BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF049F02

Length=641
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011008112.1|  PREDICTED: D-xylose-proton symporter-like 2        196   7e-56   Populus euphratica
gb|ABK95072.1|  unknown                                                 194   3e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002325479.2|  hypothetical protein POPTR_0019s08330g             192   9e-55   
gb|KDP21779.1|  hypothetical protein JCGZ_00566                         191   4e-54   Jatropha curcas
ref|XP_008376911.1|  PREDICTED: D-xylose-proton symporter-like 2        191   9e-54   Malus domestica [apple tree]
ref|XP_009361176.1|  PREDICTED: D-xylose-proton symporter-like 2        190   2e-53   Pyrus x bretschneideri [bai li]
ref|XP_002520022.1|  sugar transporter, putative                        189   2e-53   
gb|KJB26762.1|  hypothetical protein B456_004G258400                    186   4e-53   Gossypium raimondii
gb|KJB26763.1|  hypothetical protein B456_004G258400                    187   9e-53   Gossypium raimondii
gb|KJB26764.1|  hypothetical protein B456_004G258400                    187   2e-52   Gossypium raimondii
ref|XP_009351838.1|  PREDICTED: D-xylose-proton symporter-like 2        187   2e-52   Pyrus x bretschneideri [bai li]
gb|KDO39946.1|  hypothetical protein CISIN_1g0102391mg                  183   3e-52   Citrus sinensis [apfelsine]
gb|KDO39947.1|  hypothetical protein CISIN_1g0102391mg                  183   5e-52   Citrus sinensis [apfelsine]
gb|KDO39945.1|  hypothetical protein CISIN_1g0102391mg                  184   1e-51   Citrus sinensis [apfelsine]
gb|KDO39944.1|  hypothetical protein CISIN_1g0102391mg                  184   2e-51   Citrus sinensis [apfelsine]
ref|XP_008234574.1|  PREDICTED: D-xylose-proton symporter-like 2        184   3e-51   Prunus mume [ume]
ref|XP_006347568.1|  PREDICTED: D-xylose-proton symporter-like 2-...    183   5e-51   Solanum tuberosum [potatoes]
ref|XP_007029560.1|  Major facilitator superfamily protein              183   7e-51   
ref|XP_008362818.1|  PREDICTED: D-xylose-proton symporter-like 2        182   8e-51   Malus domestica [apple tree]
ref|NP_001288106.1|  D-xylose-proton symporter-like 2-like              182   1e-50   Solanum lycopersicum
ref|XP_006443190.1|  hypothetical protein CICLE_v10019791mg             181   2e-50   
ref|XP_010063233.1|  PREDICTED: D-xylose-proton symporter-like 2        181   2e-50   Eucalyptus grandis [rose gum]
ref|XP_006443191.1|  hypothetical protein CICLE_v10019791mg             181   3e-50   Citrus clementina [clementine]
ref|XP_004170091.1|  PREDICTED: D-xylose-proton symporter-like 2-...    178   3e-49   
ref|XP_007219039.1|  hypothetical protein PRUPE_ppa004602mg             177   6e-49   Prunus persica
ref|XP_004137173.1|  PREDICTED: D-xylose-proton symporter-like 2-...    177   6e-49   Cucumis sativus [cucumbers]
ref|XP_009777282.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    175   4e-48   Nicotiana sylvestris
ref|XP_011075803.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    175   7e-48   Sesamum indicum [beniseed]
ref|XP_011075802.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    175   9e-48   
ref|XP_009777280.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    175   1e-47   Nicotiana sylvestris
ref|XP_009777281.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    173   2e-47   Nicotiana sylvestris
ref|XP_008455657.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    169   8e-46   Cucumis melo [Oriental melon]
ref|XP_004505609.1|  PREDICTED: D-xylose-proton symporter-like 2-...    168   2e-45   Cicer arietinum [garbanzo]
ref|XP_003607412.1|  D-xylose-proton symporter-like protein             167   3e-45   Medicago truncatula
gb|AFK39030.1|  unknown                                                 166   8e-45   Medicago truncatula
ref|XP_003537722.1|  PREDICTED: D-xylose-proton symporter-like 2-...    165   2e-44   Glycine max [soybeans]
gb|KHN05527.1|  D-xylose-proton symporter-like 2                        165   3e-44   Glycine soja [wild soybean]
ref|XP_007131530.1|  hypothetical protein PHAVU_011G020700g             165   3e-44   Phaseolus vulgaris [French bean]
ref|XP_010495236.1|  PREDICTED: D-xylose-proton symporter-like 2        159   5e-44   Camelina sativa [gold-of-pleasure]
gb|KDO39943.1|  hypothetical protein CISIN_1g0102391mg                  162   2e-43   Citrus sinensis [apfelsine]
ref|XP_002277076.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    162   3e-43   Vitis vinifera
gb|EYU43459.1|  hypothetical protein MIMGU_mgv1a004913mg                161   6e-43   Erythranthe guttata [common monkey flower]
ref|XP_006400240.1|  hypothetical protein EUTSA_v10013319mg             160   2e-42   Eutrema salsugineum [saltwater cress]
ref|XP_004307871.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    160   2e-42   Fragaria vesca subsp. vesca
ref|XP_010671130.1|  PREDICTED: D-xylose-proton symporter-like 2        160   2e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK37751.1|  hypothetical protein AALP_AA3G025300                    158   9e-42   Arabis alpina [alpine rockcress]
ref|XP_010087486.1|  D-xylose-proton symporter-like 2                   158   1e-41   
ref|XP_011470132.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    158   1e-41   Fragaria vesca subsp. vesca
ref|XP_010453878.1|  PREDICTED: D-xylose-proton symporter-like 2        158   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010420407.1|  PREDICTED: D-xylose-proton symporter-like 2        158   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010920045.1|  PREDICTED: D-xylose-proton symporter-like 2        157   2e-41   Elaeis guineensis
ref|XP_010506301.1|  PREDICTED: D-xylose-proton symporter-like 1        157   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009126155.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    157   2e-41   Brassica rapa
ref|XP_009126154.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    157   2e-41   Brassica rapa
ref|NP_001190323.1|  D-xylose-proton symporter-like 2                   156   3e-41   
ref|NP_850835.2|  D-xylose-proton symporter-like 2                      156   5e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KHN46451.1|  D-xylose-proton symporter-like 2                        155   1e-40   Glycine soja [wild soybean]
emb|CDY38076.1|  BnaC02g06970D                                          155   1e-40   Brassica napus [oilseed rape]
ref|XP_003540611.1|  PREDICTED: D-xylose-proton symporter-like 2-...    155   1e-40   Glycine max [soybeans]
emb|CDY28736.1|  BnaCnng06220D                                          155   1e-40   Brassica napus [oilseed rape]
ref|XP_002873804.1|  sugar transporter family protein                   153   5e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_010662115.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    153   6e-40   Vitis vinifera
emb|CDX85478.1|  BnaA02g03350D                                          153   7e-40   
ref|XP_006287575.1|  hypothetical protein CARUB_v10000784mg             152   9e-40   
ref|XP_010558647.1|  PREDICTED: D-xylose-proton symporter-like 2        152   1e-39   Tarenaya hassleriana [spider flower]
ref|XP_009613870.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    151   3e-39   Nicotiana tomentosiformis
ref|XP_002884358.1|  sugar transporter family protein                   150   4e-39   
ref|XP_006297488.1|  hypothetical protein CARUB_v10013506mg             150   5e-39   Capsella rubella
ref|XP_009130331.1|  PREDICTED: D-xylose-proton symporter-like 1        150   6e-39   Brassica rapa
gb|KFK25925.1|  hypothetical protein AALP_AA8G181200                    150   7e-39   Arabis alpina [alpine rockcress]
ref|XP_010933397.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    149   1e-38   
ref|XP_010933396.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    149   1e-38   Elaeis guineensis
emb|CDY43152.1|  BnaA05g32340D                                          149   2e-38   Brassica napus [oilseed rape]
ref|NP_186959.2|  vacuolar glucose transporter 1                        149   2e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CDP04938.1|  unnamed protein product                                148   4e-38   Coffea canephora [robusta coffee]
gb|EPS57619.1|  hypothetical protein M569_17198                         144   6e-38   Genlisea aurea
ref|XP_004309072.1|  PREDICTED: D-xylose-proton symporter-like 2        147   8e-38   Fragaria vesca subsp. vesca
ref|XP_010463755.1|  PREDICTED: D-xylose-proton symporter-like 1        147   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009134719.1|  PREDICTED: D-xylose-proton symporter-like 1        144   1e-36   Brassica rapa
ref|XP_008809219.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    143   3e-36   
emb|CDX92030.1|  BnaC03g33320D                                          141   1e-35   
ref|XP_003574402.1|  PREDICTED: D-xylose-proton symporter-like 2        140   3e-35   Brachypodium distachyon [annual false brome]
emb|CDY49922.1|  BnaCnng18320D                                          140   4e-35   Brassica napus [oilseed rape]
ref|XP_008791055.1|  PREDICTED: D-xylose-proton symporter-like 2        139   4e-35   
ref|XP_009119042.1|  PREDICTED: D-xylose-proton symporter-like 1        139   5e-35   Brassica rapa
ref|XP_009382608.1|  PREDICTED: D-xylose-proton symporter-like 2        139   6e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006408343.1|  hypothetical protein EUTSA_v10020565mg             139   1e-34   Eutrema salsugineum [saltwater cress]
ref|XP_008644912.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    138   1e-34   Zea mays [maize]
dbj|BAJ88105.1|  predicted protein                                      137   2e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006662109.1|  PREDICTED: D-xylose-proton symporter-like 2-...    137   2e-34   Oryza brachyantha
gb|EMS55132.1|  D-xylose-proton symporter-like 2                        137   3e-34   Triticum urartu
ref|XP_008644913.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    137   3e-34   Zea mays [maize]
ref|XP_002464862.1|  hypothetical protein SORBIDRAFT_01g027800          137   4e-34   Sorghum bicolor [broomcorn]
ref|NP_001065505.1|  Os10g0579200                                       136   7e-34   
gb|EMT10196.1|  D-xylose-proton symporter-like protein 2                136   9e-34   
emb|CDX92028.1|  BnaC03g33300D                                          135   2e-33   
ref|XP_004983521.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    134   3e-33   
ref|XP_006854111.1|  hypothetical protein AMTR_s00048p00147550          132   1e-32   Amborella trichopoda
ref|XP_010489652.1|  PREDICTED: D-xylose-proton symporter-like 1        132   1e-32   Camelina sativa [gold-of-pleasure]
gb|ADP37177.1|  putative vacuolar glucose transporter                   129   3e-31   Vitis vinifera
emb|CAN72732.1|  hypothetical protein VITISV_037854                     128   3e-31   Vitis vinifera
ref|XP_001773171.1|  predicted protein                                  124   1e-29   
ref|XP_008222102.1|  PREDICTED: D-xylose-proton symporter-like 3,...    122   8e-29   Prunus mume [ume]
ref|XP_003563522.2|  PREDICTED: D-xylose-proton symporter-like 3,...    122   9e-29   Brachypodium distachyon [annual false brome]
ref|XP_010261641.1|  PREDICTED: D-xylose-proton symporter-like 2        120   2e-28   Nelumbo nucifera [Indian lotus]
gb|ABK24923.1|  unknown                                                 121   2e-28   Picea sitchensis
gb|EMT28553.1|  D-xylose-proton symporter-like protein 3                119   3e-28   
ref|NP_197203.1|  D-xylose-proton symporter-like 2                      120   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207311.1|  hypothetical protein PRUPE_ppa003611mg             120   3e-28   Prunus persica
dbj|BAJ95036.1|  predicted protein                                      120   5e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007016339.1|  Major facilitator superfamily protein isoform 4    119   5e-28   
ref|XP_007016338.1|  Major facilitator superfamily protein isoform 3    119   6e-28   
ref|XP_007016337.1|  Major facilitator superfamily protein isoform 2    119   7e-28   
ref|XP_004981232.1|  PREDICTED: D-xylose-proton symporter-like 3,...    120   8e-28   Setaria italica
ref|XP_006651969.1|  PREDICTED: D-xylose-proton symporter-like 3,...    119   9e-28   Oryza brachyantha
ref|XP_008222111.1|  PREDICTED: D-xylose-proton symporter-like 3,...    119   9e-28   Prunus mume [ume]
ref|XP_007016336.1|  Major facilitator superfamily protein isoform 1    119   9e-28   
ref|XP_006590767.1|  PREDICTED: D-xylose-proton symporter-like 2-...    118   1e-27   
ref|XP_004953925.1|  PREDICTED: D-xylose-proton symporter-like 3,...    113   2e-27   
ref|XP_011035268.1|  PREDICTED: D-xylose-proton symporter-like 3,...    118   2e-27   Populus euphratica
ref|XP_011035266.1|  PREDICTED: D-xylose-proton symporter-like 3,...    118   2e-27   Populus euphratica
ref|XP_010256836.1|  PREDICTED: D-xylose-proton symporter-like 3,...    118   4e-27   Nelumbo nucifera [Indian lotus]
gb|AFK37407.1|  unknown                                                 116   1e-26   Lotus japonicus
ref|XP_008681531.1|  PREDICTED: uncharacterized protein LOC100274...    116   1e-26   
gb|KHN32151.1|  D-xylose-proton symporter-like 3, chloroplastic         116   2e-26   Glycine soja [wild soybean]
ref|XP_003539594.1|  PREDICTED: D-xylose-proton symporter-like 3,...    116   2e-26   Glycine max [soybeans]
ref|XP_007132040.1|  hypothetical protein PHAVU_011G061800g             116   2e-26   Phaseolus vulgaris [French bean]
ref|XP_009605737.1|  PREDICTED: D-xylose-proton symporter-like 3,...    115   2e-26   Nicotiana tomentosiformis
ref|XP_010907806.1|  PREDICTED: D-xylose-proton symporter-like 3,...    116   2e-26   Elaeis guineensis
ref|XP_010685696.1|  PREDICTED: D-xylose-proton symporter-like 3,...    115   2e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP42213.1|  hypothetical protein JCGZ_02943                         115   2e-26   Jatropha curcas
ref|XP_009605730.1|  PREDICTED: D-xylose-proton symporter-like 3,...    115   3e-26   Nicotiana tomentosiformis
gb|ACU20080.1|  unknown                                                 112   4e-26   Glycine max [soybeans]
ref|XP_001760396.1|  predicted protein                                  115   4e-26   
ref|XP_003537973.1|  PREDICTED: D-xylose-proton symporter-like 3,...    115   4e-26   Glycine max [soybeans]
ref|XP_006846330.1|  hypothetical protein AMTR_s00012p00255880          115   4e-26   Amborella trichopoda
gb|KHN21925.1|  D-xylose-proton symporter-like 3, chloroplastic         115   5e-26   Glycine soja [wild soybean]
ref|XP_004163808.1|  PREDICTED: D-xylose-proton symporter-like 3,...    113   5e-26   
gb|KHG28803.1|  hypothetical protein F383_00413                         115   5e-26   Gossypium arboreum [tree cotton]
gb|KJB20002.1|  hypothetical protein B456_003G129000                    114   5e-26   Gossypium raimondii
gb|KJB20003.1|  hypothetical protein B456_003G129000                    114   5e-26   Gossypium raimondii
ref|XP_004294661.1|  PREDICTED: D-xylose-proton symporter-like 3,...    115   5e-26   Fragaria vesca subsp. vesca
emb|CBI16087.3|  unnamed protein product                                114   6e-26   Vitis vinifera
gb|KJB20000.1|  hypothetical protein B456_003G129000                    114   8e-26   Gossypium raimondii
ref|XP_008457451.1|  PREDICTED: D-xylose-proton symporter-like 3,...    114   9e-26   Cucumis melo [Oriental melon]
gb|AES88921.2|  sugar transporter                                       113   1e-25   Medicago truncatula
ref|XP_008777375.1|  PREDICTED: D-xylose-proton symporter-like 3,...    114   1e-25   Phoenix dactylifera
ref|XP_003606724.1|  D-xylose-proton symporter-like protein             112   1e-25   
ref|XP_002280634.1|  PREDICTED: D-xylose-proton symporter-like 3,...    113   1e-25   Vitis vinifera
ref|XP_004145283.1|  PREDICTED: D-xylose-proton symporter-like 3,...    113   2e-25   
ref|XP_010106537.1|  D-xylose-proton symporter-like 3                   112   2e-25   
ref|XP_009779937.1|  PREDICTED: D-xylose-proton symporter-like 3,...    112   2e-25   Nicotiana sylvestris
ref|XP_010535452.1|  PREDICTED: D-xylose-proton symporter-like 3,...    112   3e-25   Tarenaya hassleriana [spider flower]
ref|XP_010535453.1|  PREDICTED: D-xylose-proton symporter-like 3,...    112   3e-25   Tarenaya hassleriana [spider flower]
ref|XP_009381068.1|  PREDICTED: D-xylose-proton symporter-like 3,...    112   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009779936.1|  PREDICTED: D-xylose-proton symporter-like 3,...    112   4e-25   Nicotiana sylvestris
ref|XP_008349595.1|  PREDICTED: D-xylose-proton symporter-like 3,...    112   5e-25   
ref|XP_008384924.1|  PREDICTED: D-xylose-proton symporter-like 3,...    112   5e-25   
ref|XP_009375941.1|  PREDICTED: D-xylose-proton symporter-like 3,...    112   5e-25   Pyrus x bretschneideri [bai li]
ref|XP_006342314.1|  PREDICTED: D-xylose-proton symporter-like 3,...    111   1e-24   Solanum tuberosum [potatoes]
ref|XP_011089518.1|  PREDICTED: D-xylose-proton symporter-like 3,...    111   1e-24   Sesamum indicum [beniseed]
gb|EYU45952.1|  hypothetical protein MIMGU_mgv1a003885mg                110   1e-24   Erythranthe guttata [common monkey flower]
ref|XP_006401006.1|  hypothetical protein EUTSA_v10013139mg             110   2e-24   Eutrema salsugineum [saltwater cress]
gb|ABB17074.1|  putative sugar transporter                              110   2e-24   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_004951635.1|  PREDICTED: D-xylose-proton symporter-like 3,...    103   7e-24   
emb|CDX74227.1|  BnaA03g28200D                                          108   7e-24   
ref|XP_002982112.1|  hypothetical protein SELMODRAFT_115745             107   7e-24   
ref|XP_002992213.1|  hypothetical protein SELMODRAFT_134982             107   8e-24   
ref|XP_004951634.1|  PREDICTED: D-xylose-proton symporter-like 3,...    103   1e-23   
ref|NP_001287653.1|  D-xylose-proton symporter-like 3, chloroplas...    107   2e-23   Solanum lycopersicum
ref|XP_010443656.1|  PREDICTED: D-xylose-proton symporter-like 3,...    107   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002866311.1|  hypothetical protein ARALYDRAFT_919128             107   2e-23   Arabidopsis lyrata subsp. lyrata
gb|KDO66624.1|  hypothetical protein CISIN_1g008624mg                   107   2e-23   Citrus sinensis [apfelsine]
dbj|BAE98379.1|  D-xylose-H+ symporter - like protein                   107   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200733.2|  Major facilitator superfamily protein                 107   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006424897.1|  hypothetical protein CICLE_v10028127mg             107   3e-23   Citrus clementina [clementine]
ref|XP_006279761.1|  hypothetical protein CARUB_v10027739mg             107   3e-23   Capsella rubella
ref|XP_006488378.1|  PREDICTED: D-xylose-proton symporter-like 3,...    107   4e-23   Citrus sinensis [apfelsine]
gb|KDO66619.1|  hypothetical protein CISIN_1g008624mg                   107   4e-23   Citrus sinensis [apfelsine]
ref|XP_006424895.1|  hypothetical protein CICLE_v10028127mg             106   4e-23   
ref|XP_010483521.1|  PREDICTED: D-xylose-proton symporter-like 3,...    107   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010454633.1|  PREDICTED: D-xylose-proton symporter-like 3,...    107   4e-23   Camelina sativa [gold-of-pleasure]
gb|KDO66618.1|  hypothetical protein CISIN_1g008624mg                   107   4e-23   Citrus sinensis [apfelsine]
ref|XP_006488379.1|  PREDICTED: D-xylose-proton symporter-like 3,...    107   4e-23   
gb|KDO66623.1|  hypothetical protein CISIN_1g008624mg                   106   5e-23   Citrus sinensis [apfelsine]
ref|XP_008681530.1|  PREDICTED: uncharacterized protein LOC100274...    106   6e-23   Zea mays [maize]
emb|CDP09100.1|  unnamed protein product                                104   4e-22   Coffea canephora [robusta coffee]
gb|EEE60202.1|  hypothetical protein OsJ_13164                          102   9e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CAN83894.1|  hypothetical protein VITISV_039113                     103   9e-22   Vitis vinifera
gb|AAO18445.1|  putative sugar transporter protein                      102   1e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76432.1|  hypothetical protein OsI_14118                          102   2e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_002300123.2|  hypothetical protein POPTR_0001s25100g           95.1    5e-19   
ref|XP_002520519.1|  sugar transporter, putative                      93.6    2e-18   
ref|XP_009120413.1|  PREDICTED: D-xylose-proton symporter-like 3,...  90.9    2e-17   Brassica rapa
emb|CDY33006.1|  BnaA10g12120D                                        90.9    2e-17   Brassica napus [oilseed rape]
gb|KDO66622.1|  hypothetical protein CISIN_1g008624mg                 89.7    2e-17   Citrus sinensis [apfelsine]
gb|ABF99614.1|  sugar transporter family protein, putative, expre...  90.1    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|KHN18956.1|  D-xylose-proton symporter-like 3, chloroplastic       84.0    3e-17   Glycine soja [wild soybean]
ref|XP_008455658.1|  PREDICTED: D-xylose-proton symporter-like 2 ...  88.6    3e-17   
emb|CDY54245.1|  BnaC09g53840D                                        89.0    7e-17   Brassica napus [oilseed rape]
ref|XP_010043498.1|  PREDICTED: D-xylose-proton symporter-like 3,...  88.6    8e-17   Eucalyptus grandis [rose gum]
ref|XP_005845570.1|  hypothetical protein CHLNCDRAFT_25635            85.5    9e-16   Chlorella variabilis
gb|KJB20004.1|  hypothetical protein B456_003G129000                  80.5    5e-14   Gossypium raimondii
dbj|BAH19966.1|  AT5G59250                                            74.7    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011400947.1|  D-xylose-proton symporter-like 3, chloroplastic  74.3    5e-12   Auxenochlorella protothecoides
emb|CBJ33077.1|  conserved unknown protein                            73.6    1e-11   Ectocarpus siliculosus
ref|XP_005645204.1|  hypothetical protein COCSUDRAFT_67173            70.9    7e-11   Coccomyxa subellipsoidea C-169
gb|EPS59382.1|  hypothetical protein M569_15426                       70.5    7e-11   Genlisea aurea
ref|XP_003062688.1|  major facilitator superfamily                    69.7    1e-10   Micromonas pusilla CCMP1545
ref|XP_002179486.1|  TRD4                                             67.4    9e-10   Phaeodactylum tricornutum CCAP 1055/1
gb|KIZ01781.1|  hypothetical protein MNEG_6180                        67.0    2e-09   Monoraphidium neglectum
gb|KDO66620.1|  hypothetical protein CISIN_1g008624mg                 64.7    6e-09   Citrus sinensis [apfelsine]
ref|XP_006424896.1|  hypothetical protein CICLE_v10028127mg           64.7    6e-09   
gb|KDD76485.1|  sugar transporter                                     64.3    1e-08   Helicosporidium sp. ATCC 50920
ref|XP_009036253.1|  general sugar transporter                        63.2    2e-08   Aureococcus anophagefferens
emb|CDY47336.1|  BnaCnng14730D                                        61.2    4e-08   Brassica napus [oilseed rape]
ref|XP_005708849.1|  MFS transporter, SP family, sugar:H+ symporter   62.4    5e-08   Galdieria sulphuraria
ref|XP_002501745.1|  sugar transporter                                62.0    5e-08   Micromonas commoda
ref|XP_006414919.1|  hypothetical protein EUTSA_v10026911mg           53.1    3e-06   
ref|XP_005783754.1|  hypothetical protein EMIHUDRAFT_232111           55.1    1e-05   Emiliania huxleyi CCMP1516
emb|CEF97100.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcompl...  55.1    1e-05   Ostreococcus tauri
gb|EWM26836.1|  d-xylose-proton symporter-like protein                52.8    7e-05   Nannochloropsis gaditana
ref|XP_009032417.1|  hypothetical protein AURANDRAFT_18763            52.8    8e-05   Aureococcus anophagefferens
ref|XP_009037217.1|  hypothetical protein AURANDRAFT_26890            52.0    1e-04   Aureococcus anophagefferens
ref|XP_005831465.1|  hypothetical protein GUITHDRAFT_109605           50.1    6e-04   Guillardia theta CCMP2712
ref|WP_034274700.1|  major facilitator transporter                    49.7    7e-04   
gb|KJF15727.1|  putative metabolite transport protein CsbC            48.5    0.001   Acidithrix ferrooxidans



