGLEQLIQQL END
Sbjct  134  YFSSMR--GGNIQLIFENHPDGGGGGAGGDFRIPGNLGDYFLGPGLEQLIQQLAEND  188



>ref|XP_004235401.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_004235402.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_010318345.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_010318346.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=383

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 107/177 (60%), Gaps = 19/177 (11%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ+Y CY CE+TVTITP PNSEL CPNCNG FLEE+ETAPP+NP+ N   F  A      
Sbjct  17   PQNYHCYQCEQTVTITPSPNSELSCPNCNGTFLEESETAPPSNPNPNTHPFFSAATTDDL  76

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAG------RSPNQFHPLLFLQN  471
              GGG           + + +GG +  DDLSALFGGMA G      RSPNQF P  FL N
Sbjct  77   PFGGGFPIVFSSN---AASPAGGAVGFDDLSALFGGMAGGSAALPGRSPNQFDPFAFLNN  133

Query  472  YLQTMRASGANIQLVFXNSgggggvpgnlg--------DYFVGPGLEQLIQQLMEND  618
            Y  +MR  G NIQL+F N   GGG              DYF+GPGLEQLIQQL END
Sbjct  134  YFSSMR--GGNIQLIFENHPDGGGGGAGGDFRIPGNLGDYFLGPGLEQLIQQLAEND  188



>ref|XP_009630493.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
tomentosiformis]
Length=399

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 109/177 (62%), Gaps = 14/177 (8%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ+Y CY CE+TVTITP PNSEL CPNCNG FLEE+ETAPP +  NN   FP   A    
Sbjct  21   PQNYHCYQCEQTVTITPSPNSELTCPNCNGTFLEESETAPPPSNPNNPDNFPFFSAATTD  80

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAA--------GRSPNQFHPLLFL  465
                GG G        + + +GG +ALDDLSAL  G++          RSP+QF P  FL
Sbjct  81   DLPFGGGGFPIAFSSSAASPAGGAVALDDLSALLSGISGGAGGAAFPSRSPHQFDPFAFL  140

Query  466  QNYLQTMRASGANIQLVFXNSgggggvpgnlg------DYFVGPGLEQLIQQLMEND  618
             NY+ TMRA GANIQL+F N  GGGG  G         DYF GPGLEQLIQQL END
Sbjct  141  NNYVSTMRAGGANIQLIFENHPGGGGGGGEFRFPGNFGDYFHGPGLEQLIQQLAEND  197



>emb|CDO98567.1| unnamed protein product [Coffea canephora]
Length=391

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 114/175 (65%), Gaps = 15/175 (9%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPN--SELVCPNCNGNFLEEAETApptnpsnnnpffpgadafp  303
            PQ+YFCY C+RTVTI+P P+  SELVCPNC+G FLEE+E+A                   
Sbjct  21   PQNYFCYQCQRTVTISPSPSPTSELVCPNCHGGFLEESESADEPPSPPAVGPDLFFPPIF  80

Query  304  fgfgggggvggggeglvfSTASSGGGIALDDLSALFGGMAA--GRSPNQFHPLLFLQNYL  477
             G GGGGG GGG   +  S++  GG I   DLSALFGG A    +SPN+F+P  FL NYL
Sbjct  81   GGGGGGGGGGGGFPVIFSSSSGGGGEI---DLSALFGGAAGYPAQSPNEFNPFAFLNNYL  137

Query  478  QTMRASGANIQLVFXN--------SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
              +RA GANIQ+VF N         GGGGG+PGN GDYFVGPGLEQLIQQL END
Sbjct  138  NNLRAGGANIQVVFDNPGGGVGIGFGGGGGLPGNFGDYFVGPGLEQLIQQLAEND  192



>ref|XP_011072066.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=380

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 104/173 (60%), Gaps = 14/173 (8%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPL--PNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafp  303
            P+ YFCY CER VTI P   P +ELVCP+C G FLEE+ETAPP+NP N        D FP
Sbjct  19   PRQYFCYQCERQVTIAPPLSPTAELVCPDCQGGFLEESETAPPSNPENPISNPFLPDNFP  78

Query  304  fgfgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQT  483
               G             FS +S GGG   DDLSALFG     RSPN+F+P  FL NY+  
Sbjct  79   SLGGFPIIFSSAPGASAFSVSSGGGGGGFDDLSALFGP----RSPNEFNPFAFLNNYINN  134

Query  484  MRASGANIQLVFXNSgggggvpgnlg--------DYFVGPGLEQLIQQLMEND  618
            ++A GANIQLVF + GGGG     +         DYF+GPGLEQLIQQL END
Sbjct  135  LQARGANIQLVFESPGGGGMSGSGVDFRLPMNLGDYFIGPGLEQLIQQLAEND  187



>ref|XP_002317728.2| hypothetical protein POPTR_0012s03370g [Populus trichocarpa]
 gb|EEE95948.2| hypothetical protein POPTR_0012s03370g [Populus trichocarpa]
Length=269

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 94/189 (50%), Gaps = 57/189 (30%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFCY C+RTVTITP P S+L CPNC   FLEE E+  P++                 
Sbjct  10   PQLYFCYQCDRTVTITPSPTSDLSCPNCQEGFLEECESPNPSSNPV--------------  55

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAG-------------------R  432
                              +  G  I LD+ +++FGGMA                     +
Sbjct  56   -----------------DSGLGPAILLDEFASIFGGMAPTPRSSNNSTTTNSSSASPLFQ  98

Query  433  SPNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnl-------gDYFVGPGLEQ  591
             P+ F+P  FLQNYLQTMRA GANIQ V  N+ G GG+           GDYF+GPGLEQ
Sbjct  99   DPDGFNPFAFLQNYLQTMRAGGANIQFVIENNSGMGGMDTTGFRLPANLGDYFIGPGLEQ  158

Query  592  LIQQLMEND  618
            LIQQL END
Sbjct  159  LIQQLAEND  167



>ref|XP_010088395.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
 gb|EXC35976.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
Length=378

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 95/172 (55%), Gaps = 13/172 (8%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFC+ C RTV+ITP P S+LVCP C G FLEE +   P+   + N FF  +      
Sbjct  18   PQPYFCHQCNRTVSITPSPTSDLVCPVCGGGFLEEVQNPNPSPEPSPNSFFSFSSDDSSF  77

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGG----MAAGRSPNQFHPLLFLQNYL  477
               G  +         S++  GGG  +DDL ALFGG    ++     + F+P  FLQNYL
Sbjct  78   GARGFPLLFTTT----SSSGHGGGALVDDLPALFGGPLTRVSQSEDTDAFNPFAFLQNYL  133

Query  478  QTMRASGANIQLVFXNSgggggvpgnlg-----DYFVGPGLEQLIQQLMEND  618
            QT+RA+GAN+Q V   + G              DYF GPGLEQLIQQL END
Sbjct  134  QTLRATGANVQFVIDGNPGDPAGFRVPTNLNLGDYFFGPGLEQLIQQLAEND  185



>ref|XP_007209333.1| hypothetical protein PRUPE_ppa008345mg [Prunus persica]
 gb|EMJ10532.1| hypothetical protein PRUPE_ppa008345mg [Prunus persica]
Length=336

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 102/175 (58%), Gaps = 21/175 (12%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFC+ C+RTV++ P P S+LVCP C+G F+EE E + P     N  F   +   P  
Sbjct  18   PQLYFCHQCDRTVSLNPPPTSDLVCPICSGGFVEEMEASNPNPFPPNPFFSVPSSDAPPF  77

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQ----FHPLLFLQNYL  477
               G  +           ++ G G   DDLSALFGG  A  SP Q    F+P +FLQNYL
Sbjct  78   ASSGFPLLF---------SAPGPGNFSDDLSALFGGAPARSSPFQDPDAFNPFVFLQNYL  128

Query  478  QTMRASGANIQLVFXNSgggggvpg--------nlgDYFVGPGLEQLIQQLMEND  618
            QT+RA+GAN+Q V  N+ G GG P         NLGDYF GPGLEQLIQQL END
Sbjct  129  QTLRANGANVQFVIDNNPGAGGDPAGFRVPPNLNLGDYFFGPGLEQLIQQLAEND  183



>ref|XP_008240345.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Prunus mume]
Length=381

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 101/175 (58%), Gaps = 21/175 (12%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFC+ C+RTV++ P P S+LVCP C+G F+EE ET        N  F   +   P  
Sbjct  18   PQLYFCHQCDRTVSLNPPPTSDLVCPICSGGFVEEMETPNSNPFPPNPFFSVPSSDAPPF  77

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQ----FHPLLFLQNYL  477
               G  +           ++ G G   DDLSALFGG  A  SP Q    F+P +FLQNYL
Sbjct  78   ASSGFPLLF---------SAPGPGNFSDDLSALFGGAPARSSPFQDPDAFNPFVFLQNYL  128

Query  478  QTMRASGANIQLVFXNSgggggvpg--------nlgDYFVGPGLEQLIQQLMEND  618
            QT+RA+GAN+Q V  N+ G GG P         NLGDYF GPGLEQLIQQL END
Sbjct  129  QTLRANGANVQFVIDNNPGAGGDPAGFRVPHNLNLGDYFFGPGLEQLIQQLAEND  183



>ref|XP_011003690.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=346

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 94/189 (50%), Gaps = 57/189 (30%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFCY C+RTVTI P P S+L CPNC+  FLEE E+  P++                 
Sbjct  10   PQLYFCYQCDRTVTINPSPTSDLSCPNCHEGFLEEYESPNPSSNPV--------------  55

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAG-------------------R  432
                              +  G  I LD+ +++FGGMA                     +
Sbjct  56   -----------------DSGLGPAILLDEFASIFGGMAPTPRSSNNSTTTNSSSASPLFQ  98

Query  433  SPNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnl-------gDYFVGPGLEQ  591
             P+ F+P  FLQNYLQTMRA GANIQ V  N+ G GG+           GDYFVGPGLEQ
Sbjct  99   DPDGFNPFAFLQNYLQTMRAGGANIQFVIENNSGMGGMDTTGFRLPANLGDYFVGPGLEQ  158

Query  592  LIQQLMEND  618
            LIQQL END
Sbjct  159  LIQQLAEND  167



>ref|XP_008346897.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
 ref|XP_008346898.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
Length=381

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 98/175 (56%), Gaps = 15/175 (9%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFC+ C+RTV++TP P S+LVCP C+G FLEE ET  P+    N  F   +   P  
Sbjct  17   PQLYFCHECDRTVSLTPSPTSDLVCPLCSGGFLEEMETPNPSPFPPNPFFSFPSSDAPPF  76

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSP----NQFHPLLFLQNYL  477
               G  +            + G     DDLSALFGG     SP    + F+P +FLQNYL
Sbjct  77   ASSGFPLLFSSSAPG---PAPGPANIADDLSALFGGAPQRSSPFHDPDAFNPFVFLQNYL  133

Query  478  QTMRASGANIQLVFXN--------SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            QT+RA+GAN+Q V  +        SG       NLGDYF GPGLEQLIQQL END
Sbjct  134  QTLRANGANVQFVIDSTPGGGGDPSGFRAPTNLNLGDYFFGPGLEQLIQQLAEND  188



>ref|XP_010246216.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=361

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 97/172 (56%), Gaps = 15/172 (9%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            P+ YFCY C RTV ITP P S+LVCP+CNG FLEE E   P    N +PFF     FP  
Sbjct  17   PRPYFCYQCNRTVLITPSPTSDLVCPDCNGGFLEEYENPNPRPSLNPDPFFDNLAGFPSF  76

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS-------PNQFHPLLFLQ  468
              G G           ST++SG      +LS LFG     RS       P  F+P  FLQ
Sbjct  77   ATGIGLPVLL------STSTSGDFQGPTELSTLFGPALRHRSTSASFQEPEVFNPFAFLQ  130

Query  469  NYLQTMRASGANIQLVFXNSgggggvpgnlg--DYFVGPGLEQLIQQLMEND  618
            NYLQ +RA GANIQ V  N+ G GG+       DYF+GPGLEQLIQQL END
Sbjct  131  NYLQALRADGANIQFVIENNPGDGGIRLPSNLGDYFIGPGLEQLIQQLAEND  182



>ref|XP_010249658.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=363

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 99/173 (57%), Gaps = 13/173 (8%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFCY C RTV ITP P+S+LVCP+CNG FLEE E   P+  SN +     +D F   
Sbjct  17   PQQYFCYQCNRTVLITPSPSSDLVCPSCNGGFLEEYENPNPSPASNLDSLLGFSDNFSGL  76

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS--------PNQFHPLLFL  465
                 G+G           +SG      DLS LFG     RS        P  F+PL FL
Sbjct  77   PSLVAGLGFSPFF---PAPTSGDPQNPTDLSGLFGPGFRLRSSPTYLQEGPEAFNPLAFL  133