>ref|XP_011008112.1| PREDICTED: D-xylose-proton symporter-like 2 [Populus euphratica]
Length=502

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  332
            DPEQ T SS+G+ GKSSGEIG V+EPLL+G     ENYS+ + I PFLFPALGGLLYGYD
Sbjct  4    DPEQPTLSSLGKAGKSSGEIGGVEEPLLNGGIHPSENYSLASAIFPFLFPALGGLLYGYD  63

Query  333  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  512
            IG+TSCATISI+SAT SGISWYDL+SV IGLITSGSLYGALIGS LAFNIADFLGRRREL
Sbjct  64   IGSTSCATISIKSATLSGISWYDLNSVDIGLITSGSLYGALIGSVLAFNIADFLGRRREL  123

Query  513  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            +L++ LYL+G L+TA APV+ +MVIGRFV+G+GI LAMHAAPM
Sbjct  124  ILAAFLYLVGALVTALAPVFAVMVIGRFVFGIGIGLAMHAAPM  166



>gb|ABK95072.1| unknown [Populus trichocarpa]
Length=502

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  332
            DPEQ T SS+G+ GKSSGEIG V+EPLL+G     ENYS+V+ I PFLFPALGGLLYGYD
Sbjct  4    DPEQPTLSSLGKVGKSSGEIGGVEEPLLNGGIHTSENYSLVSAIFPFLFPALGGLLYGYD  63

Query  333  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  512
            IG+TSCATISI+SAT SGISWY+L+SV IGLITSGSLYGALIGS LAFNIADFLGRRREL
Sbjct  64   IGSTSCATISIKSATLSGISWYNLNSVDIGLITSGSLYGALIGSVLAFNIADFLGRRREL  123

Query  513  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            +L++ LYL+G L+TA AP + +MVIGRFV+G+GI LAMHAAPM
Sbjct  124  ILAAFLYLVGALVTALAPAFAVMVIGRFVFGIGIGLAMHAAPM  166



>ref|XP_002325479.2| hypothetical protein POPTR_0019s08330g [Populus trichocarpa]
 gb|EEE99860.2| hypothetical protein POPTR_0019s08330g [Populus trichocarpa]
Length=446

 Score =   192 bits (487),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  332
            DPEQ T SS+G+ GKSSGEIG V+EPLL+G     ENYS+ + I PFLFPALGGLLYGYD
Sbjct  4    DPEQPTLSSLGKVGKSSGEIGGVEEPLLNGGIHTSENYSLASAIFPFLFPALGGLLYGYD  63

Query  333  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  512
            IG+TSCATISI+SAT SGISWY+L+SV IGLITSGSLYGALIGS LAFNIADFLGRRREL
Sbjct  64   IGSTSCATISIKSATLSGISWYNLNSVDIGLITSGSLYGALIGSVLAFNIADFLGRRREL  123