Query  466  QNYLQTMRASGANIQLVFXNSggggg--vpgnlgDYFVGPGLEQLIQQLMEND  618
            Q+YLQ +RA GANIQ V  NS G     +P NLGDYF+GPGLEQLIQQL END
Sbjct  134  QSYLQALRADGANIQFVIENSPGDTAFRLPANLGDYFIGPGLEQLIQQLAEND  186



>gb|EYU17802.1| hypothetical protein MIMGU_mgv1a008418mg [Erythranthe guttata]
Length=374

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 112/180 (62%), Gaps = 20/180 (11%)
 Frame = +1

Query  130  PQDYFCYHCERTVTI--TPLPNSELVCPNCNGNFLEEAETApptnpsnn------npffp  285
            P+ YFCY CER VTI   P P +E+ CP+C+G FLEE++TAP +NP++       +  FP
Sbjct  18   PKQYFCYQCERNVTIGPPPSPTAEIFCPDCHGGFLEESDTAPSSNPTDALPNPFFDDSFP  77

Query  286  gadafpfgfgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFL  465
             + A+               G  FS +S GG    DDLSALFGG    +SPN+F+PL FL
Sbjct  78   TSAAYGAPPVIFSSSSAAPGGTSFSFSSGGGAGGFDDLSALFGGT---QSPNEFNPLAFL  134

Query  466  QNYLQTMRASGANIQLVFXNSgggggvpgnlg---------DYFVGPGLEQLIQQLMEND  618
             NY+ ++++ GANIQLVF +SGGGGG+ G            DYFVGPGLEQLIQQL END
Sbjct  135  TNYVNSLQSRGANIQLVFQSSGGGGGIGGGGAEFRLPTNLGDYFVGPGLEQLIQQLAEND  194



>ref|XP_011086955.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
 ref|XP_011086956.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
 ref|XP_011086957.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=382

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 109/177 (62%), Gaps = 19/177 (11%)
 Frame = +1

Query  133  QDYFCYHCERTVTITPLPN--SELVCPNCNGNFLEEAETApptnpsnn------npffpg  288
            + YFCY CER VTITP P+  +ELVCPNC+G+FLEE+ETAPP+NP++          FP 
Sbjct  17   RQYFCYQCERHVTITPPPSPTAELVCPNCDGSFLEESETAPPSNPTDTFPNPFFAEDFPA  76

Query  289  adafpfgfgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQ  468
            + AF               G  FS +S GG    DDLSALFG     RSPN+F+P  FL 
Sbjct  77   SAAFGGFPVVFSSSSAAPAGGSFSISSGGGVDGFDDLSALFGT----RSPNEFNPFAFLS  132

Query  469  NYLQTMRASGANIQLVFX-------NSgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            NY+  ++A GANIQLVF          G    +P NLGDYF+GPGLEQLIQQL END
Sbjct  133  NYMNNLQARGANIQLVFEAPGGGGMGGGMDFRLPTNLGDYFIGPGLEQLIQQLAEND  189



>emb|CBI35278.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 90/168 (54%), Gaps = 11/168 (7%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFCY C  TV+ITP P S+ +CP+CN  FLEE E   P       P      +    
Sbjct  66   PQSYFCYQCNLTVSITPSPTSDPLCPHCNDGFLEEVENPNPNPIPVPIPNPFLGFSDLPS  125

Query  310  fgggggvggggeglvfSTASSGGGIALD---DLSALFGGMAAGRSPNQFHPLLFLQNYLQ  480
                G        LVFSTA +GG I L    D   LFG       P+ FHP  FLQNYLQ
Sbjct  126  LSAAGATATAFPPLVFSTA-AGGSIDLQNSVDFPGLFGA-----DPDAFHPFAFLQNYLQ  179

Query  481  TMRASGANIQLVFXNSgggggvpgn--lgDYFVGPGLEQLIQQLMEND  618
            T+RA G N+Q V   +   G    +  LGDYF+GPGLEQLIQQL END
Sbjct  180  TLRAGGTNVQFVIDGNSPEGTFRLSPNLGDYFIGPGLEQLIQQLAEND  227



>ref|XP_009355932.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
 ref|XP_009355933.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
Length=381

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 99/175 (57%), Gaps = 15/175 (9%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFC+ C+RTV++TP P S+LVCP C+G FLEE ET  P     N  F   +   P  
Sbjct  17   PQLYFCHQCDRTVSLTPSPTSDLVCPLCSGGFLEEMETPNPNPFPPNPFFSFPSSDAPPF  76

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSP----NQFHPLLFLQNYL  477
               G  +         +   +   IA DDLSALFGG     SP    + F+P +FLQNYL
Sbjct  77   ASSGFPLLFSSSASGSAPGPAN--IA-DDLSALFGGAPQRSSPFHDPDAFNPFVFLQNYL  133

Query  478  QTMRASGANIQLVFXN--------SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            QT+RA+GAN+Q V  +        SG       NLGDYF GPGLEQLIQQL END
Sbjct  134  QTLRANGANVQFVIDSTPGGGGDPSGFRAPTNLNLGDYFFGPGLEQLIQQLAEND  188



>emb|CAN79596.1| hypothetical protein VITISV_042386 [Vitis vinifera]
Length=371

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 88/168 (52%), Gaps = 11/168 (7%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFCY C  TV+ITP P S+ +CP+CN  FLEE E   P       P      +    
Sbjct  24   PQSYFCYQCNLTVSITPSPTSDPLCPHCNDGFLEEVENPNPNPIPVPIPNPFLGFSDLPS  83

Query  310  fgggggvggggeglvfSTASSGGGIALD---DLSALFGGMAAGRSPNQFHPLLFLQNYLQ  480
                G        LVFSTA +GG I L    D   LFG       P+ FHP  FLQNYLQ
Sbjct  84   LSAAGATATAFPPLVFSTA-AGGSIDLQNSVDFPGLFGA-----DPDAFHPFAFLQNYLQ  137

Query  481  TMRASGANIQLVFXNSgggggvpgnlg--DYFVGPGLEQLIQQLMEND  618
            T+RA G N+Q V   +   G    +    DYF+GPGLEQLIQQL END
Sbjct  138  TLRAGGTNVQFVIDGNSPEGTFRLSPNLGDYFIGPGLEQLIQQLAEND  185



>ref|XP_003634328.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Vitis vinifera]
 ref|XP_010663919.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Vitis vinifera]
Length=369

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 88/168 (52%), Gaps = 11/168 (7%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFCY C  TV+ITP P S+ +CP+CN  FLEE E   P       P      +    
Sbjct  22   PQSYFCYQCNLTVSITPSPTSDPLCPHCNDGFLEEVENPNPNPIPVPIPNPFLGFSDLPS  81

Query  310  fgggggvggggeglvfSTASSGGGIALD---DLSALFGGMAAGRSPNQFHPLLFLQNYLQ  480
                G        LVFSTA +GG I L    D   LFG       P+ FHP  FLQNYLQ
Sbjct  82   LSAAGATATAFPPLVFSTA-AGGSIDLQNSVDFPGLFGA-----DPDAFHPFAFLQNYLQ  135

Query  481  TMRASGANIQLVFXNSgggggvpgnlg--DYFVGPGLEQLIQQLMEND  618
            T+RA G N+Q V   +   G    +    DYF+GPGLEQLIQQL END
Sbjct  136  TLRAGGTNVQFVIDGNSPEGTFRLSPNLGDYFIGPGLEQLIQQLAEND  183



>ref|XP_009357359.1| PREDICTED: E3 ubiquitin-protein ligase RING1, partial [Pyrus 
x bretschneideri]
Length=304

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 98/175 (56%), Gaps = 15/175 (9%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFC+ C+RTV++TP P S+LVCP C+G FLEE ET  P     N  F   +   P  
Sbjct  17   PQLYFCHQCDRTVSLTPSPTSDLVCPLCSGGFLEEMETPNPNPFPPNPFFSFPSSDAPPF  76

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSP----NQFHPLLFLQNYL  477
               G  +         +   +   IA DDLSALFGG     SP    + F+P +FLQNYL
Sbjct  77   ASSGFPLLFSSSASGSAPGPAN--IA-DDLSALFGGAPQRSSPFPDPDAFNPFVFLQNYL  133

Query  478  QTMRASGANIQLVFXNSgg--------gggvpgnlgDYFVGPGLEQLIQQLMEND  618
            QT+RA+GAN+Q V  +  G              NLGDYF GPGLEQLIQQL END
Sbjct  134  QTLRANGANVQFVIDSPPGGGGDPSGFRAPTNLNLGDYFFGPGLEQLIQQLAEND  188



>gb|ACT21194.1| zinc finger protein [Carica papaya]
Length=340

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 94/180 (52%), Gaps = 38/180 (21%)
 Frame = +1

Query  133  QDYFCYHCERTVTITP--LPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpf  306
            Q YFCY C RTV I+P   P+S+L+CP CNG FLEE E   P   + N   F     F  
Sbjct  6    QPYFCYQCNRTVRISPSPCPSSDLLCPTCNGGFLEELENPNPNQQTLNLNPFDSPFPFL-  64

Query  307  gfgggggvggggeglvfSTASSGGGIALDDLSALFGGM----AAGRSPNQ---FHPLLFL  465
                               +S       DDLSA FGGM    +A   PN    F+P LFL
Sbjct  65   -------------------SSPNSPHPFDDLSAFFGGMVPPPSATARPNDTEVFNPFLFL  105

Query  466  QNYLQTMRASGANIQLVFXNSgggggvpgnl---------gDYFVGPGLEQLIQQLMEND  618
            QNYLQT+RA+GANIQ V  N+  GG  P            GDYF+GPGLEQLIQQL END
Sbjct  106  QNYLQTLRANGANIQFVIENNSPGGSGPSGAFRLPGSLNLGDYFLGPGLEQLIQQLAEND  165



>ref|XP_006441411.1| hypothetical protein CICLE_v10020902mg [Citrus clementina]
 gb|ESR54651.1| hypothetical protein CICLE_v10020902mg [Citrus clementina]
Length=350

 Score =   109 bits (273),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 88/173 (51%), Gaps = 46/173 (27%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            YFC+ C RTV +TP P+S+LVCP+CNG F+EE ET  P+                     
Sbjct  24   YFCHQCNRTVRVTPSPSSDLVCPSCNGGFIEELETPNPSVN-------------------  64

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS---PNQFHPLLFLQNYLQTMR  489
                            +      LDDLS L G M   RS   P++F+P +FLQNYLQ +R
Sbjct  65   -------------PNPNPMDAFLLDDLSTLLG-MGPTRSFTDPSEFNPFVFLQNYLQNLR  110

Query  490  ASGANIQLVFXNSgggggvpgnlg----------DYFVGPGLEQLIQQLMEND  618
            A+GA+IQ V  N+       G  G          DYF+GPGLEQLIQQL END
Sbjct  111  ANGASIQFVVENNSNVDPAAGGAGAAFRLPANLGDYFIGPGLEQLIQQLAEND  163



>gb|KDO48740.1| hypothetical protein CISIN_1g0186891mg [Citrus sinensis]
Length=352

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 88/173 (51%), Gaps = 46/173 (27%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            YFC+ C RTV +TP P+S+LVCP+CNG F+EE ET  P+                     
Sbjct  24   YFCHQCNRTVRVTPSPSSDLVCPSCNGGFIEELETPNPSVN-------------------  64

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS---PNQFHPLLFLQNYLQTMR  489
                            +      LDDLS L G M   RS   P++F+P +FLQNYLQ +R
Sbjct  65   -------------PNPNPMDAFLLDDLSTLLG-MGPTRSFTDPSEFNPFVFLQNYLQNLR  110

Query  490  ASGANIQLVFXNSgggggvpgnlg----------DYFVGPGLEQLIQQLMEND  618
            A+GA+IQ V  N+       G  G          DYF+GPGLEQLIQQL END
Sbjct  111  ANGASIQFVVENNSNVDPAAGGAGAAFRLPANLGDYFIGPGLEQLIQQLAEND  163



>ref|XP_006493415.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Citrus sinensis]
Length=352

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 88/173 (51%), Gaps = 46/173 (27%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            YFC+ C RTV +TP P+S+L+CP+CNG F+EE ET  P+                     
Sbjct  24   YFCHQCNRTVRVTPSPSSDLLCPSCNGGFIEELETPNPSVN-------------------  64

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS---PNQFHPLLFLQNYLQTMR  489
                            +      LDDLS L G M   RS   P++F+P +FLQNYLQ +R
Sbjct  65   -------------PNPNPMDAFLLDDLSTLLG-MGPTRSFTDPSEFNPFVFLQNYLQNLR  110

Query  490  ASGANIQLVFXNSgggggvpgnlg----------DYFVGPGLEQLIQQLMEND  618
            A+GA+IQ V  N+       G  G          DYF+GPGLEQLIQQL END
Sbjct  111  ANGASIQFVVENNSNVDPAAGGAGAAFRLPANLGDYFIGPGLEQLIQQLAEND  163



>ref|XP_008393509.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
 ref|XP_008393510.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
Length=388