Query  513  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            +L++ LYL+G L+TA AP + +MVIGRFV+G+GI LAMHAAPM
Sbjct  124  ILAAFLYLVGALVTALAPAFAVMVIGRFVFGIGIGLAMHAAPM  166



>gb|KDP21779.1| hypothetical protein JCGZ_00566 [Jatropha curcas]
Length=501

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 146/167 (87%), Gaps = 2/167 (1%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  320
            MATD PEQ + SS G+ GKSSGEI  V+EPLL+G+    ENYS+ A ILPFLFPALGGLL
Sbjct  1    MATD-PEQSSLSSFGKVGKSSGEIDGVEEPLLNGENSS-ENYSIAAAILPFLFPALGGLL  58

Query  321  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            YGYDIG+TSCATI+IES+T SGISWY+L+SV+IGLITSGSLYGALIGS LAFNIADFLGR
Sbjct  59   YGYDIGSTSCATINIESSTFSGISWYNLNSVEIGLITSGSLYGALIGSVLAFNIADFLGR  118

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            RREL+++++LYL+G L TA AP  VIMVIGRFV+G+GI LAMHAAPM
Sbjct  119  RRELIVAALLYLVGALATALAPDLVIMVIGRFVFGIGIGLAMHAAPM  165



>ref|XP_008376911.1| PREDICTED: D-xylose-proton symporter-like 2 [Malus domestica]
Length=501

 Score =   191 bits (484),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  332
            DPEQ   SS+G+ GKSSGEIG  QEPLL G Q + ENYS++A ILPFLFPA GGLLYGYD
Sbjct  4    DPEQHAPSSLGKVGKSSGEIGDAQEPLLEGAQ-NSENYSLIAAILPFLFPAFGGLLYGYD  62

Query  333  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  512
            IGATSCATISIESAT SG+SWY+LSSV+IGLITSGSLYGALIGS LAFNIADFLGRRREL
Sbjct  63   IGATSCATISIESATLSGVSWYNLSSVEIGLITSGSLYGALIGSLLAFNIADFLGRRREL  122

Query  513  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            +L+++LYL+GGL+TA AP   +MVIGR +YG+GI LAMHAAPM
Sbjct  123  ILAALLYLLGGLVTALAPDLPVMVIGRLIYGIGIGLAMHAAPM  165



>ref|XP_009361176.1| PREDICTED: D-xylose-proton symporter-like 2 [Pyrus x bretschneideri]
Length=501

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 143/163 (88%), Gaps = 1/163 (1%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  332
            DPEQ   SS+G+ GKSSGEIG  QEPLL G   + ENYS++A ILPFLFPA GGLLYGYD
Sbjct  4    DPEQHAPSSLGKVGKSSGEIGDAQEPLLDGAH-NSENYSLIAAILPFLFPAFGGLLYGYD  62

Query  333  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  512
            IGATSCATISIESAT SG+SWY+LSSV+IGLITSGSLYGALIGS LAFN+ADFLGRRREL
Sbjct  63   IGATSCATISIESATLSGVSWYNLSSVEIGLITSGSLYGALIGSLLAFNVADFLGRRREL  122

Query  513  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            ML+++LYL+GGL+TA AP   +MVIGRF+YG+GI LAMHAAPM
Sbjct  123  MLAALLYLLGGLVTALAPDLPVMVIGRFIYGIGIGLAMHAAPM  165



>ref|XP_002520022.1| sugar transporter, putative [Ricinus communis]
 gb|EEF42346.1| sugar transporter, putative [Ricinus communis]
Length=502

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  320
            MA  D EQ +FSS+G+ GKSSGEI   +EPLL+G     E YS++A +LPFLFPALGGLL
Sbjct  1    MAATDLEQPSFSSLGKVGKSSGEIDGAEEPLLNGGSSS-EYYSILAAVLPFLFPALGGLL  59

Query  321  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            YGYDIGATSCATI+IESATSSGISWY+L++VQ+GLITSGSLYGALIGS +AFNIADFLGR
Sbjct  60   YGYDIGATSCATITIESATSSGISWYNLNAVQLGLITSGSLYGALIGSVVAFNIADFLGR  119

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            RREL+++++LYL+G L+T  AP +V+MVIGRFVYG+GI LAMHAAPM
Sbjct  120  RRELIVAALLYLVGALVTGLAPDFVVMVIGRFVYGIGIGLAMHAAPM  166



>gb|KJB26762.1| hypothetical protein B456_004G258400 [Gossypium raimondii]
Length=395

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 145/167 (87%), Gaps = 2/167 (1%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  320
            MA+D  EQ   SS+G+ G+SSGEIGS  EPL++G     E+YS  A ILPFLFPALGGLL
Sbjct  1    MASDH-EQPGLSSLGKVGRSSGEIGSEHEPLVNGIHTS-ESYSASAAILPFLFPALGGLL  58

Query  321  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            YGYDIGATSCATISIESAT SGISWYDLSSV++GLITSGSLYGALIGS LAFNIADFLGR
Sbjct  59   YGYDIGATSCATISIESATLSGISWYDLSSVEVGLITSGSLYGALIGSVLAFNIADFLGR  118

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            RREL+++SI+YL+G L+TAFAP  V+MVIGRFVYG+GI LAMHAAPM
Sbjct  119  RRELIMASIMYLVGALVTAFAPNLVVMVIGRFVYGIGIGLAMHAAPM  165



>gb|KJB26763.1| hypothetical protein B456_004G258400 [Gossypium raimondii]
Length=460

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +3

Query  150  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
             D EQ   SS+G+ G+SSGEIGS  EPL++G     E+YS  A ILPFLFPALGGLLYGY
Sbjct  3    SDHEQPGLSSLGKVGRSSGEIGSEHEPLVNGIHTS-ESYSASAAILPFLFPALGGLLYGY  61

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATSCATISIESAT SGISWYDLSSV++GLITSGSLYGALIGS LAFNIADFLGRRRE
Sbjct  62   DIGATSCATISIESATLSGISWYDLSSVEVGLITSGSLYGALIGSVLAFNIADFLGRRRE  121

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++SI+YL+G L+TAFAP  V+MVIGRFVYG+GI LAMHAAPM
Sbjct  122  LIMASIMYLVGALVTAFAPNLVVMVIGRFVYGIGIGLAMHAAPM  165



>gb|KJB26764.1| hypothetical protein B456_004G258400 [Gossypium raimondii]
Length=501

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 145/167 (87%), Gaps = 2/167 (1%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  320
            MA+D  EQ   SS+G+ G+SSGEIGS  EPL++G     E+YS  A ILPFLFPALGGLL
Sbjct  1    MASDH-EQPGLSSLGKVGRSSGEIGSEHEPLVNGIHTS-ESYSASAAILPFLFPALGGLL  58

Query  321  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            YGYDIGATSCATISIESAT SGISWYDLSSV++GLITSGSLYGALIGS LAFNIADFLGR
Sbjct  59   YGYDIGATSCATISIESATLSGISWYDLSSVEVGLITSGSLYGALIGSVLAFNIADFLGR  118

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            RREL+++SI+YL+G L+TAFAP  V+MVIGRFVYG+GI LAMHAAPM
Sbjct  119  RRELIMASIMYLVGALVTAFAPNLVVMVIGRFVYGIGIGLAMHAAPM  165



>ref|XP_009351838.1| PREDICTED: D-xylose-proton symporter-like 2 [Pyrus x bretschneideri]
Length=501

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +3

Query  150  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
             DPEQ   SS+ + GKSSGEIG  QEPLL+G   + ENYS++A ILPFLFPALGGLLYGY
Sbjct  3    SDPEQPALSSLAKVGKSSGEIGDTQEPLLNGVH-NSENYSLIAAILPFLFPALGGLLYGY  61

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATSCATIS+ESAT SG+SWY+LSSV+IGLITSGSLYGALIGS +AFNIADFLGRRRE
Sbjct  62   DIGATSCATISVESATLSGVSWYNLSSVEIGLITSGSLYGALIGSLMAFNIADFLGRRRE  121

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L+++LYL+G L+TA AP   +MVIGR VYG+GI LAMHAAPM
Sbjct  122  LILAALLYLLGALVTAVAPNLPVMVIGRLVYGIGIGLAMHAAPM  165



>gb|KDO39946.1| hypothetical protein CISIN_1g0102391mg [Citrus sinensis]
Length=355

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 5/171 (3%)
 Frame = +3

Query  141  MATDDPEQLT--FSSIGQPGKSSGEIGSV-QEPLL-HGQQPHIENYSVVACIlpflfpal  308
            MATD PEQ     SS G+ GKSSGEIGS  +EPL+ +G +P  ENYSV A ILPFLFPAL
Sbjct  1    MATD-PEQARARLSSFGKVGKSSGEIGSADEEPLIANGIRPSPENYSVSAAILPFLFPAL  59

Query  309  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  488
            GGLLYGYDIG+TSCATISIES T SGISWYDLSSV+IGLITSGSLYGALIGS LAFNIAD
Sbjct  60   GGLLYGYDIGSTSCATISIESPTLSGISWYDLSSVEIGLITSGSLYGALIGSILAFNIAD  119

Query  489  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
             LGRRREL+L+++LYL+G L+TA AP ++IMV+GRFV+G+GI LAMHAAPM
Sbjct  120  ILGRRRELILAALLYLVGALVTALAPDFIIMVVGRFVFGIGIGLAMHAAPM  170



>gb|KDO39947.1| hypothetical protein CISIN_1g0102391mg [Citrus sinensis]
Length=381

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 5/171 (3%)
 Frame = +3

Query  141  MATDDPEQLT--FSSIGQPGKSSGEIGSV-QEPLL-HGQQPHIENYSVVACIlpflfpal  308
            MATD PEQ     SS G+ GKSSGEIGS  +EPL+ +G +P  ENYSV A ILPFLFPAL
Sbjct  1    MATD-PEQARARLSSFGKVGKSSGEIGSADEEPLIANGIRPSPENYSVSAAILPFLFPAL  59

Query  309  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  488
            GGLLYGYDIG+TSCATISIES T SGISWYDLSSV+IGLITSGSLYGALIGS LAFNIAD
Sbjct  60   GGLLYGYDIGSTSCATISIESPTLSGISWYDLSSVEIGLITSGSLYGALIGSILAFNIAD  119

Query  489  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
             LGRRREL+L+++LYL+G L+TA AP ++IMV+GRFV+G+GI LAMHAAPM
Sbjct  120  ILGRRRELILAALLYLVGALVTALAPDFIIMVVGRFVFGIGIGLAMHAAPM  170



>gb|KDO39945.1| hypothetical protein CISIN_1g0102391mg [Citrus sinensis]
Length=451

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 5/171 (3%)
 Frame = +3

Query  141  MATDDPEQLT--FSSIGQPGKSSGEIGSV-QEPLL-HGQQPHIENYSVVACIlpflfpal  308
            MATD PEQ     SS G+ GKSSGEIGS  +EPL+ +G +P  ENYSV A ILPFLFPAL
Sbjct  1    MATD-PEQARARLSSFGKVGKSSGEIGSADEEPLIANGIRPSPENYSVSAAILPFLFPAL  59

Query  309  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  488
            GGLLYGYDIG+TSCATISIES T SGISWYDLSSV+IGLITSGSLYGALIGS LAFNIAD
Sbjct  60   GGLLYGYDIGSTSCATISIESPTLSGISWYDLSSVEIGLITSGSLYGALIGSILAFNIAD  119

Query  489  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
             LGRRREL+L+++LYL+G L+TA AP ++IMV+GRFV+G+GI LAMHAAPM
Sbjct  120  ILGRRRELILAALLYLVGALVTALAPDFIIMVVGRFVFGIGIGLAMHAAPM  170



>gb|KDO39944.1| hypothetical protein CISIN_1g0102391mg, partial [Citrus sinensis]
Length=487

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 5/171 (3%)
 Frame = +3

Query  141  MATDDPEQLT--FSSIGQPGKSSGEIGSV-QEPLL-HGQQPHIENYSVVACIlpflfpal  308
            MATD PEQ     SS G+ GKSSGEIGS  +EPL+ +G +P  ENYSV A ILPFLFPAL
Sbjct  1    MATD-PEQARARLSSFGKVGKSSGEIGSADEEPLIANGIRPSPENYSVSAAILPFLFPAL  59

Query  309  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  488
            GGLLYGYDIG+TSCATISIES T SGISWYDLSSV+IGLITSGSLYGALIGS LAFNIAD
Sbjct  60   GGLLYGYDIGSTSCATISIESPTLSGISWYDLSSVEIGLITSGSLYGALIGSILAFNIAD  119

Query  489  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
             LGRRREL+L+++LYL+G L+TA AP ++IMV+GRFV+G+GI LAMHAAPM
Sbjct  120  ILGRRRELILAALLYLVGALVTALAPDFIIMVVGRFVFGIGIGLAMHAAPM  170



>ref|XP_008234574.1| PREDICTED: D-xylose-proton symporter-like 2 [Prunus mume]
Length=500

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 140/164 (85%), Gaps = 2/164 (1%)
 Frame = +3

Query  150  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
             DPEQ   SS+ Q G SSGE+G  QEPLL G   + ENYSV+A ILPFLFPALGGLLYGY
Sbjct  3    SDPEQPRLSSL-QKGGSSGELGDAQEPLLSGVH-NSENYSVLAAILPFLFPALGGLLYGY  60

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATSCATIS+ES TSSGISWY+LSSV+IGLITSGSLYGALIGS LAFN+ADFLGRRRE
Sbjct  61   DIGATSCATISVESPTSSGISWYNLSSVEIGLITSGSLYGALIGSLLAFNVADFLGRRRE  120

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++ILYL+G L+TA AP   +MVIGRFV+G+GI LAMHAAPM
Sbjct  121  LISAAILYLLGALVTALAPDLPVMVIGRFVFGIGIGLAMHAAPM  164