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 97/184 (53%), Gaps = 26/184 (14%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFC+ C+RTV++TP P  +LVCP C+G FLEE ET  P         F    +    
Sbjct  17   PQLYFCHRCDRTVSLTPSPTYDLVCPLCSGGFLEEMETPNPNPNPFPPNPFFSFPSSDAP  76

Query  310  fgggggvggggeglvfSTASSGGGIAL--------DDLSALFGGMAAGRSPNQ----FHP  453
                 G          S+++SG             DDLS+LFGG  +  SP Q    F+P
Sbjct  77   PFASSGFPLLF-----SSSASGPAPDSAPAPANLADDLSSLFGGAPSRSSPFQDPDAFNP  131

Query  454  LLFLQNYLQTMRASGANIQLVFXNSgggggvpgnlg---------DYFVGPGLEQLIQQL  606
             +FLQNYLQT+RA+GAN+Q V   S GGGG               DYF GPG+EQLIQQL
Sbjct  132  FVFLQNYLQTLRANGANVQFVIDGSPGGGGGDPFGFRVPTNLNLGDYFFGPGIEQLIQQL  191

Query  607  MEND  618
             END
Sbjct  192  AEND  195



>ref|XP_006374275.1| hypothetical protein POPTR_0015s05600g [Populus trichocarpa]
 gb|ABK95038.1| unknown [Populus trichocarpa]
 gb|ERP52072.1| hypothetical protein POPTR_0015s05600g [Populus trichocarpa]
Length=345

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 91/189 (48%), Gaps = 59/189 (31%)
 Frame = +1

Query  133  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgf  312
            Q YFCY C RTVTITP P + L CPNC+  FLEE ++  P+                   
Sbjct  10   QLYFCYQCNRTVTITP-PTTALSCPNCHEGFLEELDSPNPSPNPF---------------  53

Query  313  gggggvggggeglvfSTASSGGGIALDDLSALFGGMAAG--------------------R  432
                             A  G  + LDD +++FGGM                       +
Sbjct  54   ----------------DAGLGPALLLDDFASIFGGMNPTPRSSTTSTTATNSSSASPLFQ  97

Query  433  SPNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnl-------gDYFVGPGLEQ  591
             P+ F+P +FLQNYLQTMRA GANIQ V  N+ G GG+           GDYF+GPGLEQ
Sbjct  98   DPDGFNPFVFLQNYLQTMRAGGANIQFVIENNPGMGGMDPTGFRVPANLGDYFIGPGLEQ  157

Query  592  LIQQLMEND  618
            LIQQL END
Sbjct  158  LIQQLAEND  166



>ref|XP_011047757.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=345

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 92/189 (49%), Gaps = 59/189 (31%)
 Frame = +1

Query  133  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgf  312
            Q YFCY C RTVTITP P + L CPNC+  FLEE ++  P+                   
Sbjct  10   QLYFCYKCNRTVTITP-PATALSCPNCHEGFLEELDSPNPSPNPL---------------  53

Query  313  gggggvggggeglvfSTASSGGGIALDDLSALFGGMAAG--------------------R  432
                                G  + LDD +++FGGM                       +
Sbjct  54   ----------------DGGLGPALLLDDFASIFGGMNPTPRSSTTSTTTTNSSSASPLFQ  97

Query  433  SPNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggg-------gvpgnlgDYFVGPGLEQ  591
             P+ F+P +FLQNYLQTMRA GANIQ V  N+ G G        VP NLGDYF+GPGLEQ
Sbjct  98   DPDGFNPFVFLQNYLQTMRAGGANIQFVIENNPGMGGMDPTGFRVPANLGDYFIGPGLEQ  157

Query  592  LIQQLMEND  618
            LIQQL END
Sbjct  158  LIQQLAEND  166



>ref|XP_003534093.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoformX2 [Glycine 
max]
 ref|XP_006587425.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X3 
[Glycine max]
 ref|XP_006587426.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X4 
[Glycine max]
Length=376

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 85/167 (51%), Gaps = 17/167 (10%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            P+ YFC+ C RTV+I+P P+S+L+CP CNG FLEE E   P     N  F          
Sbjct  17   PRQYFCHQCNRTVSISPSPSSDLLCPTCNGGFLEELEIPIPDPNPPNPFFSDFPLGGAAT  76

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMR  489
                                +       DLSALFG  +   + + F+PL+FLQNY QT+R
Sbjct  77   IPLVL-------------PGAATSPPFGDLSALFGDRSDAAASDAFNPLVFLQNYFQTLR  123

Query  490  A-SGANIQLVFXNSggggg---vpgnlgDYFVGPGLEQLIQQLMEND  618
            A  G N+QLV  +   GG         GDYF GPGLE+LIQ L END
Sbjct  124  AGGGGNLQLVIESGDPGGVFRFPGVTHGDYFFGPGLEELIQHLAEND  170



>ref|XP_004299466.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Fragaria vesca 
subsp. vesca]
Length=379

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 94/176 (53%), Gaps = 25/176 (14%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            YFC+ C+RTVT+ P P S+L CP C+G FLEE E++ P    N      G      GF  
Sbjct  20   YFCHQCDRTVTLNPSPTSDLACPVCSGGFLEEMESSNPNPIPNPFFPSDGPPFPSAGFPT  79

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS---------PNQFHPLLFLQN  471
                          TA++G     +DLSA+ GG A  RS         P+ F P  FL++
Sbjct  80   FLFGA--------PTAAAGPRNLAEDLSAILGG-AGSRSTSRASPFHDPDAFDPFRFLES  130

Query  472  YLQTMRASGANIQLVFXNSgggggvpgnl-------gDYFVGPGLEQLIQQLMEND  618
            YLQ +RA GAN+Q V  ++GG GG   +        GDYF GPGLEQLIQQL END
Sbjct  131  YLQGLRADGANVQFVIDHTGGDGGRDFSGFPTNVNLGDYFFGPGLEQLIQQLAEND  186



>ref|XP_003549174.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=369

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 85/166 (51%), Gaps = 16/166 (10%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            P+ YFC+ C RTV+I+P P+S+L+CP CNG FLEE E   P    N    F         
Sbjct  17   PRQYFCHQCNRTVSISPSPSSDLLCPTCNGGFLEELEFPIPNPNPNPPNPFFPDFPLAGA  76

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMR  489
                                +      +DLSALFG      + + F+PL+FLQNY QT+R
Sbjct  77   ATIPLV-----------LPGAAASPPFEDLSALFGNRPDAAA-DAFNPLVFLQNYFQTLR  124

Query  490  ASGANIQLVFXNSggggg---vpgnlgDYFVGPGLEQLIQQLMEND  618
            A G N+QLV  +   GG         GDYF GPGLE+LIQ L END
Sbjct  125  A-GGNLQLVIESGDPGGAFRFPGVTHGDYFFGPGLEELIQHLAEND  169



>ref|XP_008467256.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
 ref|XP_008467264.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
Length=377

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 101/174 (58%), Gaps = 16/174 (9%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadaf---  300
            PQ YFCY C RTVTITP  +S+L+CPNCN +F+EE E+  P      NPF          
Sbjct  21   PQLYFCYTCNRTVTITPSSSSDLLCPNCNDSFVEEMESPNPNPSPVPNPFLSFTSEAFPP  80

Query  301  -pfgfgggggvggggeglvfSTASSGGGIALDDLSALFGG----MAAGRSPNQFHPLLFL  465
               G GG GG          S    GGG  ++DLSAL GG     ++ ++P+ F+PLLFL
Sbjct  81   FSTGGGGNGGFPIIFSTTSSSGGIGGGGSMMNDLSALLGGGSLRSSSLQNPDGFNPLLFL  140

Query  466  QNYLQTMRASGANIQLVFXNSgggg---gvpgnlgDYFVGPGLEQLIQQLMEND  618
            QNYLQ+     AN+QLV  N+ G         NLGDYF GPGLEQLIQQL END
Sbjct  141  QNYLQS-----ANVQLVIQNASGEAFHPPSNFNLGDYFFGPGLEQLIQQLAEND  189



>gb|EYU22293.1| hypothetical protein MIMGU_mgv1a006235mg [Erythranthe guttata]
Length=451

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 99/180 (55%), Gaps = 24/180 (13%)
 Frame = +1

Query  139  YFCYHCERTVTITPL--PNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgf  312
            YFCY C+R V+I P   P +E+VCPNC G FLEE+++ PP+   N       +D+FP   
Sbjct  89   YFCYQCDRHVSIVPPTSPTAEIVCPNCQGGFLEESDSPPPSIADNPIHNPFFSDSFPSAA  148

Query  313  ----------gggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLF  462
                        G G    G     S+   GGG   DDLSAL G     RSPN+F+P  F
Sbjct  149  PFGGFPIILSSAGAGAAHAGSAFTMSSGGGGGGGGFDDLSALLGS----RSPNEFNPFSF  204

Query  463  LQNYLQTMRASGANIQLVFXNSgggggvpgnlg--------DYFVGPGLEQLIQQLMEND  618
            L NY+  +++ GANIQLVF + GGGG               DYF+GPGLEQLIQQL END
Sbjct  205  LNNYINNLQSRGANIQLVFESPGGGGLGGMGADFRIPSNLGDYFIGPGLEQLIQQLAEND  264



>ref|XP_010687250.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 96/177 (54%), Gaps = 21/177 (12%)
 Frame = +1

Query  133  QDYFCYHCERTVTITPLPNS-ELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            Q YFCY C RTV+I+   +S EL CPNCNG FLEE E   P  P  +  F     +    
Sbjct  22   QFYFCYECNRTVSISNPSSSSELFCPNCNGGFLEEVENPNPFPPPFSPFFSSSPSSSAAD  81

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGG---------MAAGRSPNQFHPLLF  462
                              +SS   I   DLS++FGG          +A + P+ F+PL F
Sbjct  82   QLAPFAPFMF------PPSSSPPPINPIDLSSIFGGGIANVGGNSRSAFQDPDVFNPLQF  135

Query  463  LQNYLQTMRASGANIQLVFXNSgggg-----gvpgnlgDYFVGPGLEQLIQQLMEND  618
            LQNYLQTMRA GANIQ V  N+GG        VP NLGDYF GPGLEQLIQQL END
Sbjct  136  LQNYLQTMRAGGANIQFVIENAGGDHGGGNFRVPSNLGDYFFGPGLEQLIQQLAEND  192



>ref|XP_006495422.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like, partial [Citrus 
sinensis]
Length=125

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 67/133 (50%), Gaps = 36/133 (27%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            YFC+ C RTV +TP P+S+L+CP+CNG F+EE ET                         
Sbjct  24   YFCHQCNRTVRVTPSPSSDLLCPSCNGGFIEELETP------------------------  59

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS---PNQFHPLLFLQNYLQTMR  489
                       V    +      LDDLS L  GM   RS   P++F+P +FLQNYLQ +R
Sbjct  60   --------NPSVNPNPNPMDAFLLDDLSTLL-GMGPTRSFTDPSEFNPFVFLQNYLQNLR  110

Query  490  ASGANIQLVFXNS  528
            A+GA+IQ V  N+
Sbjct  111  ANGASIQFVVENN  123



>ref|XP_007152550.1| hypothetical protein PHAVU_004G139600g [Phaseolus vulgaris]
 gb|ESW24544.1| hypothetical protein PHAVU_004G139600g [Phaseolus vulgaris]
Length=359

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 82/169 (49%), Gaps = 20/169 (12%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            P+ YFC+ C RTV++TP P+S+L+CP+CN  FLEE E   P    +N  F     A    
Sbjct  13   PRQYFCHQCNRTVSVTPSPSSDLICPDCNSGFLEELEIPNPNPTPSNPFFPDFPLAGATA  72

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMA-AGRSPNQFHPLLFLQNYLQTM  486
                                 G G   DD S L G  + A  +     P + LQNYLQT+
Sbjct  73   IPF--------------VFPGGAGQPFDDFSTLSGIRSDAATADTALAPFVLLQNYLQTL  118

Query  487  RA--SGANIQLVFXNSggggg---vpgnlgDYFVGPGLEQLIQQLMEND  618
            RA   G N+QLV  +   GG         GDYF G GLE+LIQ L END
Sbjct  119  RAGGGGGNLQLVIESGDPGGAFRFPGITHGDYFFGTGLEELIQHLAEND  167



>ref|XP_004515274.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Cicer arietinum]
 ref|XP_004515275.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Cicer arietinum]
 ref|XP_004515276.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X3 
[Cicer arietinum]
Length=349

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 83/170 (49%), Gaps = 21/170 (12%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            YFC+ CERT  I+   +++L+CPNCNG FLEE ET  P    N NP              
Sbjct  20   YFCHQCERTAFIS-TSSTDLICPNCNGTFLEELETPIPNPNPNPNPNPIPPFFSYTTDFP  78

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGR--SP--NQFHPLLFLQNYLQTM  486
                              G    L+DLS LFG  ++    SP    F+P+ F+QNYLQ +
Sbjct  79   AANFSFPI----------GNSQPLEDLSVLFGNRSSPSPASPFGQAFNPVAFIQNYLQNI  128