>ref|XP_006347568.1| PREDICTED: D-xylose-proton symporter-like 2-like [Solanum tuberosum]
Length=503

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 141/168 (84%), Gaps = 2/168 (1%)
 Frame = +3

Query  141  MAT-DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  317
            MAT +DPEQL  SSI +   SS EI  V+EPLL G+  H ENYS+ + +LPFLFPA GGL
Sbjct  1    MATANDPEQLIVSSIDKGENSSSEINIVREPLLKGEH-HAENYSIRSAVLPFLFPAFGGL  59

Query  318  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  497
            LYGYDIGATS ATISIESA+ SGISWYDLSSVQ GLITSGSLYGALIGS +AF IAD+LG
Sbjct  60   LYGYDIGATSSATISIESASLSGISWYDLSSVQTGLITSGSLYGALIGSAVAFQIADWLG  119

Query  498  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            RRREL++S++ Y +G L+TAFAPVYVI+VIGR +YGVGI LAMHAAPM
Sbjct  120  RRRELIVSALFYFLGALVTAFAPVYVILVIGRLLYGVGIGLAMHAAPM  167



>ref|XP_007029560.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY10062.1| Major facilitator superfamily protein [Theobroma cacao]
Length=501

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  320
            MA+D  EQ   SS G+ GKSSGEIG+  EPL++G     ENYS  A I PFLFPALGGLL
Sbjct  1    MASDH-EQPGLSSFGKVGKSSGEIGAEHEPLINGIHSS-ENYSASAAIFPFLFPALGGLL  58

Query  321  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            YGYDIG+TSCATISIESA+ SG+SWYDLSSV+IGLITSGSLYGALIGS LAFNIADFLGR
Sbjct  59   YGYDIGSTSCATISIESASLSGMSWYDLSSVEIGLITSGSLYGALIGSVLAFNIADFLGR  118

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            RREL+ ++I+YL+G L+TAFAP  V+MVIGR VYG+GI LAMHAAPM
Sbjct  119  RRELITAAIMYLVGALVTAFAPDLVVMVIGRLVYGIGIGLAMHAAPM  165



>ref|XP_008362818.1| PREDICTED: D-xylose-proton symporter-like 2 [Malus domestica]
Length=501

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +3

Query  150  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
             DPE+   SS+ +  KSSGEIG  QEPLL+G   + ENYS++A ILPFLFPALGGLLYGY
Sbjct  3    SDPEKPALSSLAKVRKSSGEIGDTQEPLLNGVH-NSENYSLIAAILPFLFPALGGLLYGY  61

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATSCATIS+ESAT SG+SWY+LSSV+IGLITSGSLYGALIGS +AFNIADFLGRRRE
Sbjct  62   DIGATSCATISVESATLSGVSWYNLSSVEIGLITSGSLYGALIGSLMAFNIADFLGRRRE  121

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L+++LYL+G L+TA AP   +MVIGR VYG+GI LAMHAAPM
Sbjct  122  LILAALLYLLGALVTAVAPDLPVMVIGRLVYGIGIGLAMHAAPM  165



>ref|NP_001288106.1| D-xylose-proton symporter-like 2-like [Solanum lycopersicum]
 dbj|BAO96239.1| vacuolar glucose transporter 2 [Solanum lycopersicum]
Length=503

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 140/168 (83%), Gaps = 2/168 (1%)
 Frame = +3

Query  141  MAT-DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  317
            MAT  D EQL  SSI +   SS EI  V+EPLL G+  H ENYSV++ +LPFLFPA GGL
Sbjct  1    MATAHDTEQLIVSSIDKGENSSSEINIVREPLLEGEH-HAENYSVLSAVLPFLFPAFGGL  59

Query  318  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  497
            LYGYDIGATS ATISIESAT SGISWYDLSSVQ GLITSGSLYGALIGS +AF IAD+LG
Sbjct  60   LYGYDIGATSSATISIESATLSGISWYDLSSVQTGLITSGSLYGALIGSAVAFQIADWLG  119

Query  498  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            RRREL++S++ Y +G L+TAFAPVYVI+VIGR +YGVGI LAMHAAPM
Sbjct  120  RRRELIVSALFYFLGALVTAFAPVYVILVIGRLLYGVGIGLAMHAAPM  167



>ref|XP_006443190.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
 gb|ESR56430.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
Length=451

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 146/171 (85%), Gaps = 5/171 (3%)
 Frame = +3

Query  141  MATDDPEQLT--FSSIGQPGKSSGEIGSV-QEPLL-HGQQPHIENYSVVACIlpflfpal  308
            MATD PEQ     SS G+ GKSSGEIGS  +EPL+ +G +P  ENYSV A ILPFLFPAL
Sbjct  1    MATD-PEQARARLSSFGKVGKSSGEIGSADEEPLIANGIRPSPENYSVSAAILPFLFPAL  59

Query  309  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  488
            GGLLYGYDIG+TSCATISIES T SGISWY LSSV+IGLITSGSLYGALIGS LAFNIAD
Sbjct  60   GGLLYGYDIGSTSCATISIESPTLSGISWYGLSSVEIGLITSGSLYGALIGSILAFNIAD  119

Query  489  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
             LGRRREL+L+++LYL+G L+TA AP ++IMV+GRFV+G+GI LAMHAAPM
Sbjct  120  ILGRRRELILAALLYLVGALVTALAPDFIIMVVGRFVFGIGIGLAMHAAPM  170



>ref|XP_010063233.1| PREDICTED: D-xylose-proton symporter-like 2 [Eucalyptus grandis]
 gb|KCW90943.1| hypothetical protein EUGRSUZ_A02968 [Eucalyptus grandis]
Length=503

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIG-SVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
            DPE+ T SS+ + GKSSGEIG + QEPL++G     ++YSV A +LPFLFPALGGLLYGY
Sbjct  4    DPERPTRSSLAKVGKSSGEIGDATQEPLINGNGGIPDSYSVAAAVLPFLFPALGGLLYGY  63

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATSCATIS+ESAT SGISWYDLSS+QIGLITSGSLYGALIGS LAF+IADF+GRRRE
Sbjct  64   DIGATSCATISVESATLSGISWYDLSSLQIGLITSGSLYGALIGSVLAFSIADFIGRRRE  123

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L+S+LYL+G LITA AP + +MV+GRFV+G+GI LAMHAAPM
Sbjct  124  LILASVLYLVGALITALAPDFAVMVVGRFVFGIGIGLAMHAAPM  167



>ref|XP_006443191.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
 ref|XP_006478911.1| PREDICTED: D-xylose-proton symporter-like 2-like [Citrus sinensis]
 gb|ESR56431.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
Length=506

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 146/171 (85%), Gaps = 5/171 (3%)
 Frame = +3

Query  141  MATDDPEQLT--FSSIGQPGKSSGEIGSV-QEPLL-HGQQPHIENYSVVACIlpflfpal  308
            MATD PEQ     SS G+ GKSSGEIGS  +EPL+ +G +P  ENYSV A ILPFLFPAL
Sbjct  1    MATD-PEQARARLSSFGKVGKSSGEIGSADEEPLIANGIRPSPENYSVSAAILPFLFPAL  59

Query  309  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  488
            GGLLYGYDIG+TSCATISIES T SGISWY LSSV+IGLITSGSLYGALIGS LAFNIAD
Sbjct  60   GGLLYGYDIGSTSCATISIESPTLSGISWYGLSSVEIGLITSGSLYGALIGSILAFNIAD  119

Query  489  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
             LGRRREL+L+++LYL+G L+TA AP ++IMV+GRFV+G+GI LAMHAAPM
Sbjct  120  ILGRRRELILAALLYLVGALVTALAPDFIIMVVGRFVFGIGIGLAMHAAPM  170



>ref|XP_004170091.1| PREDICTED: D-xylose-proton symporter-like 2-like, partial [Cucumis 
sativus]
Length=459

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +3

Query  147  TDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllyg  326
            T D  +L  SS+G+ G+SSGEI +V+EPL+  +  H EN+S  A ILPFLFPALGGLLYG
Sbjct  2    TSDHRELVLSSLGKVGQSSGEIDNVEEPLISVEFKHSENFSARAAILPFLFPALGGLLYG  61

Query  327  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  506
            YDIGATSCATIS++SA+SSGISWY+LSSV++GL+TSGSLYGALIGS LAFN+ADFLGRRR
Sbjct  62   YDIGATSCATISLQSASSSGISWYNLSSVEVGLVTSGSLYGALIGSVLAFNVADFLGRRR  121

Query  507  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            EL+LS+++YL+G +IT  AP +VI++IGR + G GI LAMHAAPM
Sbjct  122  ELILSALMYLVGAIITGLAPNFVILIIGRIISGTGIGLAMHAAPM  166



>ref|XP_007219039.1| hypothetical protein PRUPE_ppa004602mg [Prunus persica]
 gb|EMJ20238.1| hypothetical protein PRUPE_ppa004602mg [Prunus persica]
Length=500

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 139/164 (85%), Gaps = 2/164 (1%)
 Frame = +3

Query  150  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
             D EQ   SS+ Q G SS E+G  QEPLL+G   + ENYSV+A ILPFLFPALGGLLYGY
Sbjct  3    SDSEQPRLSSL-QKGGSSVELGDAQEPLLNGVH-NSENYSVLAAILPFLFPALGGLLYGY  60

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATSCATIS+ES TSSGISWY+LSSV+IGLITSGSLYGALIGS LAFN+ADFLGRRRE
Sbjct  61   DIGATSCATISVESPTSSGISWYNLSSVEIGLITSGSLYGALIGSLLAFNVADFLGRRRE  120

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++ILYL+G L+TA AP   +MVIGRFV+G+GI LAMHAAPM
Sbjct  121  LISAAILYLLGALVTALAPDLPVMVIGRFVFGIGIGLAMHAAPM  164



>ref|XP_004137173.1| PREDICTED: D-xylose-proton symporter-like 2-like [Cucumis sativus]
 gb|KGN53693.1| hypothetical protein Csa_4G106860 [Cucumis sativus]
Length=502

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +3

Query  147  TDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllyg  326
            T D  +L  SS+G+ G+SSGEI +V+EPL+  +  H EN+S  A ILPFLFPALGGLLYG
Sbjct  2    TSDHRELVLSSLGKVGQSSGEIDNVEEPLISVEFKHSENFSARAAILPFLFPALGGLLYG  61

Query  327  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  506
            YDIGATSCATIS++SA+SSGISWY+LSSV++GL+TSGSLYGALIGS LAFN+ADFLGRRR
Sbjct  62   YDIGATSCATISLQSASSSGISWYNLSSVEVGLVTSGSLYGALIGSVLAFNVADFLGRRR  121

Query  507  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            EL+LS+++YL+G +IT  AP +VI++IGR + G GI LAMHAAPM
Sbjct  122  ELILSALMYLVGAIITGLAPNFVILIIGRIISGTGIGLAMHAAPM  166



>ref|XP_009777282.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009777283.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X3 [Nicotiana 
sylvestris]
Length=498

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 137/168 (82%), Gaps = 7/168 (4%)
 Frame = +3

Query  141  MAT-DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  317
            MAT  DPEQ   S         GEI +V+EPLL G+  H ENYS+ + ILPFLFPA GGL
Sbjct  1    MATASDPEQPIVSF-----TDKGEINNVREPLLKGEH-HPENYSIRSAILPFLFPAFGGL  54

Query  318  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  497
            LYGYDIGATS ATISIESAT SGISWYDLSSVQ+GL+TSGSLYGALIGS +AF IAD+LG
Sbjct  55   LYGYDIGATSSATISIESATFSGISWYDLSSVQLGLVTSGSLYGALIGSAVAFKIADWLG  114

Query  498  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            RRREL++S++ Y +G L+TAFAPVYVIMVIGR +YGVGI LAMHAAPM
Sbjct  115  RRRELIVSALFYFVGALVTAFAPVYVIMVIGRLLYGVGIGLAMHAAPM  162



>ref|XP_011075803.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Sesamum 
indicum]
Length=502

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  150  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
             D EQ  FS   + GKSS E   ++EPLL       E++SV++ ILPFLFPA GGLLYGY
Sbjct  3    SDVEQPAFSYRAKNGKSSAETDGIEEPLLKNDSREYEHFSVLSAILPFLFPAFGGLLYGY  62

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATISI+SATSSGISWY+LS V++GLITSGSLYGALIGS LAFN+ADFLGRRRE
Sbjct  63   DIGATSSATISIKSATSSGISWYNLSPVEVGLITSGSLYGALIGSVLAFNVADFLGRRRE  122

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+LSS++YLIG L+TA AP +VIMVIGRF+YG+GI LAMHAAPM
Sbjct  123  LILSSLMYLIGALVTALAPNFVIMVIGRFIYGIGIGLAMHAAPM  166



>ref|XP_011075802.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Sesamum 
indicum]
Length=524

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 136/164 (83%), Gaps = 0/164 (0%)
 Frame = +3

Query  150  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
             D EQ  FS   + GKSS E   ++EPLL       E++SV++ ILPFLFPA GGLLYGY
Sbjct  25   SDVEQPAFSYRAKNGKSSAETDGIEEPLLKNDSREYEHFSVLSAILPFLFPAFGGLLYGY  84

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATISI+SATSSGISWY+LS V++GLITSGSLYGALIGS LAFN+ADFLGRRRE
Sbjct  85   DIGATSSATISIKSATSSGISWYNLSPVEVGLITSGSLYGALIGSVLAFNVADFLGRRRE  144

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+LSS++YLIG L+TA AP +VIMVIGRF+YG+GI LAMHAAPM
Sbjct  145  LILSSLMYLIGALVTALAPNFVIMVIGRFIYGIGIGLAMHAAPM  188



>ref|XP_009777280.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Nicotiana 
sylvestris]
Length=555

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 137/168 (82%), Gaps = 7/168 (4%)
 Frame = +3

Query  141  MAT-DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  317
            MAT  DPEQ   S         GEI +V+EPLL G+  H ENYS+ + ILPFLFPA GGL
Sbjct  58   MATASDPEQPIVSF-----TDKGEINNVREPLLKGEH-HPENYSIRSAILPFLFPAFGGL  111

Query  318  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  497
            LYGYDIGATS ATISIESAT SGISWYDLSSVQ+GL+TSGSLYGALIGS +AF IAD+LG
Sbjct  112  LYGYDIGATSSATISIESATFSGISWYDLSSVQLGLVTSGSLYGALIGSAVAFKIADWLG  171

Query  498  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            RRREL++S++ Y +G L+TAFAPVYVIMVIGR +YGVGI LAMHAAPM
Sbjct  172  RRRELIVSALFYFVGALVTAFAPVYVIMVIGRLLYGVGIGLAMHAAPM  219



>ref|XP_009777281.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Nicotiana 
sylvestris]
Length=508

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 134/164 (82%), Gaps = 6/164 (4%)
 Frame = +3

Query  150  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
             DPEQ   S         GEI +V+EPLL G+  H ENYS+ + ILPFLFPA GGLLYGY
Sbjct  15   SDPEQPIVSF-----TDKGEINNVREPLLKGEH-HPENYSIRSAILPFLFPAFGGLLYGY  68

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATISIESAT SGISWYDLSSVQ+GL+TSGSLYGALIGS +AF IAD+LGRRRE
Sbjct  69   DIGATSSATISIESATFSGISWYDLSSVQLGLVTSGSLYGALIGSAVAFKIADWLGRRRE  128

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L++S++ Y +G L+TAFAPVYVIMVIGR +YGVGI LAMHAAPM
Sbjct  129  LIVSALFYFVGALVTAFAPVYVIMVIGRLLYGVGIGLAMHAAPM  172



>ref|XP_008455657.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Cucumis 
melo]
Length=502

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  332
            D      SS+G+ G+SSGEI +V+EPL+  +  + EN+S  A ILPFLFPALGGLLYGYD
Sbjct  4    DHRHPVLSSLGKVGQSSGEIDNVEEPLVSVEFKNSENFSARAAILPFLFPALGGLLYGYD  63

Query  333  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  512
            IGATSCATIS++SA+SSGISWY+LSSV++GL+TSGSLYGALIGS LAFN+ADFLGRRREL
Sbjct  64   IGATSCATISLQSASSSGISWYNLSSVEVGLVTSGSLYGALIGSVLAFNVADFLGRRREL  123

Query  513  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            +LS+++YL+G +IT  AP + I++IGRF+ G GI LAMHAAPM
Sbjct  124  ILSALMYLVGAIITGLAPNFAILIIGRFISGTGIGLAMHAAPM  166



>ref|XP_004505609.1| PREDICTED: D-xylose-proton symporter-like 2-like [Cicer arietinum]
Length=502

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  320
            MA+D  +Q   SS  + GKSS E  S +EPLL+G +   ENYS+ A ILPFLFPA GGLL
Sbjct  1    MASDPEQQPPLSSFSKEGKSSREDRSAREPLLNGVRGS-ENYSISAAILPFLFPAFGGLL  59

Query  321  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            +GYDIGATS ATISI+S + SGI+WYDL SV+IGL+TSGSLYGALIGS LAFNIADFLGR
Sbjct  60   FGYDIGATSSATISIQSPSQSGITWYDLGSVEIGLLTSGSLYGALIGSLLAFNIADFLGR  119

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            RREL+++S+LYL+G LITA AP Y I+V+GR V+G+GI LAMHAAPM
Sbjct  120  RRELIVASLLYLVGALITALAPNYPILVVGRLVFGIGIGLAMHAAPM  166



>ref|XP_003607412.1| D-xylose-proton symporter-like protein [Medicago truncatula]
 ref|XP_003607415.1| D-xylose-proton symporter-like protein [Medicago truncatula]
 gb|AES89609.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=501

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 139/164 (85%), Gaps = 3/164 (2%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllygy  329
            DPEQ   SS  Q GKSS E+ S +EPLL+G   H+ ++YS+ A ILPFLFPA GGLL+GY
Sbjct  4    DPEQPPLSSFSQEGKSSTEVRSEREPLLNGI--HVPQDYSLSAAILPFLFPAFGGLLFGY  61

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATISI+S++ SGI+WYDL +V+IGL+TSGSLYGALIGS LAFNIADFLGRRRE
Sbjct  62   DIGATSSATISIQSSSLSGITWYDLDAVEIGLLTSGSLYGALIGSVLAFNIADFLGRRRE  121

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L++++++YL+G LITAFAP + ++VIGR V+G+GI LAMHAAPM
Sbjct  122  LLVAALMYLVGALITAFAPNFPLLVIGRLVFGIGIGLAMHAAPM  165



>gb|AFK39030.1| unknown [Medicago truncatula]
Length=501

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 139/164 (85%), Gaps = 3/164 (2%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllygy  329
            DPEQ   SS  Q GKSS E+ S +EPLL+G   H+ ++YS+ A ILPFLFPA GGLL+GY
Sbjct  4    DPEQPPLSSFSQEGKSSTEVRSEREPLLNGI--HVPQDYSLSAAILPFLFPAFGGLLFGY  61

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATISI+S++ SGI+WYDL +V+IGL+TSGSLYGALIGS LAFNIADFLGRRRE
Sbjct  62   DIGATSSATISIQSSSLSGITWYDLDAVEIGLLTSGSLYGALIGSVLAFNIADFLGRRRE  121

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L++++++YL+G LITAFAP + +++IGR V+G+GI LAMHAAPM
Sbjct  122  LLVAALMYLVGALITAFAPNFPLLLIGRLVFGIGIGLAMHAAPM  165



>ref|XP_003537722.1| PREDICTED: D-xylose-proton symporter-like 2-like isoform X1 [Glycine 
max]
Length=501

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 134/164 (82%), Gaps = 1/164 (1%)
 Frame = +3

Query  150  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
             DPEQ   SS  +  +S GEIGS  EPLL+G     E+YSV A ILPFLFPALGGLL+GY
Sbjct  3    SDPEQPAHSSFAKEARSGGEIGSAIEPLLNGVHDS-ESYSVSAAILPFLFPALGGLLFGY  61

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATISI+S T SG+SWY LSSV+IGL+TSGSLYGALIGS LAFN+ADFLGRR+E
Sbjct  62   DIGATSSATISIQSPTLSGVSWYKLSSVEIGLLTSGSLYGALIGSLLAFNVADFLGRRKE  121

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++++YL+G L+TA AP + ++V+GR V+G+GI LAMHAAPM
Sbjct  122  LIGAAVVYLVGALVTALAPNFPVLVLGRLVFGIGIGLAMHAAPM  165



>gb|KHN05527.1| D-xylose-proton symporter-like 2 [Glycine soja]
Length=501

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 134/164 (82%), Gaps = 1/164 (1%)
 Frame = +3

Query  150  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
             DPEQ   SS  +  +S GEIGS  EPLL+G     E+YSV A ILPFLFPALGGLL+GY
Sbjct  3    SDPEQPAHSSFAKEARSGGEIGSAIEPLLNGVHDS-ESYSVSAAILPFLFPALGGLLFGY  61

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATISI+S T SG+SWY LSSV+IGL+TSGSLYGALIGS LAFN+ADFLGRR+E
Sbjct  62   DIGATSSATISIQSPTLSGVSWYKLSSVEIGLLTSGSLYGALIGSLLAFNVADFLGRRKE  121

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++++YL+G L+TA AP + ++V+GR V+G+GI LAMHAAPM
Sbjct  122  LIGAAVVYLVGALVTALAPNFPVLVLGRLVFGIGIGLAMHAAPM  165



>ref|XP_007131530.1| hypothetical protein PHAVU_011G020700g [Phaseolus vulgaris]
 gb|ESW03524.1| hypothetical protein PHAVU_011G020700g [Phaseolus vulgaris]
Length=498

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 135/164 (82%), Gaps = 4/164 (2%)
 Frame = +3

Query  150  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
             DPEQ T +   + G SSGEIGS +EPLL G   H E+YS+ A ILPFLFPA GGLL+GY
Sbjct  3    SDPEQPTSA---KEGSSSGEIGSAREPLLIGVH-HSESYSLSAAILPFLFPAFGGLLFGY  58

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATISI+S T SG+SWY LSS++IGL+TSGSLYGALIGS LAFN+ADFLGRRRE
Sbjct  59   DIGATSSATISIQSPTLSGVSWYQLSSIEIGLLTSGSLYGALIGSLLAFNVADFLGRRRE  118

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY +G L+TAFAP + ++V+GR ++G GI LAMHAAPM
Sbjct  119  LIVAALLYFVGALVTAFAPNFSVLVLGRLIFGTGIGLAMHAAPM  162



>ref|XP_010495236.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=259

 Score =   159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 137/165 (83%), Gaps = 4/165 (2%)
 Frame = +3

Query  153  DPEQLTFSSIGQP-GKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllyg  326
            DPEQ   SS+ +  GKSSGEI S +EPL+  ++ H+ ENYSVVA ILPF FPALGGLLYG
Sbjct  4    DPEQQPISSVSREVGKSSGEISSEREPLI--KENHVPENYSVVAAILPFFFPALGGLLYG  61

Query  327  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  506
            Y+IGATSCATIS++S + SGISWY+LSSV +GL+TSGSLYGAL GS +AF IAD +GRR+
Sbjct  62   YEIGATSCATISLQSPSLSGISWYNLSSVDVGLVTSGSLYGALFGSIVAFTIADVIGRRK  121

Query  507  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            EL+LS++LYLIG L+TA AP+Y +++IGR  YGV + LAMHAAPM
Sbjct  122  ELILSALLYLIGALVTALAPIYSVLIIGRVTYGVSVGLAMHAAPM  166



>gb|KDO39943.1| hypothetical protein CISIN_1g0102391mg, partial [Citrus sinensis]
Length=453

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 135/158 (85%), Gaps = 5/158 (3%)
 Frame = +3

Query  141  MATDDPEQLT--FSSIGQPGKSSGEIGSV-QEPLL-HGQQPHIENYSVVACIlpflfpal  308
            MATD PEQ     SS G+ GKSSGEIGS  +EPL+ +G +P  ENYSV A ILPFLFPAL
Sbjct  1    MATD-PEQARARLSSFGKVGKSSGEIGSADEEPLIANGIRPSPENYSVSAAILPFLFPAL  59

Query  309  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  488
            GGLLYGYDIG+TSCATISIES T SGISWYDLSSV+IGLITSGSLYGALIGS LAFNIAD
Sbjct  60   GGLLYGYDIGSTSCATISIESPTLSGISWYDLSSVEIGLITSGSLYGALIGSILAFNIAD  119

Query  489  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVY  602
             LGRRREL+L+++LYL+G L+TA AP ++IMV+GRFV+
Sbjct  120  ILGRRRELILAALLYLVGALVTALAPDFIIMVVGRFVF  157



>ref|XP_002277076.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Vitis 
vinifera]
 emb|CBI26530.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  332
            D EQ + +S+G+ GKSSGEI  +QEPL+ G     ENYSV A ILPFLFPALGGLLYGYD
Sbjct  3    DLEQPSLTSLGKVGKSSGEIDGMQEPLIDGVGSS-ENYSVAAAILPFLFPALGGLLYGYD  61

Query  333  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  512
            IGATSCA ISIES++ SGISWYDLSSVQIGL TSGSLYGALIGS LAFNIADF GRRREL
Sbjct  62   IGATSCALISIESSSLSGISWYDLSSVQIGLTTSGSLYGALIGSVLAFNIADFFGRRREL  121

Query  513  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            +L+++LYL+G L+TA AP +++MVIGRFV+G+GI L+MHAAPM
Sbjct  122  ILAALLYLVGALVTAVAPSFIVMVIGRFVFGIGIGLSMHAAPM  164



>gb|EYU43459.1| hypothetical protein MIMGU_mgv1a004913mg [Erythranthe guttata]
Length=504

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIGSVQEPLL-HGQQPHIENYSVVACIlpflfpalggllygy  329
            D E  T S   +  K SGEI +VQ+PLL + +    E +SVV+ ILPFLFPA GGLLYGY
Sbjct  4    DVESPTISFPAKNVKYSGEIDAVQQPLLENNKSTECEEFSVVSAILPFLFPAFGGLLYGY  63

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+ I+SAT SG+SWY+LSSVQ+GLITSGSLYGALIGS LA+ +ADFLGRRRE
Sbjct  64   DIGATSSATLLIQSATLSGVSWYNLSSVQVGLITSGSLYGALIGSILAYTVADFLGRRRE  123

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L LSS++Y +G  +TAFAP +V++VIGR VYG+GI LAMHAAPM
Sbjct  124  LGLSSVMYFVGATVTAFAPTFVVLVIGRVVYGIGIGLAMHAAPM  167



>ref|XP_006400240.1| hypothetical protein EUTSA_v10013319mg [Eutrema salsugineum]
 gb|ESQ41693.1| hypothetical protein EUTSA_v10013319mg [Eutrema salsugineum]
Length=502

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 139/165 (84%), Gaps = 4/165 (2%)
 Frame = +3

Query  153  DPEQLTFSSI-GQPGKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllyg  326
            DPEQ   SS+ G+ GKSSGEI + +EPL+  +  HI ENY+VV+ ILPFLFPALGGLLYG
Sbjct  4    DPEQRPTSSVFGEVGKSSGEIRTEREPLI--KDNHIPENYTVVSAILPFLFPALGGLLYG  61

Query  327  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  506
            Y+IGATSCATISI+S + SGISWY+LSSV +GL+TSGSLYGAL GS +AF+IAD +GRR+
Sbjct  62   YEIGATSCATISIQSPSLSGISWYNLSSVDVGLVTSGSLYGALFGSIVAFSIADVIGRRK  121

Query  507  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            EL+L++ L+L+G L+TA AP+Y +++IGR  YGVG+ LAMHAAPM
Sbjct  122  ELILAAFLFLVGALVTALAPIYSVLIIGRVTYGVGVGLAMHAAPM  166