Query  487  R-ASGANIQLVFXNSgggggv-----pgnlgDYFVGPGLEQLIQQLMEND  618
            R  +G N+Q    ++    G        N GDYF GPGLE LIQQL END
Sbjct  129  RPGAGGNVQFFIDDADDPTGPFRFPGNANPGDYFFGPGLEDLIQQLAEND  178



>gb|KJB31865.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
 gb|KJB31866.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
 gb|KJB31867.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
 gb|KJB31868.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
 gb|KJB31869.1| hypothetical protein B456_005G211800 [Gossypium raimondii]
Length=332

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 88/163 (54%), Gaps = 7/163 (4%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FCY C RTVT+T  P S+  CP C+G FLEE E   P   SN     P + +       
Sbjct  23   FFCYQCNRTVTVTIAP-SDPSCPICHGGFLEEYENPIPNQASNFRNPNPFSHSSSSLSDP  81

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS-PNQFHPLLFLQNYLQTMRAS  495
               +      +  +++SS   + L+  + LF      R+ P  F P  F+QN+L  +R+S
Sbjct  82   FSSILPLLTAM--NSSSSPAYVDLES-TGLFESTVTTRADPFAFDPFTFIQNHLSDLRSS  138

Query  496  GANIQLVFXNSgggg--gvpgnlgDYFVGPGLEQLIQQLMEND  618
            GA I+ V  NS       +P NLGDYF+GPGLEQLIQQL END
Sbjct  139  GAQIEFVIQNSPSESGFRLPANLGDYFIGPGLEQLIQQLAEND  181



>ref|XP_010541863.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541864.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541865.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541866.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541867.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541868.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541869.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541870.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010541871.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Tarenaya hassleriana]
Length=326

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 86/166 (52%), Gaps = 14/166 (8%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FCY C RTVT++   +++  CP CN  FLEE E   P    N NP      + P     
Sbjct  17   FFCYQCNRTVTVSISSSTDPFCPLCNDGFLEEYEDPNPNPSPNLNPSGVFPFSDPLSSLL  76

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS----PNQFHPLLFLQNYLQTM  486
                          +AS    +      ++FG    GRS    P  F P+ FLQN+LQ++
Sbjct  77   PILFA--------PSASPSSNVIDFFNPSIFGQPMPGRSTQPDPIAFDPVTFLQNHLQSL  128

Query  487  RASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            R+SG ++Q V  N  S     +PGNLGDYF GPGLEQLIQQL END
Sbjct  129  RSSGTHVQFVIENHPSDPEFRLPGNLGDYFFGPGLEQLIQQLAEND  174



>ref|XP_010487953.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=332

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 90/168 (54%), Gaps = 15/168 (9%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FCY C RTVTI+   +++  CP CN  FLEE E   P  P N NP   G+         
Sbjct  21   FFCYQCNRTVTISITASADPFCPICNQGFLEEFEDRSPNPPPNFNPNTDGSFFPMADPFS  80

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGG---MAAGRSPNQ---FHPLLFLQNYLQ  480
                   G     STAS  G   +D +S+ F G       RS  Q   F P+ FLQN+LQ
Sbjct  81   TLLPLLFGS----STASPSG---MDFMSSSFFGPSMQPQARSTQQSDAFDPVSFLQNHLQ  133

Query  481  TMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
             +R+SG ++Q V  N  S     +PGNLGDYF GPGLEQLIQQL END
Sbjct  134  HLRSSGTHVQFVVENHPSDPAHRIPGNLGDYFFGPGLEQLIQQLAEND  181



>gb|KJB79836.1| hypothetical protein B456_013G068800 [Gossypium raimondii]
Length=339

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 90/166 (54%), Gaps = 5/166 (3%)
 Frame = +1

Query  133  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET-Apptnpsnnnpffpgadafpfg  309
            + +FCY C RTVT+T  P+++  CP CN  FLEE E  +      N+NP      +    
Sbjct  22   KPFFCYQCNRTVTVTIYPSADPSCPLCNEGFLEEYENPSFENPNPNSNPLSEPFLSVSDP  81

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGR-SPNQFHPLLFLQNYLQTM  486
            F     +         S++ S   I L + ++ FG   +GR  P  F P  F+QN+L  +
Sbjct  82   FSSLLPLLFPSSSSTTSSSPSPASIDLHNPNS-FGSTRSGRGDPFAFDPFTFIQNHLNDL  140

Query  487  RASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            R+ GA I+ V  N  S  G  +P N+GDYF+GPGLEQLIQQL END
Sbjct  141  RSRGAQIEFVIQNNPSEPGFRLPANIGDYFIGPGLEQLIQQLAEND  186



>ref|XP_010533212.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Tarenaya hassleriana]
Length=322

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 90/167 (54%), Gaps = 16/167 (10%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FC+ C RTVT++   +++ +CP CN  FLEE E   P    N NP      + P     
Sbjct  18   FFCHQCNRTVTVSISSSADPLCPLCNEGFLEEYENPHPAPSPNLNPGGFPPFSDPLSPLL  77

Query  319  gggvggggeglvfSTASSGGGIALDDLS-ALFGGMAAGRS----PNQFHPLLFLQNYLQT  483
                         + ++S    A+D  + + FG    GRS    P+ F P+ FLQN+LQ 
Sbjct  78   QILF---------APSASPSSNAIDFFNPSFFGRPMQGRSLQPEPSAFDPVTFLQNHLQD  128

Query  484  MRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            +R+SG ++Q V  N  S  G  + GNLGDYF GPGLEQLIQQL END
Sbjct  129  LRSSGTHVQFVIENHPSDPGFRLGGNLGDYFFGPGLEQLIQQLAEND  175



>ref|XP_002883213.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59472.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=330

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 85/169 (50%), Gaps = 14/169 (8%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FCY C RTVTI+   +++  CP CN  FLEE E   P    N NP    +         
Sbjct  21   FFCYQCNRTVTISISSSADPFCPICNQGFLEEYEDPNPNPSLNFNPNSVDSLFPMADPFS  80

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAA-GRSPNQ------FHPLLFLQNYL  477
                   G     S+A+S  GI L   S     M    RS  Q      F P  FLQN+L
Sbjct  81   TLLPLLFG-----SSAASPSGIDLMSSSFFAPSMQPQARSTQQNPQSDAFDPFTFLQNHL  135

Query  478  QTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            Q +R+SG ++Q V  N  S  G  +PGN GDYF GPGLEQLIQQL END
Sbjct  136  QNLRSSGTHVQFVIENHPSDLGNRMPGNFGDYFFGPGLEQLIQQLAEND  184



>gb|KHG01857.1| E3 ubiquitin-protein ligase RING1 [Gossypium arboreum]
Length=331

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 85/165 (52%), Gaps = 11/165 (7%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FCY C RTVT+T + +S+  CP C G FLEE E   P   SN     P + +       
Sbjct  22   FFCYQCNRTVTVT-IASSDPSCPICQGGFLEEYENPIPNQASNFRNPNPVSHSSSSLSDP  80

Query  319  gggvggggeglvfSTASSGGGIALDDL--SALFGGMAAGRS-PNQFHPLLFLQNYLQTMR  489
               +      +  S +      A  DL  + LF      R+ P  F P  F++N+L  +R
Sbjct  81   FSSILPLLTAMNSSPSP-----AYVDLESTGLFESTVTTRADPFAFDPFTFIRNHLSDLR  135

Query  490  ASGANIQLVFXNSgggg--gvpgnlgDYFVGPGLEQLIQQLMEND  618
            +SGA I+ V  NS       +P NLGDYF+GPGLEQLIQQL END
Sbjct  136  SSGAQIEFVIQNSPSESGFRLPANLGDYFIGPGLEQLIQQLAEND  180



>ref|XP_006297993.1| hypothetical protein CARUB_v10014036mg, partial [Capsella rubella]
 gb|EOA30891.1| hypothetical protein CARUB_v10014036mg, partial [Capsella rubella]
Length=361

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 89/171 (52%), Gaps = 18/171 (11%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FCY C RTVTI+   +++  CP CN  FLEE E   P  P N N     +         
Sbjct  47   FFCYQCNRTVTISISSSADPFCPICNQGFLEEYEDRSPNLPPNFNLNSDDSFFPMADPFS  106

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGG---MAAGRSPNQ------FHPLLFLQN  471
                   G     S+A+S  G  +D +S+ F G       RS  Q      F P+ FLQN
Sbjct  107  TLLPLLFG-----SSAASPSG--MDFMSSSFFGPSMQPQARSTQQIPQSDAFDPVSFLQN  159

Query  472  YLQTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            +LQ +R+SG ++Q V  N  S     +PGNLGDYF GPGLEQLIQQL END
Sbjct  160  HLQHLRSSGTHVQFVIENHPSDAAHRMPGNLGDYFFGPGLEQLIQQLAEND  210



>ref|XP_010508254.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=333

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 87/174 (50%), Gaps = 19/174 (11%)
 Frame = +1

Query  133  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgf  312
            +++FCY C RTVTI+   +++  CP CN  FLEE E        N  P F       F  
Sbjct  19   KNFFCYQCNRTVTISITASADPFCPICNQGFLEEFED----RSPNPPPNFNPNTDGSFFP  74

Query  313  gggggvggggeglvfSTASSGGGIALDDLSALFGG---MAAGRSPNQ-------FHPLLF  462
                           S AS  G   +D +S+ F G       RS  Q       F P+ F
Sbjct  75   MADPFSTLLPLLFGTSAASPSG---MDFMSSSFFGPSMQPQARSTQQNPLQSDAFDPVSF  131

Query  463  LQNYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            LQN+LQ +R+SG ++Q V  N  S     +PGNLGDYF GPGLEQLIQQL END
Sbjct  132  LQNHLQHLRSSGTHVQFVVENHPSDPAHRIPGNLGDYFFGPGLEQLIQQLAEND  185



>ref|XP_009401096.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Musa acuminata 
subsp. malaccensis]
Length=367

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 81/174 (47%), Gaps = 17/174 (10%)
 Frame = +1

Query  133  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgf  312
            Q Y+C+ C+RTV + P   +E+ CP C+G FLEE E   P    N    F  +    F  
Sbjct  14   QHYYCHQCDRTVALVPN-AAEISCPICHGGFLEEVEPPNPNPNPNPFFPFAPSSDAFFLS  72

Query  313  gggggvggggeglvfSTAS-------SGGGIALDDLSALFGGMAA-----GRSPNQFHPL  456
                           +  S          G+   DL     G  A     G +P  F+P+
Sbjct  73   PSLPFFLSSSSSSSPAATSFDLRNPGDLAGLLGPDLVVTRSGPVAPSAAHGAAP--FNPM  130

Query  457  LFLQNYLQTMRASGANIQLVFXNSgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            +FLQ+Y Q + + GANIQ+V      GG       DYF+GPGLEQLIQQL END
Sbjct  131  VFLQDYFQQLLSGGANIQVVIEGGPSGGIGNLG--DYFIGPGLEQLIQQLAEND  182



>ref|NP_188629.1| E3 ubiquitin-protein ligase RING1-like protein [Arabidopsis thaliana]
 sp|Q8LPN7.1|RNG1L_ARATH RecName: Full=E3 ubiquitin-protein ligase RING1-like; AltName: 
Full=RING finger protein 1 [Arabidopsis thaliana]
 gb|AAM19951.1| AT3g19950/MPN9_19 [Arabidopsis thaliana]
 gb|AAN18152.1| At3g19950/MPN9_19 [Arabidopsis thaliana]
 gb|AEE76311.1| E3 ubiquitin-protein ligase RING1-like protein [Arabidopsis thaliana]
Length=328

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 87/170 (51%), Gaps = 18/170 (11%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FCY C +TVTI+   +++  CP CN  FLEE E   P    N NP    +         
Sbjct  21   FFCYQCNQTVTISISSSADPFCPICNQGFLEEYEDPNPNQSLNFNPNSSDSFFPMADPFS  80

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGG--MAAGRSPNQ------FHPLLFLQNY  474
                   G     S+A++  G+   D  +LFG       RS  Q      F P  FLQN+
Sbjct  81   TLLPLIFG-----SSAAAPSGM---DFMSLFGPSMQPQARSTQQNPQSDAFDPFTFLQNH  132

Query  475  LQTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            LQT+R+SG + + V  N  S  G  +PGN GDYF GPGLEQLIQQL END
Sbjct  133  LQTLRSSGTHFEFVIENHPSDPGNRMPGNFGDYFFGPGLEQLIQQLAEND  182



>ref|XP_010466163.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Camelina sativa]
Length=336

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 85/172 (49%), Gaps = 19/172 (11%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FCY C RTVTI+   +++  CP CN  FLEE E        N  P F       F    
Sbjct  21   FFCYQCNRTVTISISASADPFCPICNQGFLEEFED----RSPNPPPNFNPNTDGSFYPMA  76