>ref|XP_004307871.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=497

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 133/163 (82%), Gaps = 5/163 (3%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  332
            DPEQ   SS+ +   S    G VQ PLL+G Q   +NYSV+A +LPFLFPALGGLLYGYD
Sbjct  4    DPEQPPRSSLHEVQNS----GDVQMPLLNGGQ-FSDNYSVLAAVLPFLFPALGGLLYGYD  58

Query  333  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  512
            IGATSCATIS+ESAT SG+SWYDLSSV+IGLITSGSLYGALIGS LAFNIAD +GRR EL
Sbjct  59   IGATSCATISVESATLSGVSWYDLSSVEIGLITSGSLYGALIGSVLAFNIADIIGRRWEL  118

Query  513  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            + S+I+YLIG ++TA AP   IMVIGR V+G+GI LAMHAAPM
Sbjct  119  ISSAIVYLIGAIVTALAPDLPIMVIGRVVFGIGIGLAMHAAPM  161



>ref|XP_010671130.1| PREDICTED: D-xylose-proton symporter-like 2 [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 136/168 (81%), Gaps = 6/168 (4%)
 Frame = +3

Query  144  ATDDPEQLTFSSIGQPGKSSGE--IGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  317
            +T D +    SS G   K+SGE  +  V+ PLL+G  P  E+YS+++CI+PFLFPALGGL
Sbjct  4    STTDHQHHVLSSFG---KASGEFDLDEVERPLLNGAHPT-EDYSLLSCIVPFLFPALGGL  59

Query  318  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  497
            L+GYDIGATS AT+SI+S T SG +WYDLSSV++GLI+SGSLYGALIGS LAFN+ADFLG
Sbjct  60   LFGYDIGATSSATLSIQSPTLSGTTWYDLSSVEVGLISSGSLYGALIGSVLAFNVADFLG  119

Query  498  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            RR+EL+ ++I YL G LITA  P +VIM+IGRF++G+GI LAMHAAPM
Sbjct  120  RRKELIAAAIFYLAGALITAIGPNFVIMMIGRFIFGIGIGLAMHAAPM  167



>gb|KFK37751.1| hypothetical protein AALP_AA3G025300 [Arabis alpina]
Length=503

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSS-GEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
            D E  + SS+ Q G SS GEI SV++PL+       ENYSV+A I PFLFPALG LL+GY
Sbjct  4    DSENQSISSLSQVGDSSSGEISSVKQPLIKQNHHSPENYSVLAAIPPFLFPALGALLFGY  63

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            +IGATSCATIS++S T SGISWYDLSSV +G+ITSGSLYGALIGS +AF++AD +GRR+E
Sbjct  64   EIGATSCATISLKSPTLSGISWYDLSSVDVGIITSGSLYGALIGSIVAFSVADIIGRRKE  123

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L++ LYL+G ++TA APV+ ++++GR  YG+GI L MHAAPM
Sbjct  124  LILAAFLYLVGAIVTAIAPVFSVLIVGRVTYGIGIGLTMHAAPM  167



>ref|XP_010087486.1| D-xylose-proton symporter-like 2 [Morus notabilis]
 gb|EXB29167.1| D-xylose-proton symporter-like 2 [Morus notabilis]
Length=518

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 135/172 (78%), Gaps = 12/172 (7%)
 Frame = +3

Query  150  DDPEQLTFSSIGQPGKSSGEIGSVQEPL--------LHGQQPHIENYSVVACIlpflfpa  305
             DPEQ T SS+    KSSGEIGS+Q           ++G   + + YSV+A ILPFLFPA
Sbjct  15   SDPEQPTLSSLV---KSSGEIGSIQLLQQLQEPLLNVNGAH-NSDTYSVIAAILPFLFPA  70

Query  306  lggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIA  485
            LGGLLYGYDIGATSCATIS++SATSSG+SWY+LSSV IGLITSGSLYGALIGS LAFN++
Sbjct  71   LGGLLYGYDIGATSCATISVQSATSSGVSWYNLSSVDIGLITSGSLYGALIGSVLAFNVS  130

Query  486  DFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            DFLGRRREL+ +++ YL G +IT  A    IMVIGRFVYG+GI LAMHAAPM
Sbjct  131  DFLGRRRELISAALFYLFGAIITTVASNLAIMVIGRFVYGIGIGLAMHAAPM  182



>ref|XP_011470132.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=495

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 132/163 (81%), Gaps = 7/163 (4%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  332
            DPEQ   SS+ +        G VQ PLL+G Q   +NYSV+A +LPFLFPALGGLLYGYD
Sbjct  4    DPEQPPRSSLHENS------GDVQMPLLNGGQ-FSDNYSVLAAVLPFLFPALGGLLYGYD  56

Query  333  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  512
            IGATSCATIS+ESAT SG+SWYDLSSV+IGLITSGSLYGALIGS LAFNIAD +GRR EL
Sbjct  57   IGATSCATISVESATLSGVSWYDLSSVEIGLITSGSLYGALIGSVLAFNIADIIGRRWEL  116

Query  513  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            + S+I+YLIG ++TA AP   IMVIGR V+G+GI LAMHAAPM
Sbjct  117  ISSAIVYLIGAIVTALAPDLPIMVIGRVVFGIGIGLAMHAAPM  159



>ref|XP_010453878.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453879.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453880.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453881.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=502

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 136/165 (82%), Gaps = 4/165 (2%)
 Frame = +3

Query  153  DPEQLTFSSIGQP-GKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllyg  326
            DPEQ   SS+ +  GKSSGEI S +EPL+  ++ H+ ENYSVVA ILPF FPALGGLLYG
Sbjct  4    DPEQQPISSVSREVGKSSGEISSEREPLI--KENHVPENYSVVAAILPFFFPALGGLLYG  61

Query  327  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  506
            Y+IGATSCATIS++S + SGISWY+ SSV +GL+TSGSLYGAL GS +AF IAD +GRR+
Sbjct  62   YEIGATSCATISLQSPSLSGISWYNFSSVDVGLVTSGSLYGALFGSIVAFTIADVIGRRK  121

Query  507  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            EL+L++IL+LIG L+TA AP+Y +++IGR  YGV + LAMHAAPM
Sbjct  122  ELILAAILFLIGALVTALAPIYSVLIIGRVTYGVSVGLAMHAAPM  166



>ref|XP_010420407.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420408.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420410.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420411.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=502

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 137/165 (83%), Gaps = 4/165 (2%)
 Frame = +3

Query  153  DPEQLTFSSIGQP-GKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllyg  326
            DPEQ   SS+ +  GKSSGEI S +EPL+  ++ H+ ENYSVVA ILPF FPALGGLLYG
Sbjct  4    DPEQQPISSVSREVGKSSGEISSEREPLI--KENHVPENYSVVAAILPFFFPALGGLLYG  61

Query  327  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  506
            Y+IGATSCATIS++S + SG+SWY+LSSV +GL+TSGSLYGAL GS +AF IAD +GRR+
Sbjct  62   YEIGATSCATISLQSPSLSGVSWYNLSSVDVGLVTSGSLYGALFGSIVAFTIADVIGRRK  121

Query  507  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            EL+L+++L+LIG L+TA AP+Y +++IGR  YGV + LAMHAAPM
Sbjct  122  ELILAALLFLIGALVTALAPIYSVLIIGRVTYGVSVGLAMHAAPM  166



>ref|XP_010920045.1| PREDICTED: D-xylose-proton symporter-like 2 [Elaeis guineensis]
Length=501

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 132/166 (80%), Gaps = 4/166 (2%)
 Frame = +3

Query  144  ATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalgglly  323
            A  DPE    S + +      EI + +EPL++G   H E+YS  A ILPFLFPALG LLY
Sbjct  4    AISDPE---LSRVHRKEVKGNEIDNPREPLINGVGYH-ESYSANAAILPFLFPALGALLY  59

Query  324  gyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRR  503
            GYDIGATS ATIS+ES+T SG +WYDLSS++IGL+ SGSLYGALIGS LAFNIADFLGRR
Sbjct  60   GYDIGATSGATISLESSTLSGTTWYDLSSLEIGLVVSGSLYGALIGSVLAFNIADFLGRR  119

Query  504  RElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            REL+LSS+LYL+G L+TA AP Y +MV+GRFVYG+GI LAMHAAPM
Sbjct  120  RELILSSVLYLVGALVTALAPTYPVMVVGRFVYGIGIGLAMHAAPM  165



>ref|XP_010506301.1| PREDICTED: D-xylose-proton symporter-like 1 [Camelina sativa]
Length=502

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 134/164 (82%), Gaps = 2/164 (1%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSS-GEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
            DPE+ + SS+GQ G SS G I + +EPL+  +    ENYSV+A I PFLFPALG LL+GY
Sbjct  4    DPERQSISSVGQIGDSSSGGISAEKEPLIK-ENHSPENYSVLAAIPPFLFPALGALLFGY  62

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            +IGATSCATISIES T SGISWYDLS V +G+ITSGSLYGALIGS +AF++AD +GRR+E
Sbjct  63   EIGATSCATISIESPTLSGISWYDLSPVDVGIITSGSLYGALIGSIVAFSVADIIGRRKE  122

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L++ LYL+G ++TA APV+ +++IGR +YG+GI L MHAAPM
Sbjct  123  LILAAFLYLVGAIVTAVAPVFSVLIIGRVMYGIGIGLTMHAAPM  166



>ref|XP_009126155.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Brassica 
rapa]
Length=502

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  320
            MA D  +Q T S++ + GKSSGEI S +EPL+       ENYSVV+ I PFLFPALGGLL
Sbjct  1    MAFDPEQQPTSSALVEVGKSSGEIRSEREPLIKDNHTP-ENYSVVSAIFPFLFPALGGLL  59

Query  321  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            YGY+IGATSCATIS++S + SGISWY+LSS+ +GL+TSGSLYGAL+GS +AF IAD +GR
Sbjct  60   YGYEIGATSCATISLQSPSLSGISWYNLSSLDVGLVTSGSLYGALVGSAVAFTIADVIGR  119

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            R+EL+L+++ +L+G L T  AP+Y +++IGR  YGVG+ LAMHAAPM
Sbjct  120  RKELVLAALFFLVGALATTLAPIYSVLIIGRVTYGVGVGLAMHAAPM  166



>ref|XP_009126154.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Brassica 
rapa]
Length=505

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  320
            MA D  +Q T S++ + GKSSGEI S +EPL+       ENYSVV+ I PFLFPALGGLL
Sbjct  4    MAFDPEQQPTSSALVEVGKSSGEIRSEREPLIKDNHTP-ENYSVVSAIFPFLFPALGGLL  62

Query  321  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            YGY+IGATSCATIS++S + SGISWY+LSS+ +GL+TSGSLYGAL+GS +AF IAD +GR
Sbjct  63   YGYEIGATSCATISLQSPSLSGISWYNLSSLDVGLVTSGSLYGALVGSAVAFTIADVIGR  122

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            R+EL+L+++ +L+G L T  AP+Y +++IGR  YGVG+ LAMHAAPM
Sbjct  123  RKELVLAALFFLVGALATTLAPIYSVLIIGRVTYGVGVGLAMHAAPM  169



>ref|NP_001190323.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AED92372.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=470

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 138/169 (82%), Gaps = 4/169 (2%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQP-GKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalgg  314
            MA D  +Q   SS+ +  GKSSGEI   +EPL+  ++ H+ ENYSVVA ILPFLFPALGG
Sbjct  1    MALDPEQQQPISSVSREFGKSSGEISPEREPLI--KENHVPENYSVVAAILPFLFPALGG  58

Query  315  llygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFL  494
            LLYGY+IGATSCATIS++S + SGISWY+LSSV +GL+TSGSLYGAL GS +AF IAD +
Sbjct  59   LLYGYEIGATSCATISLQSPSLSGISWYNLSSVDVGLVTSGSLYGALFGSIVAFTIADVI  118

Query  495  GRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            GRR+EL+L+++LYL+G L+TA AP Y +++IGR +YGV + LAMHAAPM
Sbjct  119  GRRKELILAALLYLVGALVTALAPTYSVLIIGRVIYGVSVGLAMHAAPM  167



>ref|NP_850835.2| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 ref|NP_850836.2| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 sp|Q6AWX0.1|XYLL2_ARATH RecName: Full=D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AAT85724.1| At5g17010 [Arabidopsis thaliana]
 dbj|BAF00329.1| sugar transporter like protein [Arabidopsis thaliana]
 gb|AED92369.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AED92370.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=503

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 138/169 (82%), Gaps = 4/169 (2%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQP-GKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalgg  314
            MA D  +Q   SS+ +  GKSSGEI   +EPL+  ++ H+ ENYSVVA ILPFLFPALGG
Sbjct  1    MALDPEQQQPISSVSREFGKSSGEISPEREPLI--KENHVPENYSVVAAILPFLFPALGG  58

Query  315  llygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFL  494
            LLYGY+IGATSCATIS++S + SGISWY+LSSV +GL+TSGSLYGAL GS +AF IAD +
Sbjct  59   LLYGYEIGATSCATISLQSPSLSGISWYNLSSVDVGLVTSGSLYGALFGSIVAFTIADVI  118

Query  495  GRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            GRR+EL+L+++LYL+G L+TA AP Y +++IGR +YGV + LAMHAAPM
Sbjct  119  GRRKELILAALLYLVGALVTALAPTYSVLIIGRVIYGVSVGLAMHAAPM  167



>gb|KHN46451.1| D-xylose-proton symporter-like 2 [Glycine soja]
Length=497

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 131/163 (80%), Gaps = 5/163 (3%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  332
            DP Q     + +  +S GEI S +EPLL+G     E+YSV A ILPFLFPALGGLL+GYD
Sbjct  4    DPVQ----PVAKKARSGGEIVSAREPLLNGVHDS-ESYSVSAAILPFLFPALGGLLFGYD  58

Query  333  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  512
            IGATS ATISIES T SG+SWY LSSV+IGL+TSGSLYGALIGS LAFN+ADFLGRR+EL
Sbjct  59   IGATSSATISIESPTLSGVSWYKLSSVEIGLLTSGSLYGALIGSVLAFNVADFLGRRKEL  118

Query  513  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            + S+++YL+G L+TA AP + ++V+GR V+G GI LAMHAAPM
Sbjct  119  IGSAVVYLVGALVTALAPNFPVLVLGRLVFGTGIGLAMHAAPM  161



>emb|CDY38076.1| BnaC02g06970D [Brassica napus]
Length=502

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  320
            MA D  +Q T S+  + GK+SGEI S +EPL+       ENYSVV+ I PFLFPALGGLL
Sbjct  1    MAFDPEQQPTSSAFVEVGKTSGEIRSEREPLIKDNHTP-ENYSVVSAIFPFLFPALGGLL  59

Query  321  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            YGY+IGATSCATIS++S + SGISWY+LSS+ +GL+TSGSLYGAL+GS +AF+IAD +GR
Sbjct  60   YGYEIGATSCATISLQSPSLSGISWYNLSSLDVGLVTSGSLYGALVGSAVAFSIADVIGR  119

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            R+EL+L+++ +L+GGL T  AP+Y +++IGR  YGVG+ LAMHAAPM
Sbjct  120  RKELVLAALFFLVGGLATTLAPIYSVLIIGRVTYGVGVGLAMHAAPM  166



>ref|XP_003540611.1| PREDICTED: D-xylose-proton symporter-like 2-like [Glycine max]
Length=497

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 131/163 (80%), Gaps = 5/163 (3%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  332
            DP Q     + +  +S GEI S +EPLL+G     E+YSV A ILPFLFPALGGLL+GYD
Sbjct  4    DPVQ----PVAKKARSGGEIVSAREPLLNGVHDS-ESYSVSAAILPFLFPALGGLLFGYD  58

Query  333  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  512
            IGATS ATISIES T SG+SWY LSSV+IGL+TSGSLYGALIGS LAFN+ADFLGRR+EL
Sbjct  59   IGATSSATISIESPTLSGVSWYKLSSVEIGLLTSGSLYGALIGSVLAFNVADFLGRRKEL  118

Query  513  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            + S+++YL+G L+TA AP + ++V+GR V+G GI LAMHAAPM
Sbjct  119  IGSAVVYLVGALVTALAPNFPVLVLGRLVFGTGIGLAMHAAPM  161



>emb|CDY28736.1| BnaCnng06220D [Brassica napus]
Length=503

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 133/164 (81%), Gaps = 1/164 (1%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSS-GEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
            D E+ +  S+GQ G SS GEI S ++PL+       ENYSV+A I PFLFPALG LL+GY
Sbjct  4    DAEKQSIVSLGQIGDSSSGEISSEKQPLIKENHHSPENYSVLAAIPPFLFPALGALLFGY  63

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            +IGATSCATISI+S   SGISWY+LSSV +G+ITSGSLYGALIGS +AF++AD +GRR+E
Sbjct  64   EIGATSCATISIKSPKLSGISWYNLSSVDVGIITSGSLYGALIGSIVAFSVADIIGRRKE  123

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L+++LYL+G ++TA APV+ +++IGR +YG+G+ L MHAAPM
Sbjct  124  LILAALLYLVGAIVTAVAPVFYVLIIGRLMYGIGVGLTMHAAPM  167



>ref|XP_002873804.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50063.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=502

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 134/165 (81%), Gaps = 4/165 (2%)
 Frame = +3

Query  153  DPEQLTFSSIGQP-GKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllyg  326
            DPEQ   SS+ +  GKS GEI + +EPL+  ++ H  ENYSVVA ILPF FPALGGLLYG
Sbjct  4    DPEQQPISSVSREVGKSDGEISAEREPLI--KENHTPENYSVVAAILPFFFPALGGLLYG  61

Query  327  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  506
            Y+IGATSCATIS++S + SGISWY+L+SV +GL+TSGSLYGAL GS +AF IAD +GRR+
Sbjct  62   YEIGATSCATISLQSPSLSGISWYNLTSVDVGLVTSGSLYGALFGSIVAFTIADVIGRRK  121

Query  507  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            EL+L+++LYL+G L+TA AP Y +++IGR  YGV + LAMHAAPM
Sbjct  122  ELILAALLYLVGALVTALAPTYSVLIIGRVTYGVSVGLAMHAAPM  166



>ref|XP_010662115.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Vitis 
vinifera]
Length=493

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = +3

Query  180  IGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATI  359
            I + GKSSGEI  +QEPL+ G     ENYSV A ILPFLFPALGGLLYGYDIGATSCA I
Sbjct  5    ISEVGKSSGEIDGMQEPLIDGVGSS-ENYSVAAAILPFLFPALGGLLYGYDIGATSCALI  63

Query  360  SIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyli  539
            SIES++ SGISWYDLSSVQIGL TSGSLYGALIGS LAFNIADF GRRREL+L+++LYL+
Sbjct  64   SIESSSLSGISWYDLSSVQIGLTTSGSLYGALIGSVLAFNIADFFGRRRELILAALLYLV  123

Query  540  ggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            G L+TA AP +++MVIGRFV+G+GI L+MHAAPM
Sbjct  124  GALVTAVAPSFIVMVIGRFVFGIGIGLSMHAAPM  157



>emb|CDX85478.1| BnaA02g03350D [Brassica napus]
Length=505

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 130/167 (78%), Gaps = 5/167 (3%)
 Frame = +3

Query  153  DPEQL----TFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  320
            DPEQ      F  +   GK+SGEI S +EPL+       ENYSVVA I PFLFPALGGLL
Sbjct  4    DPEQQPTSSAFVELTPTGKTSGEIRSEREPLIKDNHTP-ENYSVVAAIFPFLFPALGGLL  62

Query  321  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            YGY+IGATSCATIS++S + SGISWY+LSS+ +GL+TSGSLYGAL+GS +AF IAD +GR
Sbjct  63   YGYEIGATSCATISLQSPSLSGISWYNLSSLDVGLVTSGSLYGALVGSAVAFTIADVIGR  122

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            R+EL+L+++ +L+G L T  AP+Y +++IGR  YGVG+ LAMHAAPM
Sbjct  123  RKELVLAALFFLVGALATTLAPIYSVLIIGRVTYGVGVGLAMHAAPM  169



>ref|XP_006287575.1| hypothetical protein CARUB_v10000784mg [Capsella rubella]
 gb|EOA20473.1| hypothetical protein CARUB_v10000784mg [Capsella rubella]
Length=502

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 134/164 (82%), Gaps = 2/164 (1%)
 Frame = +3

Query  153  DPEQLTFSSIGQP-GKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
            DPEQ   +S+ +  GKSSGEI + +EPL+  +    ENYS VA +LPF FPALGGLLYGY
Sbjct  4    DPEQQPITSVSREVGKSSGEISAEREPLIK-ENHDPENYSAVAAVLPFFFPALGGLLYGY  62

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            +IGATSCATIS++S + SGISWY+LS V +GL+TSGSLYGAL+GS +AF IAD +GRR+E
Sbjct  63   EIGATSCATISLQSPSLSGISWYNLSPVDVGLVTSGSLYGALLGSIVAFTIADVIGRRKE  122

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L+++LYL+G L+TA +P+Y +++IGR +YGV + LAMHAAPM
Sbjct  123  LILAALLYLVGALVTALSPIYSVLIIGRIIYGVSVGLAMHAAPM  166



>ref|XP_010558647.1| PREDICTED: D-xylose-proton symporter-like 2 [Tarenaya hassleriana]
 ref|XP_010558648.1| PREDICTED: D-xylose-proton symporter-like 2 [Tarenaya hassleriana]
Length=501

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 138/164 (84%), Gaps = 1/164 (1%)
 Frame = +3

Query  150  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
             DPEQ +  S+ Q GKSSGEI S +EPL+  +    ENYSVVA +LPFLFPALGGLLYGY
Sbjct  3    SDPEQPSLPSLVQVGKSSGEISSEREPLIK-ESYSSENYSVVAAVLPFLFPALGGLLYGY  61

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATSCATISI+S T SGISWY+LSSV IGLITSGSLYGALIGS +AF +ADFLGRR+E
Sbjct  62   DIGATSCATISIKSPTLSGISWYNLSSVDIGLITSGSLYGALIGSIVAFTVADFLGRRKE  121

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L++ ++L+G L+TA APV+ I+VIGR +YG+GI LAMHAAP+
Sbjct  122  LILAACVFLVGALVTALAPVFFILVIGRIIYGIGIGLAMHAAPI  165



>ref|XP_009613870.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2 [Nicotiana tomentosiformis]
Length=462

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATISIESAT SGISWYDLSSVQ+GL+TSGSLYGALIGS +AF IAD+LGRRRE
Sbjct  23   DIGATSSATISIESATFSGISWYDLSSVQLGLVTSGSLYGALIGSAVAFQIADWLGRRRE  82

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L++S++ Y +G L+TAFAPVYVIMVIGR +YGVGI LAMHAAPM
Sbjct  83   LIVSALFYFVGALVTAFAPVYVIMVIGRLLYGVGIGLAMHAAPM  126



>ref|XP_002884358.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60617.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSS-GEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
            DPE  + SS+GQ G SS GEI + +EPL+  +    ENYSV+A I PFLFPALG LL+GY
Sbjct  4    DPENQSISSVGQVGDSSSGEINAQKEPLIK-ENHSPENYSVLAAIPPFLFPALGALLFGY  62

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            +IGATSCA +SI+S T SGI+WYDLSSV +G++TSGSLYGALIGS +AF++AD +GRR+E
Sbjct  63   EIGATSCAIMSIKSPTLSGITWYDLSSVDVGILTSGSLYGALIGSIVAFSVADTIGRRKE  122

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L++ LYL+G ++T  AP + I++IGR  YG+GI L MHAAPM
Sbjct  123  LILAAFLYLVGAIVTVVAPAFSILIIGRVTYGMGIGLTMHAAPM  166



>ref|XP_006297488.1| hypothetical protein CARUB_v10013506mg [Capsella rubella]
 gb|EOA30386.1| hypothetical protein CARUB_v10013506mg [Capsella rubella]
Length=502

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 133/164 (81%), Gaps = 2/164 (1%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSS-GEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
            DPE+ + S  GQ G SS G I + +EPL+  +    ENYSV+A I PFLFPALG LL+GY
Sbjct  4    DPERQSISFAGQIGDSSSGGISAEKEPLIK-ENHSPENYSVLAAIPPFLFPALGALLFGY  62

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            +IGATSCATISI+S T SGISWYDLSSV +G++TSGSLYGALIGS +AF++AD +GRR+E
Sbjct  63   EIGATSCATISIKSPTLSGISWYDLSSVDVGIMTSGSLYGALIGSMVAFSVADTIGRRKE  122

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L++ +YL+G ++T+ APV+ +++IGR +YG+GI L MHAAPM
Sbjct  123  LILAAFVYLVGAIVTSVAPVFSVLIIGRVLYGIGIGLTMHAAPM  166



>ref|XP_009130331.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
Length=504

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 130/168 (77%), Gaps = 1/168 (1%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQPG-KSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  317
            M  D  +Q   S  GQ G  SSGEI S ++PL+       ENYSV+A I PFLFPALG L
Sbjct  1    MGFDAEKQSIVSVEGQVGDSSSGEISSEKQPLIKENHHSPENYSVLAAIPPFLFPALGAL  60

Query  318  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  497
            L+GY+IGATSCATISI+S   SGISWY+LSSV +G+ITSGSLYGALIGS +AF+ AD +G
Sbjct  61   LFGYEIGATSCATISIKSPKLSGISWYNLSSVDVGIITSGSLYGALIGSIVAFSAADIIG  120

Query  498  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            RR+EL+L++ LYL+G ++TA APV+ +++IGR +YG+G+ L MHAAPM
Sbjct  121  RRKELILAAFLYLVGAIVTAVAPVFSVLIIGRLMYGIGVGLTMHAAPM  168



>gb|KFK25925.1| hypothetical protein AALP_AA8G181200 [Arabis alpina]
Length=504

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 138/167 (83%), Gaps = 6/167 (4%)
 Frame = +3

Query  153  DPEQLTFSS--IGQPGKSS-GEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggll  320
            DPEQ + SS    + GKSS GEI + +EPL+  ++ HI ENYSVV+ ILPFLFPALGGLL
Sbjct  4    DPEQQSTSSSDFVEVGKSSSGEISAEREPLI--KENHILENYSVVSAILPFLFPALGGLL  61

Query  321  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            YGY+IGATSCATIS++S + SG+SWY+LSS+ +GL+TSGSLYGAL GS +AF+IAD +GR
Sbjct  62   YGYEIGATSCATISLQSPSLSGVSWYNLSSLDVGLVTSGSLYGALFGSIVAFSIADVIGR  121

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            R+EL+L++ LYL+G ++TA AP+Y  ++IGR  YGVG+ LAMHAAPM
Sbjct  122  RKELILAAFLYLVGAVLTALAPIYFALIIGRVTYGVGVGLAMHAAPM  168



>ref|XP_010933397.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Elaeis 
guineensis]
Length=468

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 131/166 (79%), Gaps = 4/166 (2%)
 Frame = +3

Query  144  ATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalgglly  323
            AT DPE      + +   +  EI S  EPL++G +   E+YSV A ILPFLFPALGG LY
Sbjct  4    ATYDPE---LPMVHRKDVTEREIDSAGEPLINGDR-SCESYSVRAAILPFLFPALGGALY  59

Query  324  gyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRR  503
            GYDIGATS ATIS+ES+T SG +WY+LSS++IGL+ SGSLYGALIGS LAF IADFLGRR
Sbjct  60   GYDIGATSGATISVESSTLSGTTWYNLSSLEIGLVVSGSLYGALIGSVLAFAIADFLGRR  119