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGG---MAAGRSPNQ-------FHPLLFLQ  468
                         S AS  G   +D +S+ F G       RS  Q       F P+ FLQ
Sbjct  77   DPFSTLLPLLFGTSAASPSG---MDFMSSSFFGPSMQPQARSTQQNPMQSDAFDPVSFLQ  133

Query  469  NYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            N+LQ +R+SG ++Q V  N  S     +PGNLGDYF GPGLEQLIQQL END
Sbjct  134  NHLQHLRSSGTHVQFVVENHPSDPAHRIPGNLGDYFFGPGLEQLIQQLAEND  185



>dbj|BAB01310.1| unnamed protein product [Arabidopsis thaliana]
Length=386

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 87/170 (51%), Gaps = 18/170 (11%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FCY C +TVTI+   +++  CP CN  FLEE E   P    N NP    +         
Sbjct  79   FFCYQCNQTVTISISSSADPFCPICNQGFLEEYEDPNPNQSLNFNPNSSDSFFPMADPFS  138

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGG--MAAGRSPNQ------FHPLLFLQNY  474
                   G     S+A++  G+   D  +LFG       RS  Q      F P  FLQN+
Sbjct  139  TLLPLIFG-----SSAAAPSGM---DFMSLFGPSMQPQARSTQQNPQSDAFDPFTFLQNH  190

Query  475  LQTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            LQT+R+SG + + V  N  S  G  +PGN GDYF GPGLEQLIQQL END
Sbjct  191  LQTLRSSGTHFEFVIENHPSDPGNRMPGNFGDYFFGPGLEQLIQQLAEND  240



>ref|XP_010069512.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Eucalyptus 
grandis]
 gb|KCW57890.1| hypothetical protein EUGRSUZ_H00641 [Eucalyptus grandis]
Length=394

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 57/91 (63%), Gaps = 14/91 (15%)
 Frame = +1

Query  388  LDDLSALFGGMAA-------GRSPNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggv  546
            +DD SALFGG +A         +P+ F+PLLFL NY QT+RA GANIQ V  N+ GG   
Sbjct  116  MDDFSALFGGASAFGEGGGNSNNPDAFNPLLFLNNYFQTLRAGGANIQFVIDNNTGGDSG  175

Query  547  pg-------nlgDYFVGPGLEQLIQQLMEND  618
                     NLGDYF+G  LEQLIQQL END
Sbjct  176  GSFRFPGNINLGDYFIGSNLEQLIQQLAEND  206


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  243
            PQ Y+C+ C  TV+I   P ++LVCP+CNG FLEE+E+
Sbjct  18   PQLYYCHQCRSTVSINRSPTADLVCPDCNGEFLEESES  55



>gb|EYU29041.1| hypothetical protein MIMGU_mgv1a026532mg, partial [Erythranthe 
guttata]
Length=189

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 74/165 (45%), Gaps = 23/165 (14%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFC+ CERT TI P P  E++CP+CN  F+EE +    +        F    +    
Sbjct  14   PQMYFCHQCERTATIAPSPGGEILCPSCNSGFVEEFQNP--SPDPRIPDPFYLLLSQFLP  71

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMR  489
                            +  S+ G  A D +S                   +  N+L   R
Sbjct  72   PASANLNPNPTRRTAPTGVSAHGADAFDPMS-------------------YFMNFLANSR  112

Query  490  ASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            ASG + Q V  +  S  G  +P N+GDYFVGPG EQLIQQL +ND
Sbjct  113  ASGIDYQFVIEDNPSDSGFALPANIGDYFVGPGYEQLIQQLADND  157



>gb|KDP37541.1| hypothetical protein JCGZ_05980 [Jatropha curcas]
Length=311

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 78/163 (48%), Gaps = 11/163 (7%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FCY C RTVT+    +S+  CP C+  FLEE E   P   S N       D+       
Sbjct  17   FFCYQCNRTVTVPVSASSDPSCPICHDGFLEEYENPNPHLNSQNPNPNNFNDSIFSFPDP  76

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMRASG  498
               +             S   I   + + L     A   P  F+P+ FL+N++Q +++ G
Sbjct  77   ISTLLPLLF--------SSTTIDFQNPNLLGNTRTASSDPEAFNPMDFLRNHIQNLQSGG  128

Query  499  ANIQLVFXNSgggg---gvpgnlgDYFVGPGLEQLIQQLMEND  618
            A IQ V  N         +P N+GDYF+GPGLEQLIQQL END
Sbjct  129  ARIQFVIENHPSDQGGFRLPANIGDYFIGPGLEQLIQQLAEND  171



>ref|XP_004236843.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=309

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 84/169 (50%), Gaps = 15/169 (9%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            YFC+ C  TVTITP P+ +L CP CN +F+EE E   P      N   PG  +       
Sbjct  16   YFCHKCSNTVTITPSPSGDLFCPTCNSDFVEEYEEPDPEPEMFPNFPNPGLLSSLLMGAR  75

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQ-------FHPLLFLQNYL  477
                   G     + A+   G  +   +A F    + R+P Q       F+P  FLQ +L
Sbjct  76   PRSAPTTGSHQHSAPAT---GSRVSPYTAFFN---SNRNPRQMSSGSDDFNPFEFLQTHL  129

Query  478  QTMRASGANIQLVFX--NSgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
              +RA+GA+ + V    N G G  +P N GDYF+GPG EQLIQ L END
Sbjct  130  AALRANGASFEFVIEGGNGGSGLQMPANYGDYFIGPGFEQLIQNLAEND  178



>ref|XP_011070454.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
 ref|XP_011070455.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
 ref|XP_011070456.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
Length=330

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 76/165 (46%), Gaps = 22/165 (13%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFC+ CERTVTITP P  +++CP+CN  F+EE +     +P    PFFP   +    
Sbjct  30   PQMYFCHQCERTVTITPSPGGDILCPSCNSGFVEEFQNP-NPSPGIPEPFFPDPLSLFLS  88

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMR  489
                            S  S  G  A D +S L                    N L   R
Sbjct  89   QFLHSTNPNPSSRSGQSGESQFGADAFDPVSYLL-------------------NLLANRR  129

Query  490  ASGANIQLVFXNS--gggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            ASG + Q V  +        +P N+GDYFVGPG EQLIQQL END
Sbjct  130  ASGIDYQFVVEDHPLASAFSLPANIGDYFVGPGFEQLIQQLAEND  174



>emb|CDP18533.1| unnamed protein product [Coffea canephora]
Length=319

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 78/179 (44%), Gaps = 40/179 (22%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFC+ C RTVTI P P S+L+CP C+  F+EE E      P+      P        
Sbjct  13   PQLYFCHQCNRTVTIIPSPTSDLICPTCHSGFVEEFENPNNAYPNPAYSPDPFF------  66

Query  310  fgggggvggggeglvfSTASSGGGIALDDL--------SALF-GGMAAGR----SPNQFH  450
                              +S   G  L DL          LF G   +GR        F 
Sbjct  67   ------------------SSDPVGSFLQDLFVGPQRNPGGLFTGSRVSGRRSQYGAEDFD  108

Query  451  PLLFLQNYLQTMRASGANIQLVFXNSgggggv---pgnlgDYFVGPGLEQLIQQLMEND  618
            P  ++ N++   R +G     +F +   G      PG++GDYF+GPG EQLIQQL END
Sbjct  109  PFAYIVNHVLARRNAGEQFHFMFGDDHAGIEGFQFPGSIGDYFLGPGFEQLIQQLAEND  167



>gb|ABK96352.1| unknown [Populus trichocarpa x Populus deltoides]
Length=296

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 76/180 (42%), Gaps = 49/180 (27%)
 Frame = +1

Query  133  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgf  312
            + YFCY C RTV+ITP    +  CP C+ +F+EE ET                       
Sbjct  21   KQYFCYQCNRTVSITPSSYDDPFCPICHDSFIEEFETQ----------------------  58

Query  313  gggggvggggeglvfSTASSGGGIALDDLSALF-------GGMAAGRSP--------NQF  447
                             + S      D  S+LF       G  +    P        N F
Sbjct  59   ---------NPQNPNPFSDSYFNDPFDPFSSLFPLLFQNSGNFSHPEFPTRPGFSDPNAF  109

Query  448  HPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnl---gDYFVGPGLEQLIQQLMEND  618
            +PL FL+++LQ + + G  +Q V  N+G   G+       GDYF+G GLEQLIQQL END
Sbjct  110  NPLEFLRSHLQNLHSGGGRVQFVIDNNGHEPGLRFPDGNFGDYFIGSGLEQLIQQLAEND  169



>ref|XP_002310643.2| hypothetical protein POPTR_0007s07510g [Populus trichocarpa]
 gb|EEE91093.2| hypothetical protein POPTR_0007s07510g [Populus trichocarpa]
Length=297

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 76/180 (42%), Gaps = 49/180 (27%)
 Frame = +1

Query  133  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgf  312
            + YFCY C RTV+ITP    +  CP C+ +F+EE ET                       
Sbjct  21   KQYFCYQCNRTVSITPSSYDDPFCPICHDSFIEEFETQ----------------------  58

Query  313  gggggvggggeglvfSTASSGGGIALDDLSALF-------GGMAAGRSP--------NQF  447
                             + S      D  S+LF       G  +    P        N F
Sbjct  59   ---------NPQNPNPFSDSYFNDPFDPFSSLFPLLFQNSGNFSHPEFPTRPGFSDPNAF  109

Query  448  HPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnl---gDYFVGPGLEQLIQQLMEND  618
            +PL FL+++LQ + + G  +Q V  N+G   G+       GDYF+G GLEQLIQQL END
Sbjct  110  NPLEFLRSHLQNLHSGGGRVQFVIDNNGHEPGLRFPDGNFGDYFIGSGLEQLIQQLAEND  169



>ref|XP_006359295.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum tuberosum]
Length=322

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 80/169 (47%), Gaps = 15/169 (9%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            YFC+ C  TVTITP    +L CP CN +F+EE E   P      N       +       
Sbjct  16   YFCHKCSNTVTITPSATGDLFCPTCNSDFIEEYEEPDPEPEMFPNFPNSVLLSSLLMGSR  75

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQ-------FHPLLFLQNYL  477
                   G     +  +   G  +   +A+F    + R+P Q       F+P  FLQ +L
Sbjct  76   SRSDPTTGSPPHSAPTT---GSRVSPYTAIFN---SNRNPRQTSSGSDDFNPFEFLQTHL  129

Query  478  QTMRASGANIQLVFX--NSgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
              +RA+GA+ + V    N G G  +P N GDYF+GPG EQLIQ L END
Sbjct  130  AGLRANGASFEFVIEGGNGGSGFQLPANFGDYFIGPGFEQLIQNLAEND  178



>ref|XP_010557559.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Tarenaya hassleriana]
Length=333

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 79/170 (46%), Gaps = 17/170 (10%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FC+ C RTVTI    +++  CP CN  FLEE E   P      NP        P     
Sbjct  18   FFCHQCNRTVTIPISSSADPFCPLCNEGFLEEYENPNPNPSPVLNPSGFLPFPDPISSLL  77

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQ---FHPLLFLQNYLQTMR  489
                         S   S   I L + S L   M    SP     F P  FLQ++LQ +R
Sbjct  78   PILFAP-------SALPSSNVIDLFNPSFLGHPMQGRSSPPDSIAFDPAAFLQDHLQNLR  130

Query  490  ASGANIQLVFXN-------SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            + G +IQ +  N       SG    +PGNLGDYF GPGLEQLIQQL END
Sbjct  131  SRGTHIQFMVENHPSGPGFSGTTSLLPGNLGDYFFGPGLEQLIQQLAEND  180



>emb|CDY25360.1| BnaA05g19240D [Brassica napus]
Length=323

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 77/164 (47%), Gaps = 14/164 (9%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FCY C  TV I+    ++  CP C+G FLEE +   PT P N NP           F  
Sbjct  19   FFCYQCNHTVNISISSAADPFCPLCSGGFLEEYDEPVPTLPQNLNPAASDFFPMADPFST  78

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPN--QFHPLLFLQNYLQTMRA  492
               +  G      S+A+           + FG  +A   P    F P+ FLQN+LQ +++
Sbjct  79   LLPLLFGSSAPPPSSANP----------SFFGPRSAQNQPQGGAFDPVSFLQNHLQHLQS  128

Query  493  SGANIQLVFXNSgggggvpgnlg--DYFVGPGLEQLIQQLMEND  618
            SG ++Q +  +              DYF GPGLEQLIQQL END
Sbjct  129  SGTHVQFLIEDHPLDPSNQAPGHLGDYFFGPGLEQLIQQLAEND  172



>ref|XP_003555841.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=298

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 75/163 (46%), Gaps = 33/163 (20%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FC+ C + +T +    SE  CP C  +F+EE     P                      
Sbjct  13   FFCHVCSQRITCSD--ESEPFCPICMESFVEECNPNNPNPNLFTE---------------  55

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGR-SPNQFHPLLFLQNYLQTMRAS  495
                         +  SS   I+   L      ++  R  P+ F P++FLQN++Q +RA 
Sbjct  56   -------------NEESSDSEISFSLLPLFLSSVSRSRPEPDMFDPMVFLQNHIQGLRAD  102

Query  496  GANIQLVFXNSgggg--gvpgnlgDYFVGPGLEQLIQQLMEND  618
            GANIQ+ F +        +P N+GDYF+GPGLEQ IQQL +ND
Sbjct  103  GANIQVDFGHPSEQQGFRLPANIGDYFMGPGLEQFIQQLADND  145



>ref|XP_008355430.1| PREDICTED: uncharacterized protein LOC103419088 [Malus domestica]
Length=531

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 46/69 (67%), Gaps = 8/69 (12%)
 Frame = +1

Query  436  PNQFHPLLFLQNYLQTMRASGANIQLVFXN--------SgggggvpgnlgDYFVGPGLEQ  591
            P+ F+P +FLQNYLQT+RA+GAN+Q +  +        SG       NL DYF GPGLEQ
Sbjct  268  PDDFNPFVFLQNYLQTLRANGANVQFMIDSTPGDGGDPSGFPAPTNLNLRDYFFGPGLEQ  327

Query  592  LIQQLMEND  618
            LIQQL END
Sbjct  328  LIQQLAEND  336



>ref|XP_003620252.1| RING finger protein [Medicago truncatula]
Length=340

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 79/172 (46%), Gaps = 38/172 (22%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            YFC+ CERT  I+   +++L+CPNCN +F+EE E+  P    N  P F            
Sbjct  22   YFCHQCERTSLISTT-STDLICPNCNSSFIEELESPIPNPNPNPLPPFFSH---------  71

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAA--GRSPNQFHPLLFLQNYLQTMRA  492
                         +T    GG +      LF G  A    +   F+P+ F+QNYL+ M A
Sbjct  72   -------------TTEFPAGGFSF---PMLFSGNGAPTATATEAFNPMAFIQNYLRNMNA  115

Query  493  SGAN---IQLVFXNSggggg-------vpgnlgDYFVGPGLEQLIQQLMEND  618
             G     IQ V  +    G           NLGDYF GPGLE LIQQL END
Sbjct  116  GGGGGGGIQFVINDGDEPGRFRFPGFPGNANLGDYFFGPGLEDLIQQLAEND  167



>gb|EPS73974.1| hypothetical protein M569_00782, partial [Genlisea aurea]
Length=296

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 75/165 (45%), Gaps = 21/165 (13%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  309
            PQ YFC+ CERTV I+P P  +++CP+CN  F+EE +   P     +  F      F   
Sbjct  13   PQMYFCHQCERTVAISPSPGGDILCPSCNSGFVEEFQNPSPNPVIPDPFFPDPLSLFLSQ  72

Query  310  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMR  489
            F    G        V S     G  + D ++ L   +A  R                   
Sbjct  73   FILPPGNPFNPPRSVSSGDPQLGHESFDPVTYLVNLLANRR-------------------  113

Query  490  ASGANIQLVFXNSgggg--gvpgnlgDYFVGPGLEQLIQQLMEND  618
            ASG + Q V  +S        PGN+GDYFVGPG EQLIQQL END
Sbjct  114  ASGVDYQFVLDDSTSAAGFPFPGNIGDYFVGPGFEQLIQQLAEND  158



>ref|XP_007043255.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOX99086.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=343

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = +1

Query  403  ALFGGMAAGR-SPNQFHPLLFLQNYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFV  573
            +LFG   + R  P  F P  F+QN+L  +R+SGA+I+ V  N  S  G  +P N+GDYF+
Sbjct  116  SLFGSTRSARGDPFAFDPFAFIQNHLNDLRSSGAHIEFVIQNNPSEPGFRLPANIGDYFI  175

Query  574  GPGLEQLIQQLMEND  618
            GPGLEQLIQQL END
Sbjct  176  GPGLEQLIQQLAEND  190



>ref|XP_006847820.1| hypothetical protein AMTR_s00029p00043520 [Amborella trichopoda]
 gb|ERN09401.1| hypothetical protein AMTR_s00029p00043520 [Amborella trichopoda]
Length=366

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  436  PNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnlgDYFVGPGLEQLIQQLMEN  615
            P  F+PL+FLQ+YLQT+     N Q+VF  S         L DYFVGPGLEQLIQ L EN
Sbjct  100  PMVFNPLIFLQDYLQTLVQGRPNFQVVFETSDNAAPAGFRLNDYFVGPGLEQLIQHLAEN  159

Query  616  D  618
            D
Sbjct  160  D  160



>ref|XP_003536735.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=286

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +1

Query  433  SPNQFHPLLFLQNYLQTMRASGANIQLVFXNSggggg--vpgnlgDYFVGPGLEQLIQQL  606
             P+ F P++FLQN+LQ +RA GANIQ+ F +           N+GDYF+GPGLEQ IQQL
Sbjct  83   EPDVFDPMVFLQNHLQDLRADGANIQVDFDHPSNENQGFRLANIGDYFMGPGLEQFIQQL  142

Query  607  MEND  618
             +ND
Sbjct  143  ADND  146



>emb|CDY24592.1| BnaC05g32760D [Brassica napus]
Length=321

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 77/166 (46%), Gaps = 17/166 (10%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNS--ELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgf  312
            +FCY C RTV I+   +S  +  CP C+G FLEE +   PT P N NP            
Sbjct  19   FFCYQCNRTVNISISISSAADPFCPLCSGGFLEEYDEPVPTLPPNLNPESGFFPMADPFS  78

Query  313  gggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPN--QFHPLLFLQNYLQTM  486
                 + G       ST  S            FG  +    P    F P+ FLQN+LQ +
Sbjct  79   TLLPLLFGSSSAPPSSTNPS-----------FFGPRSTQNQPQGGAFDPVSFLQNHLQHL  127

Query  487  RASGANIQLVFXNSgggggvpgn--lgDYFVGPGLEQLIQQLMEND  618
            ++SG ++Q +  +            +GDYF GPGLEQLIQQL END
Sbjct  128  QSSGTHVQFLIEDHPLDPSNRAPGHVGDYFFGPGLEQLIQQLAEND  173



>ref|XP_009135656.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=302

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 79/172 (46%), Gaps = 42/172 (24%)
 Frame = +1

Query  139  YFCYHC-ERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfg  315
            YFCY C +     T   +S+  CP C+G FLEE +   P  P N                
Sbjct  17   YFCYQCNQTVTISTSSTSSDPFCPLCSGGFLEEYDEPNPNPPPN----------------  60

Query  316  ggggvggggeglvfSTASSGGGIALDD-----LSALFGG---MAAGRSPNQ-FHPLLFLQ  468
                             S GG   + D     L  LFG    M    + N  F P+ FLQ
Sbjct  61   --------------LNPSGGGFFPMSDPFSTLLPLLFGSNPSMQPRSTRNDAFDPVSFLQ  106

Query  469  NYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            N+LQ +R+SG ++Q V  N  S     VPGNLGDYF GPGLEQLIQQL END
Sbjct  107  NHLQHLRSSGTHVQFVIENHPSDQSNRVPGNLGDYFFGPGLEQLIQQLAEND  158



>gb|KJB77384.1| hypothetical protein B456_012G134900 [Gossypium raimondii]
 gb|KJB77385.1| hypothetical protein B456_012G134900 [Gossypium raimondii]
 gb|KJB77386.1| hypothetical protein B456_012G134900 [Gossypium raimondii]
 gb|KJB77387.1| hypothetical protein B456_012G134900 [Gossypium raimondii]
Length=338

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +1

Query  403  ALFGGMAAGR-SPNQFHPLLFLQNYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFV  573
            +L G   +GR  P  F P  F+QN+L  +R+SGA I+ V  N  S  G  +P N+GDYF+
Sbjct  116  SLSGPTRSGRGDPFAFDPFTFIQNHLNDLRSSGAQIEFVIQNNPSDQGFRLPANIGDYFI  175

Query  574  GPGLEQLIQQLMEND  618
            GPGLEQLIQQL END
Sbjct  176  GPGLEQLIQQLAEND  190



>gb|KHG22497.1| E3 ubiquitin-protein ligase RING1 [Gossypium arboreum]
Length=338

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +1

Query  403  ALFGGMAAGR-SPNQFHPLLFLQNYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFV  573
            +L G   +GR  P  F P  F+QN+L  +R+SGA I+ V  N  S  G  +P N+GDYF+
Sbjct  116  SLSGPTRSGRGDPFAFDPFTFIQNHLNDLRSSGAQIEFVIQNNPSDQGFRLPANIGDYFI  175

Query  574  GPGLEQLIQQLMEND  618
            GPGLEQLIQQL END
Sbjct  176  GPGLEQLIQQLAEND  190



>sp|P0CH30.1|RING1_GOSHI RecName: Full=E3 ubiquitin-protein ligase RING1; AltName: Full=RING 
finger protein 1 [Gossypium hirsutum]
 gb|ADI58769.1| RING-type ubiquitin E3 ligase [Gossypium hirsutum]
Length=338

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 3/75 (4%)
 Frame = +1

Query  403  ALFGGMAAGR-SPNQFHPLLFLQNYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFV  573
            +L G   +GR  P  F P  F+QN+L  +R+SGA I+ V  N  S  G  +P N+GDYF+
Sbjct  116  SLSGPTRSGRGDPFAFDPFTFIQNHLNDLRSSGAQIEFVIQNNPSDQGFRLPANIGDYFI  175

Query  574  GPGLEQLIQQLMEND  618
            GPGLEQLIQQL END
Sbjct  176  GPGLEQLIQQLAEND  190



>ref|XP_008803049.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
Length=364

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 47/80 (59%), Gaps = 9/80 (11%)
 Frame = +1

Query  379  GIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnl  558
            G A     AL GG  A      F+PL FLQN++Q + + GANIQ+V     GG       
Sbjct  111  GPAPGPTPALGGGGGA----EPFNPLAFLQNHIQQLLSGGANIQIVLEGGPGGNLG----  162

Query  559  gDYFVGPGLEQLIQQLMEND  618
             DYF+GPGLEQLIQQL END
Sbjct  163  -DYFIGPGLEQLIQQLAEND  181


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  234
            PQ YFC+ C+RTVT+TP P +E+ CP C+  F+EE
Sbjct  13   PQRYFCHQCDRTVTLTPSPGAEIACPICHDGFIEE  47



>ref|XP_011002257.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase RING1-like 
[Populus euphratica]
Length=292

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 73/165 (44%), Gaps = 23/165 (14%)
 Frame = +1

Query  133  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgf  312
            + YFCY C RTV+I      +  CP C+ +F+EE ET  P NP+     +          
Sbjct  19   KQYFCYQCNRTVSIPASSYDDPYCPICHDSFIEEFETQNPQNPNPFPDSYFNDPF-----  73

Query  313  gggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMRA  492
                              SS   +   +    F        PN F+PL FL+++LQ + +
Sbjct  74   ---------------DPFSSLFPLLFQNSGTEFPARPGFSGPNAFNPLEFLRSHLQNLHS  118

Query  493  SGANIQLVFXNSgggggvpgnlgD---YFVGPGLEQLIQQLMEND  618
             G  +  V  N+G   G+     +   YF+G GLEQLIQQL END
Sbjct  119  GGGRVXFVIENNGHEPGLRFPDSNFGNYFIGSGLEQLIQQLAEND  163



>ref|NP_001152117.1| RHC1A [Zea mays]
 gb|ACG45859.1| RHC1A [Zea mays]
 tpg|DAA49548.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=375

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 9/77 (12%)
 Frame = +1

Query  415  GMAAGRS-PNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvp--------gnlgDY  567
            G A  R+ P  F P++F QNY+Q++   GANIQ++F ++    G           + GDY
Sbjct  127  GTATHRNEPEPFDPVMFFQNYIQSLVEGGANIQVLFDDASASLGSGPGLGRLGGASFGDY  186

Query  568  FVGPGLEQLIQQLMEND  618
            FVGPGLEQLI+QL END
Sbjct  187  FVGPGLEQLIEQLAEND  203



>emb|CDX82271.1| BnaA03g35500D [Brassica napus]
Length=213

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = +1

Query  439  NQFHPLLFLQNYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLME  612
            + F P+ FLQN+LQ +R+SG ++Q V  N  S     VPGNLGDYF GPGLEQLIQQL E
Sbjct  9    DAFDPVSFLQNHLQHLRSSGTHVQFVIENHPSDQSNRVPGNLGDYFFGPGLEQLIQQLAE  68

Query  613  ND  618
            ND
Sbjct  69   ND  70



>ref|XP_009383684.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Musa acuminata 
subsp. malaccensis]
Length=359

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 48/80 (60%), Gaps = 7/80 (9%)
 Frame = +1

Query  394  DLSALFGGMAAGR-----SPNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnl  558
            DL+ L G + +        P  F+P+LFLQ+Y++ + + GANIQ+V       G      
Sbjct  100  DLADLLGPVRSSEPSPTPGPAPFNPMLFLQDYMRQLLSGGANIQVVLEGGPVVGAGNLG-  158

Query  559  gDYFVGPGLEQLIQQLMEND  618
             DYF+GPGLE+LIQQL END
Sbjct  159  -DYFIGPGLERLIQQLAEND  177



>emb|CDY36069.1| BnaC03g41290D [Brassica napus]
Length=217

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = +1

Query  445  FHPLLFLQNYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            F P+ FLQN+LQ +R+SG ++Q V  N  S     +PGNLGDYF GPGLEQLIQQL END
Sbjct  11   FDPVSFLQNHLQHLRSSGTHVQFVIENHPSDPSNRIPGNLGDYFFGPGLEQLIQQLAEND  70



>ref|XP_010940373.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940374.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940375.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940376.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
Length=363

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +1

Query  436  PNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnlgDYFVGPGLEQLIQQLMEN  615
            P  F+PL FLQN++Q + + GANIQ+V     G GG  G   DYF+GPGLEQLIQQL EN
Sbjct  122  PEPFNPLEFLQNHIQQLLSGGANIQVVLEGGPGLGGNLG---DYFIGPGLEQLIQQLAEN  178

Query  616  D  618
            D
Sbjct  179  D  179


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  133  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  234
            Q YFC+ C+RTVT+T  P +E+ CP C+G FLEE
Sbjct  14   QLYFCHQCDRTVTLTLSPGAEIACPICHGGFLEE  47



>ref|XP_007142767.1| hypothetical protein PHAVU_007G015200g [Phaseolus vulgaris]
 gb|ESW14761.1| hypothetical protein PHAVU_007G015200g [Phaseolus vulgaris]
Length=306

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +1

Query  406  LFGGMAAGRSPNQFHPLLFLQNYLQTMRASGANIQLVFXN-SgggggvpgnlgDYFVGPG  582
            L  G    R  + F P  +LQNYLQ++RA GANIQ  F + S      P NLGDY++GPG
Sbjct  79   LNSGSRTRREADMFDPRTYLQNYLQSLRADGANIQFSFGHPSDNWFRSPANLGDYYLGPG  138

Query  583  LEQLIQQLMEND  618
             EQLIQ L +ND
Sbjct  139  FEQLIQLLADND  150



>ref|XP_010935556.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
Length=358

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 3/58 (5%)
 Frame = +1

Query  445  FHPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            F+PL FLQN++Q + + GANIQ+V     G GG  G   DYF+GPGLEQLIQQL END
Sbjct  121  FNPLAFLQNHIQQLVSGGANIQIVLEGGPGLGGNLG---DYFIGPGLEQLIQQLAEND  175


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  234
            PQ YFC+ C+RTVT+TP P++E+ CP C+G FLEE
Sbjct  13   PQRYFCHQCDRTVTLTPSPDAEIACPICHGGFLEE  47



>ref|XP_006406436.1| hypothetical protein EUTSA_v10021059mg [Eutrema salsugineum]
 gb|ESQ47889.1| hypothetical protein EUTSA_v10021059mg [Eutrema salsugineum]
Length=345

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = +1

Query  445  FHPLLFLQNYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            F P+ FLQN+LQ +R+SG ++Q V  +  S     +PGNLGDYF GPGLEQLIQQL END
Sbjct  128  FDPITFLQNHLQHLRSSGTHVQFVIESNPSDPSNRMPGNLGDYFFGPGLEQLIQQLAEND  187



>emb|CDY22790.1| BnaA06g02870D [Brassica napus]
Length=270

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 69/162 (43%), Gaps = 41/162 (25%)
 Frame = +1

Query  133  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgf  312
            + +FC+ C +T+TIT  P ++  CP CN  FLEE                          
Sbjct  19   KTFFCHQCNQTITITISPTADPFCPLCNLGFLEEHTDPIFPISDP---------------  63

Query  313  gggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMRA  492
                             +S    I + D + L         P+ F P+ F+ ++LQ +++
Sbjct  64   ---------------PPSSRLPFIPVMDFTNL------DHDPDAFDPVSFIHSHLQQLQS  102

Query  493  SGANIQLVFXNSgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            SG N+Q++F N         + GDYF   GLE LIQQL E+D
Sbjct  103  SGVNVQMLFENH-----HHHHHGDYFGRGGLEDLIQQLGEDD  139



>ref|XP_009588217.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
tomentosiformis]
Length=314

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 73/162 (45%), Gaps = 13/162 (8%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            YFC+ C  TVTITP P  +L+CP CN +F+EE E   P      N   P    F   F  
Sbjct  16   YFCHKCSNTVTITPSPTGDLLCPTCNSDFVEEYEEPDPDPDPYPNFPDPVYSLFSTLFNP  75

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMRASG  498
                    +       SS    A +    + G  + G  P     + +L  +L + RASG
Sbjct  76   SRSTTASLDSQNPRIYSS----AQNPRDEILG--SGGFDP-----IGYLMTHLSSQRASG  124

Query  499  ANIQLVFXNSgggggvpgnlg--DYFVGPGLEQLIQQLMEND  618
             N + V     GG G+       DYF+GP  E+LIQQL END
Sbjct  125  INFEFVIEGGNGGSGLGLPANIGDYFIGPHFEELIQQLAEND  166



>ref|XP_004137524.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004137525.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004137526.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 3 [Cucumis 
sativus]
 ref|XP_004161827.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004161828.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004161829.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 3 [Cucumis 
sativus]
 gb|KGN64207.1| hypothetical protein Csa_1G043100 [Cucumis sativus]
Length=378

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +1

Query  130  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  243
            PQ YFCY C RTVTITP  +S+L+CPNCN +F+EE E+
Sbjct  21   PQLYFCYTCNRTVTITPSSSSDLLCPNCNDSFVEEMES  58



>gb|ACG33105.1| RHC1A [Zea mays]
Length=385

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 8/80 (10%)
 Frame = +1

Query  403  ALFGGMAAGRSPNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvp--------gnl  558
            A  G       P  F P++F QNY+ ++   GANIQ++  ++    G           + 
Sbjct  134  AAAGTATPENEPEPFDPVMFFQNYIHSLVEGGANIQVLLDDASVTLGSGPGLGRIGGASF  193

Query  559  gDYFVGPGLEQLIQQLMEND  618
            GDYFVGPGLEQLI+QL END
Sbjct  194  GDYFVGPGLEQLIEQLAEND  213



>ref|NP_001130953.1| uncharacterized LOC100192058 [Zea mays]
 gb|ACF79355.1| unknown [Zea mays]
 gb|AFW68526.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=385

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 8/80 (10%)
 Frame = +1

Query  403  ALFGGMAAGRSPNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvp--------gnl  558
            A  G       P  F P++F QNY+ ++   GANIQ++  ++    G           + 
Sbjct  134  AAAGTATPENEPEPFDPVMFFQNYIHSLVEGGANIQVLLDDASVTLGSGPGLGRIGGASF  193

Query  559  gDYFVGPGLEQLIQQLMEND  618
            GDYFVGPGLEQLI+QL END
Sbjct  194  GDYFVGPGLEQLIEQLAEND  213



>ref|NP_001064906.2| Os10g0487400 [Oryza sativa Japonica Group]
 dbj|BAF26820.2| Os10g0487400 [Oryza sativa Japonica Group]
Length=304

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 41/67 (61%), Gaps = 6/67 (9%)
 Frame = +1

Query  436  PNQFHPLLFLQNYLQTMRASGANIQLVFXNSggg------ggvpgnlgDYFVGPGLEQLI  597
            P+ F  + F QNYLQ +   GANIQ++  ++  G           + GDYFVGPGLEQLI
Sbjct  69   PDGFDAVTFFQNYLQNLMDGGANIQVLLDDASVGLAPGIGRVGGASFGDYFVGPGLEQLI  128

Query  598  QQLMEND  618
            +QL END
Sbjct  129  EQLTEND  135



>ref|XP_006661882.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Oryza brachyantha]
Length=363

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 7/68 (10%)
 Frame = +1

Query  436  PNQFHPLLFLQNYLQTMRASGANIQLVFXNSg-------ggggvpgnlgDYFVGPGLEQL  594
            P+ F  + F+QNYLQ++   GANIQ++  ++         G     + GDYFVGPGLEQL
Sbjct  123  PDGFDAVTFVQNYLQSLVEGGANIQVLLDDASFSLAPGGIGRVGGASFGDYFVGPGLEQL  182

Query  595  IQQLMEND  618
            I+QL END
Sbjct  183  IEQLAEND  190



>ref|XP_004982780.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Setaria italica]
Length=393

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 40/69 (58%), Gaps = 8/69 (12%)
 Frame = +1

Query  436  PNQFHPLLFLQNYLQTMRASGANIQLVFXNSggg--------ggvpgnlgDYFVGPGLEQ  591
            P  F P++F QNYL  +   GANIQ++  ++                + GDYFVGPGLEQ
Sbjct  150  PEPFDPVIFFQNYLHNLMDGGANIQVLLDDASVSLGPGLGLGRVGGASFGDYFVGPGLEQ  209

Query  592  LIQQLMEND  618
            LI+QL END
Sbjct  210  LIEQLAEND  218



>ref|XP_002467049.1| hypothetical protein SORBIDRAFT_01g018800 [Sorghum bicolor]
 gb|EER94047.1| hypothetical protein SORBIDRAFT_01g018800 [Sorghum bicolor]
Length=398

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 8/69 (12%)
 Frame = +1

Query  436  PNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvp--------gnlgDYFVGPGLEQ  591
            P  F P++F QNY+ ++   GANIQ++  ++    G           + GDYFVGPGLEQ
Sbjct  154  PEPFDPVMFFQNYIHSLMEGGANIQVLLDDASVNLGSGPGLGRFGGASFGDYFVGPGLEQ  213

Query  592  LIQQLMEND  618
            LI+QL END
Sbjct  214  LIEQLAEND  222



>emb|CDY42507.1| BnaC06g03510D [Brassica napus]
Length=339

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 70/160 (44%), Gaps = 38/160 (24%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  318
            +FC+ C +T+TIT    ++  CP CN  FLEE     P      +               
Sbjct  21   FFCHQCNQTITITISSAADPFCPLCNLGFLEEYTDPIPILIFPISDP-------------  67

Query  319  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMRASG  498
                           +S    I + D + L         P+ F P+ F+ ++LQ +++SG
Sbjct  68   -------------PPSSRLPFIPVMDFTNL------DHDPDAFDPVSFIHSHLQQLQSSG  108

Query  499  ANIQLVFXNSgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
             N+Q++F N         + GDYF G GLE LIQQL E+D
Sbjct  109  INVQMLFENH------HHHHGDYFFGRGLEDLIQQLGEDD  142



>ref|XP_003574092.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brachypodium 
distachyon]
Length=366

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 7/68 (10%)
 Frame = +1

Query  436  PNQFHPLLFLQNYLQTMRASGANIQLVFXNSggg-------ggvpgnlgDYFVGPGLEQL  594
            P  F P+ F QNY+ ++   GANIQ++  ++               + GDYFVGPGLEQL
Sbjct  131  PESFDPVTFFQNYIHSLMEGGANIQVLLDDASVSLAPGLGGRTGGASFGDYFVGPGLEQL  190

Query  595  IQQLMEND  618
            I+QL END
Sbjct  191  IEQLAEND  198



>ref|XP_009111341.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
 ref|XP_009111349.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=325

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 49/76 (64%), Gaps = 5/76 (7%)
 Frame = +1

Query  406  LFGGMAAGRSPN---QFHPLLFLQNYLQTMRASGANIQLVFXN--SgggggvpgnlgDYF  570
            LFG  +    P     F P+ FLQN+LQ +++SG ++Q V  +  S     +PGN+GDYF
Sbjct  95   LFGPRSTENQPQGGGAFDPVSFLQNHLQHLQSSGTHVQFVIEDHPSDPFSRIPGNMGDYF  154

Query  571  VGPGLEQLIQQLMEND  618
             GPGLEQLIQQL END
Sbjct  155  FGPGLEQLIQQLAEND  170



>ref|XP_010034290.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Eucalyptus grandis]
 gb|KCW51329.1| hypothetical protein EUGRSUZ_J00881 [Eucalyptus grandis]
 gb|KCW51330.1| hypothetical protein EUGRSUZ_J00881 [Eucalyptus grandis]
Length=321

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 43/66 (65%), Gaps = 6/66 (9%)
 Frame = +1

Query  439  NQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggv------pgnlgDYFVGPGLEQLIQ  600
            N F P  FL N+LQ ++++GA IQ V  +S   G        P NLGDYFVGPGLEQLIQ
Sbjct  119  NLFDPFAFLMNHLQDLQSTGAQIQFVVESSPSEGRGGGGFHLPSNLGDYFVGPGLEQLIQ  178

Query  601  QLMEND  618
            QL END
Sbjct  179  QLAEND  184



>emb|CDY72364.1| BnaAnng40830D, partial [Brassica napus]
Length=222

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = +1

Query  445  FHPLLFLQNYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            F P+ FLQN+LQ +++SG ++Q V  +  S     +PGN+GDYF GPGLEQLIQQL END
Sbjct  14   FDPVSFLQNHLQHLQSSGTHVQFVIEDHPSDPFSRIPGNMGDYFFGPGLEQLIQQLAEND  73



>gb|AAL59019.1|AC087182_2 putative zinc finger protein [Oryza sativa Japonica Group]
 gb|AAP54362.1| Zinc finger, C3HC4 type family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95571.1| unnamed protein product [Oryza sativa Japonica Group]
Length=370

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 6/67 (9%)
 Frame = +1

Query  436  PNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnlg------DYFVGPGLEQLI  597
            P+ F  + F QNYLQ +   GANIQ++  ++  G              DYFVGPGLEQLI
Sbjct  135  PDGFDAVTFFQNYLQNLMDGGANIQVLLDDASVGLAPGIGRVGGASFGDYFVGPGLEQLI  194

Query  598  QQLMEND  618
            +QL END
Sbjct  195  EQLTEND  201



>gb|EAY78992.1| hypothetical protein OsI_34100 [Oryza sativa Indica Group]
Length=370

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 6/67 (9%)
 Frame = +1

Query  436  PNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnlg------DYFVGPGLEQLI  597
            P+ F  + F QNYLQ +   GANIQ++  ++  G              DYFVGPGLEQLI
Sbjct  135  PDGFDAVTFFQNYLQNLMDGGANIQVLLDDASVGLAPGIGRVGGASFGDYFVGPGLEQLI  194

Query  598  QQLMEND  618
            +QL END
Sbjct  195  EQLAEND  201



>ref|XP_010322969.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=359

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 72/157 (46%), Gaps = 36/157 (23%)
 Frame = +1

Query  136  DYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfg  315
            +Y+CY C+ TV   PLPNSEL CPNCNG F+EE+ +                        
Sbjct  19   NYYCYGCQSTV---PLPNSELSCPNCNGTFVEESPSP-----------------------  52

Query  316  ggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTMRAS  495
                V G      FS  +  G  + D++SALF     GRSP +  P+ F+       R  
Sbjct  53   --DPVTGANPDSSFSFPTDSGNESDDEVSALF-ESGFGRSPVEVDPVTFMN------RDG  103

Query  496  GANIQLVFXNSgggggvpgnlgDYFVGPGLEQLIQQL  606
               IQL+  N+     +P   GD+ VG  L QLI+QL
Sbjct  104  DGTIQLLLENN-HENELPIIFGDFTVGRYLVQLIRQL  139



>emb|CDY33437.1| BnaC01g32880D [Brassica napus]
Length=324

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = +1

Query  445  FHPLLFLQNYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            F P+ FLQN+LQ +++SG ++Q V  +  S     +PGN+GDYF GPGLEQLIQQL END
Sbjct  113  FDPVSFLQNHLQHLQSSGTHVQFVIEDHPSDPFNRIPGNMGDYFFGPGLEQLIQQLAEND  172



>ref|XP_008811090.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811098.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811103.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811112.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811119.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
Length=362

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 44/55 (80%), Gaps = 3/55 (5%)
 Frame = +1

Query  454  LLFLQNYLQTMRASGANIQLVFXNSgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            L+FLQN++Q + + GANIQ+V     GG G+ G+LGDYF+GPGLEQLIQQL END
Sbjct  127  LVFLQNHIQQLLSGGANIQVV---LEGGPGLGGSLGDYFIGPGLEQLIQQLAEND  178


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +1

Query  133  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  234
            Q YFC+ C+RTVT+T  P +E+ CP C+G F+EE
Sbjct  14   QRYFCHQCDRTVTLTVSPGAEIACPICHGGFVEE  47



>ref|XP_006393160.1| hypothetical protein EUTSA_v10011690mg [Eutrema salsugineum]
 gb|ESQ30446.1| hypothetical protein EUTSA_v10011690mg [Eutrema salsugineum]
Length=305

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = +1

Query  421  AAGRSPNQFHPLLFLQNYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQL  594
            +  + P+ F P+ F+ N+LQ +++SG N+QL+F N  S     +PGN GDYF G GLE L
Sbjct  96   STQQQPDAFDPVRFIHNHLQQLQSSGINVQLLFENQLSDLANPLPGNHGDYFFGRGLEDL  155

Query  595  IQQLMEND  618
            IQQL E+D
Sbjct  156  IQQLAEDD  163



>gb|ACF84253.1| unknown [Zea mays]
Length=234

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 8/62 (13%)
 Frame = +1

Query  457  LFLQNYLQTMRASGANIQLVFXNSgggggvp--------gnlgDYFVGPGLEQLIQQLME  612
            +F QNY+Q++   GANIQ++F ++    G           + GDYFVGPGLEQLI+QL E
Sbjct  1    MFFQNYIQSLVEGGANIQVLFDDASASLGSGPGLGRLGGASFGDYFVGPGLEQLIEQLAE  60

Query  613  ND  618
            ND
Sbjct  61   ND  62



>gb|KJB49973.1| hypothetical protein B456_008G147900 [Gossypium raimondii]
 gb|KJB49974.1| hypothetical protein B456_008G147900 [Gossypium raimondii]
 gb|KJB49975.1| hypothetical protein B456_008G147900 [Gossypium raimondii]
 gb|KJB49976.1| hypothetical protein B456_008G147900 [Gossypium raimondii]
Length=331

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 2/63 (3%)
 Frame = +1

Query  436  PNQFHPLLFLQNYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQLM  609
            P  F P  F+Q +L  +R+ GA I+ V  +  S  G  +P N+GDYF+GPGLEQLIQQL 
Sbjct  116  PFAFDPFAFIQGHLSDLRSRGAQIEFVIQSNPSEPGFRIPVNIGDYFIGPGLEQLIQQLA  175

Query  610  END  618
            END
Sbjct  176  END  178



>ref|XP_009145710.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=327

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 41/75 (55%), Gaps = 4/75 (5%)
 Frame = +1

Query  406  LFGGMAAGRSPN--QFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnlg--DYFV  573
             FG  +A   P    F P  FLQN+LQ +++SG ++Q +  +              DYF 
Sbjct  99   FFGPRSAQNQPQGGAFDPFSFLQNHLQHLQSSGTHVQFLIEDHPLDPSNQAPGHLGDYFF  158

Query  574  GPGLEQLIQQLMEND  618
            GPGLEQLIQQL END
Sbjct  159  GPGLEQLIQQLAEND  173



>ref|XP_006306505.1| hypothetical protein CARUB_v10012493mg [Capsella rubella]
 gb|EOA39403.1| hypothetical protein CARUB_v10012493mg [Capsella rubella]
Length=307

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 2/65 (3%)
 Frame = +1

Query  430  RSPNQFHPLLFLQNYLQTMRASGANIQLVFXN--SgggggvpgnlgDYFVGPGLEQLIQQ  603
            R P+ F P+ F+ N+L  +++SG N+Q +F N  S     +PGN GDYF G GLE LIQQ
Sbjct  101  RQPDAFDPVRFIHNHLLQLQSSGINVQFLFENQLSDAANPLPGNHGDYFFGRGLEDLIQQ  160

Query  604  LMEND  618
            L E+D
Sbjct  161  LAEDD  165



>ref|XP_011022020.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
 ref|XP_011022021.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=291

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 4/65 (6%)
 Frame = +1

Query  436  PNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnlg----DYFVGPGLEQLIQQ  603
            PN ++P  FL+++LQ + + GA +Q V  N+GG  G     G    DYF+G GLEQLIQQ
Sbjct  103  PNAYNPFDFLRSHLQNLHSGGARVQFVIENNGGERGGLRFPGGNFGDYFIGSGLEQLIQQ  162

Query  604  LMEND  618
            L END
Sbjct  163  LAEND  167



>ref|XP_003592721.1| RING finger protein [Medicago truncatula]
 gb|AES62972.1| E3 ubiquitin-protein ligase RING1-like protein [Medicago truncatula]
Length=315

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = +1

Query  439  NQFHPLLFLQNYLQTMRASGANIQLVFXN---SgggggvpgnlgDYFVGPGLEQLIQQLM  609
            + F P  FLQN+L  + A GANIQ    N   S  G  VP NLGDYF+G G EQLIQQL 
Sbjct  98   DSFDPFAFLQNHLNGLHADGANIQFEINNPSESEPGFRVPSNLGDYFLGAGFEQLIQQLA  157

Query  610  END  618
            END
Sbjct  158  END  160



>gb|KFM59559.1| hypothetical protein X975_00622, partial [Stegodyphus mimosarum]
Length=105

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEE  234
            YFC+ C R VT++P+  +EL CP C+G FLEE
Sbjct  14   YFCHGCSREVTVSPIHTTELTCPECSGEFLEE  45



>ref|XP_002307159.2| hypothetical protein POPTR_0005s09270g [Populus trichocarpa]
 gb|EEE94155.2| hypothetical protein POPTR_0005s09270g [Populus trichocarpa]
Length=290

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 4/64 (6%)
 Frame = +1

Query  439  NQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnlg----DYFVGPGLEQLIQQL  606
            N F+P  FL+++LQ + + GA +Q V  N+GG  G     G    DYF+G GLEQLIQQL
Sbjct  107  NAFNPFDFLRSHLQNLHSGGARVQFVIENNGGEQGGLRFPGGNFGDYFIGSGLEQLIQQL  166

Query  607  MEND  618
             END
Sbjct  167  AEND  170



>ref|XP_001777565.1| predicted protein [Physcomitrella patens]
 gb|EDQ57608.1| predicted protein [Physcomitrella patens]
Length=560

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 40/77 (52%), Gaps = 7/77 (9%)
 Frame = +1

Query  409  FGGMAAGRS------PNQFHPLLFLQNYLQTMRASGANIQLVFXNSgggggvpgnl-gDY  567
            +G  + GRS      P  F PL+ LQ  +      G N+ + F N  G         GDY
Sbjct  256  YGTHSRGRSGVMEDVPGGFSPLVRLQGQMHNFLGGGGNVDVFFDNGTGNPRRLPGNFGDY  315

Query  568  FVGPGLEQLIQQLMEND  618
            F+GPGL+QLIQQL END
Sbjct  316  FLGPGLDQLIQQLAEND  332



>ref|XP_003529396.2| PREDICTED: uncharacterized protein LOC100820426 [Glycine max]
Length=446

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 38/60 (63%), Gaps = 4/60 (7%)
 Frame = +1

Query  448  HPLLFLQNYLQTMRAS-GANIQLVFXNSggggg---vpgnlgDYFVGPGLEQLIQQLMEN  615
            +PL+FLQNY QT+RAS G N+QLV  +S  G     +     DYF   GLE+LIQ L EN
Sbjct  27   NPLVFLQNYFQTLRASGGGNLQLVIKSSNPGRAFHFLGVTHNDYFFRSGLEELIQHLTEN  86



>ref|XP_004149872.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
 ref|XP_004168858.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis sativus]
 gb|KGN50936.1| hypothetical protein Csa_5G350590 [Cucumis sativus]
Length=299

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = +1

Query  445  FHPLLFLQNYLQTMRASGANI--QLVFXNSgggggvpgnlgDYFVGPGLEQLIQQLMEND  618
            + P +FLQN+L+++  SGA++  ++   +S  G  +P N+GDYF+GPGLEQLIQ L END
Sbjct  102  YDPFVFLQNHLRSIFESGADVVFEIPRHSSHSGVPMPQNVGDYFIGPGLEQLIQLLAEND  161



>ref|XP_009788594.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009788595.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Nicotiana sylvestris]
 ref|XP_009788596.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Nicotiana sylvestris]
Length=311

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  139  YFCYHCERTVTITPLPNSELVCPNCNGNFLEE  234
            YFC+ C  TVTITP P  +L+CP CN +F+EE
Sbjct  16   YFCHKCSNTVTITPSPTGDLLCPTCNSDFVEE  47



>ref|XP_008449154.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
Length=211

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = +1

Query  436  PNQFHPLLFLQNYLQTMRASGANI--QLVFXNSgggggvpgnlgDYFVGPGLEQLIQQLM  609
            P  + P +FLQN+L+++  SGA++  ++   +   G  +P N+GDYF+GPGLEQLIQ L 
Sbjct  101  PEPYDPFVFLQNHLRSIFESGADVVFEIPCHSFHSGVPMPQNVGDYFIGPGLEQLIQLLA  160

Query  610  END  618
            +ND
Sbjct  161  DND  163



>gb|EAZ16486.1| hypothetical protein OsJ_31957 [Oryza sativa Japonica Group]
Length=336

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 33/56 (59%), Gaps = 6/56 (11%)
 Frame = +1

Query  469  NYLQTMRASGANIQLVFXNSgggggvpgnlg------DYFVGPGLEQLIQQLMEND  618
            NYLQ +   GANIQ++  ++  G              DYFVGPGLEQLI+QL END
Sbjct  112  NYLQNLMDGGANIQVLLEDASVGLAPGIRRVGGASFGDYFVGPGLEQLIEQLTEND  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520