Query  504  RElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            REL+LSS+LY +G L+TA AP + +M++GRFVYG+GI LAMHAAPM
Sbjct  120  RELILSSVLYFVGALLTALAPDFPVMMVGRFVYGIGIGLAMHAAPM  165



>ref|XP_010933396.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Elaeis 
guineensis]
Length=501

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 131/166 (79%), Gaps = 4/166 (2%)
 Frame = +3

Query  144  ATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalgglly  323
            AT DPE      + +   +  EI S  EPL++G +   E+YSV A ILPFLFPALGG LY
Sbjct  4    ATYDPE---LPMVHRKDVTEREIDSAGEPLINGDR-SCESYSVRAAILPFLFPALGGALY  59

Query  324  gyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRR  503
            GYDIGATS ATIS+ES+T SG +WY+LSS++IGL+ SGSLYGALIGS LAF IADFLGRR
Sbjct  60   GYDIGATSGATISVESSTLSGTTWYNLSSLEIGLVVSGSLYGALIGSVLAFAIADFLGRR  119

Query  504  RElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            REL+LSS+LY +G L+TA AP + +M++GRFVYG+GI LAMHAAPM
Sbjct  120  RELILSSVLYFVGALLTALAPDFPVMMVGRFVYGIGIGLAMHAAPM  165



>emb|CDY43152.1| BnaA05g32340D [Brassica napus]
Length=504

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 130/168 (77%), Gaps = 1/168 (1%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQPG-KSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  317
            M  D  +Q   S  GQ G  SSGEI S ++PL+       ENYSV+A I PFLFPALG L
Sbjct  1    MGFDAEKQSIVSVEGQIGDSSSGEISSEKQPLIKENHHSPENYSVLAAIPPFLFPALGAL  60

Query  318  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  497
            L+GY+IGATSCATISI+S   SGISWY+LSSV +G+ITSGSLYGALIGS +AF++AD +G
Sbjct  61   LFGYEIGATSCATISIKSPKLSGISWYNLSSVDVGIITSGSLYGALIGSIVAFSVADIIG  120

Query  498  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
             R+EL+L++ LYL+G ++TA APV+ +++IGR +YG+G+ L MHAAPM
Sbjct  121  LRKELILAAFLYLVGAIVTAVAPVFYVLIIGRLMYGIGVGLTMHAAPM  168



>ref|NP_186959.2| vacuolar glucose transporter 1 [Arabidopsis thaliana]
 sp|Q8L6Z8.1|XYLL1_ARATH RecName: Full=D-xylose-proton symporter-like 1 [Arabidopsis thaliana]
 gb|AAM98195.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ56818.1| At3g03090 [Arabidopsis thaliana]
 gb|AEE73900.1| vacuolar glucose transporter 1 [Arabidopsis thaliana]
Length=503

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 130/165 (79%), Gaps = 3/165 (2%)
 Frame = +3

Query  153  DPEQLTFSSIGQP--GKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllyg  326
            DPE  + SS+GQ     SSG I + +EPLL  +    ENYSV+A I PFLFPALG LL+G
Sbjct  4    DPENQSISSVGQVVGDSSSGGITAEKEPLLK-ENHSPENYSVLAAIPPFLFPALGALLFG  62

Query  327  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  506
            Y+IGATSCA +S++S T SGISWYDLSSV +G+ITSGSLYGALIGS +AF++AD +GRR+
Sbjct  63   YEIGATSCAIMSLKSPTLSGISWYDLSSVDVGIITSGSLYGALIGSIVAFSVADIIGRRK  122

Query  507  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            EL+L++ LYL+G ++T  APV+ I++IGR  YG+GI L MHAAPM
Sbjct  123  ELILAAFLYLVGAIVTVVAPVFSILIIGRVTYGMGIGLTMHAAPM  167



>emb|CDP04938.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 134/174 (77%), Gaps = 10/174 (6%)
 Frame = +3

Query  150  DDPEQ--LTFSSIGQPGKSSGEIGSVQEP--LLH------GQQPHIENYSVVACIlpflf  299
            D P Q   T S + + G    + G+ +E   LLH       Q+   +NYSV+A ILPFLF
Sbjct  5    DRPHQPPTTASLLTKGGGGEIDDGAPEEEHLLLHENGEQQQQRLQSDNYSVLAAILPFLF  64

Query  300  palggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFN  479
            PALGGLLYGYDIGATS ATISI+S + SGISWYDLSSV++GLITSGSLYGAL GS LAFN
Sbjct  65   PALGGLLYGYDIGATSSATISIQSPSFSGISWYDLSSVEVGLITSGSLYGALAGSVLAFN  124

Query  480  IADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            +ADFLGRRREL+ SS+LYL+G L+TA AP +V++VIGR VYG+GI LAMHAAPM
Sbjct  125  VADFLGRRRELIFSSLLYLLGALVTALAPNFVVLVIGRLVYGIGIGLAMHAAPM  178



>gb|EPS57619.1| hypothetical protein M569_17198, partial [Genlisea aurea]
Length=304

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATSCATISI+S+  SGISWYDLSSV++G+ITSGSLYGALIGS LAFN+ADFLGRRRE
Sbjct  14   DIGATSCATISIQSSVVSGISWYDLSSVEVGVITSGSLYGALIGSILAFNVADFLGRRRE  73

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L+S +Y IG L+TA AP +V++V GRF+YG+GI LAMHAAPM
Sbjct  74   LILASSMYFIGILVTASAPNFVLLVSGRFIYGIGIGLAMHAAPM  117



>ref|XP_004309072.1| PREDICTED: D-xylose-proton symporter-like 2 [Fragaria vesca subsp. 
vesca]
Length=498

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  201  SGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATS  380
            SG+IG  ++PLL G      NYS++  I PFLFPAL GL+YGYDIGAT+CATIS+ SAT 
Sbjct  16   SGDIGGAKDPLLTGVHKISHNYSLLRAIFPFLFPALEGLVYGYDIGATACATISLGSATL  75

Query  381  SGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAF  560
            SG+SWYDLSS+QIGLI SGSL GALIGS LAFN  D LGRR EL+ S++LY IG LITA 
Sbjct  76   SGVSWYDLSSLQIGLIASGSLSGALIGSVLAFNAGDVLGRRFELIASAVLYCIGALITAL  135

Query  561  APVYVIMVIGRFVYGVGIXLAMHAAPM  641
            AP + +MVIGRFV+GVGI LAMHAAPM
Sbjct  136  APEFPVMVIGRFVFGVGIGLAMHAAPM  162



>ref|XP_010463755.1| PREDICTED: D-xylose-proton symporter-like 1 [Camelina sativa]
Length=498

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 129/167 (77%), Gaps = 5/167 (3%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  320
            M  D   Q  F  IG    SSG I + +EPL+  +    ENYSV+A I PFLFPALG LL
Sbjct  1    MGFDSERQ--FEQIGD--SSSGGISAEKEPLIK-ENHSPENYSVLAAIPPFLFPALGALL  55

Query  321  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            +GY+IGATSCATISI+S T SGISWYDLSSV +G+ITSGSLYGALIGS +AF++AD +GR
Sbjct  56   FGYEIGATSCATISIKSPTLSGISWYDLSSVDVGIITSGSLYGALIGSAVAFSVADIIGR  115

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            R+EL+L++ LYL+G ++TA APV+ +++IGR  YG+GI L MHAAPM
Sbjct  116  RKELILAAFLYLVGAIVTAVAPVFSVLIIGRVTYGIGIGLTMHAAPM  162



>ref|XP_009134719.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
Length=502

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSG-EIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllyg  326
            D E+ +   + Q G  S   + SVQEPL+  +Q H  ENYSV+A I PFLFPALG  L+G
Sbjct  4    DAEKQSIVHVEQVGDLSLIGLSSVQEPLI--KQKHTPENYSVLAAIPPFLFPALGTFLFG  61

Query  327  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  506
            Y+IGATSCATISI+S T SGISWY+LSSV +G+ITSGSLYGALIGS +AF+IAD +GRR+
Sbjct  62   YEIGATSCATISIKSPTLSGISWYNLSSVDVGIITSGSLYGALIGSIVAFSIADIIGRRK  121

Query  507  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
             L+ ++ LYLIG ++TA APV+ +++IGR VYG+G+ L MHAAPM
Sbjct  122  GLITAAFLYLIGAIVTAVAPVFPVLIIGRVVYGIGVGLTMHAAPM  166



>ref|XP_008809219.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2 [Phoenix dactylifera]
Length=502

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 129/167 (77%), Gaps = 5/167 (3%)
 Frame = +3

Query  144  ATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalgglly  323
            AT DPE      + +   +  EI S  EPL++  +   E+YSV A ILPFLFPALGG LY
Sbjct  4    ATSDPE---LPRVHRKDVTGREIDSATEPLINSDR-SCESYSVRAAILPFLFPALGGALY  59

Query  324  gyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADF-LGR  500
            GYDIGATS ATIS+ES+T SG +WYDLSS++IGL+ SGSLYGALIGS LAF +ADF + R
Sbjct  60   GYDIGATSGATISVESSTLSGTTWYDLSSLEIGLVVSGSLYGALIGSVLAFTVADFXVWR  119

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            RREL+LSS+LY +G L+TA AP + +MV+GRFVYG+GI LAMHAAPM
Sbjct  120  RRELILSSVLYFVGALLTALAPDFPVMVVGRFVYGIGIGLAMHAAPM  166



>emb|CDX92030.1| BnaC03g33320D [Brassica napus]
Length=502

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 118/141 (84%), Gaps = 3/141 (2%)
 Frame = +3

Query  222  QEPLLHGQQPHI-ENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWY  398
            QEPL+  QQ H  ENYSV+A I PFLFPALG  L+GY+IGATSCATISI+S T SGISWY
Sbjct  28   QEPLI--QQKHSPENYSVLAAIPPFLFPALGAFLFGYEIGATSCATISIKSPTLSGISWY  85

Query  399  DLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVI  578
            +LSSV +G+ITSGSLYGALIGS +AF+IAD +GRR+ L+ ++ LYL+G ++TA APV+ +
Sbjct  86   NLSSVDVGIITSGSLYGALIGSIVAFSIADIIGRRKGLITAAFLYLVGAIVTALAPVFHV  145

Query  579  MVIGRFVYGVGIXLAMHAAPM  641
            ++IGR VYG+G+ L MHAAPM
Sbjct  146  LIIGRVVYGIGVGLTMHAAPM  166



>ref|XP_003574402.1| PREDICTED: D-xylose-proton symporter-like 2 [Brachypodium distachyon]
Length=503

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  258  ENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSG  437
            E YSV A ILPF FPALGGLLYGYDIGATS ATIS++S+TSSG +WYDLSSVQ GL+ SG
Sbjct  41   EAYSVSAAILPFFFPALGGLLYGYDIGATSGATISLKSSTSSGTTWYDLSSVQTGLVVSG  100

Query  438  SLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIX  617
            SLYGALIGS +AF IADFLGRRREL+++SI YL+G L+TA AP ++IMV+GRF+YG+GI 
Sbjct  101  SLYGALIGSAMAFTIADFLGRRRELVVASISYLVGALLTAVAPNFLIMVVGRFLYGIGIG  160

Query  618  LAMHAAPM  641
            LAMHAAPM
Sbjct  161  LAMHAAPM  168



>emb|CDY49922.1| BnaCnng18320D [Brassica napus]
Length=503

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = +3

Query  153  DPEQLTFSSIGQ-PGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
            D E+ +  S+GQ    SSG I SV+EPL+       E+YSV+A I  FLFPALG LL+GY
Sbjct  4    DSEKQSIVSLGQVGDSSSGGISSVKEPLIKENHHSPEDYSVLAAIPSFLFPALGALLFGY  63

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            +IGATSCA ISI+S T SGISWY+LS V +G+ITSGSLYGALIGS +AF+IAD +GRR+E
Sbjct  64   EIGATSCAIISIKSPTLSGISWYNLSPVDVGIITSGSLYGALIGSIVAFSIADTIGRRKE  123

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L++ LYL+G ++T+ APV+ +++IGR +YGVGI L MHAAPM
Sbjct  124  LILAAFLYLVGAIVTSLAPVFSVLIIGRLMYGVGIGLTMHAAPM  167



>ref|XP_008791055.1| PREDICTED: D-xylose-proton symporter-like 2 [Phoenix dactylifera]
Length=475

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS+ES+  SG +WY+LSS++IGL+ SGSLYGALIGS LAFNIADFLGRRRE
Sbjct  36   DIGATSSATISLESSALSGTTWYNLSSLEIGLVVSGSLYGALIGSILAFNIADFLGRRRE  95

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+LSS+LYL+G LITA AP Y +MV+GRFVYG+GI LAMHAAPM
Sbjct  96   LILSSVLYLVGALITALAPSYPVMVVGRFVYGIGIGLAMHAAPM  139



>ref|XP_009119042.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
 emb|CDY23466.1| BnaC04g49940D [Brassica napus]
Length=503

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 130/164 (79%), Gaps = 1/164 (1%)
 Frame = +3

Query  153  DPEQLTFSSIGQ-PGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  329
            D E+ + +S+GQ    SSG I SV+EPL+       E+YSV+A I PFLFPALG LL+GY
Sbjct  4    DSEKQSIASLGQVGDSSSGGISSVKEPLIKENHHSPEDYSVLAAIPPFLFPALGALLFGY  63

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            +IGATSCA ISI+S T SGISWY LS V +G+ITSGSLYGALIGS +AF+IAD +GRR+E
Sbjct  64   EIGATSCAIISIKSPTLSGISWYTLSPVDVGIITSGSLYGALIGSIVAFSIADTIGRRKE  123

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L++ LYL+G ++T+ APV+ +++IGR +YGVGI L MHAAPM
Sbjct  124  LILAAFLYLVGAIVTSLAPVFSVLIIGRLMYGVGIGLTMHAAPM  167



>ref|XP_009382608.1| PREDICTED: D-xylose-proton symporter-like 2 [Musa acuminata subsp. 
malaccensis]
Length=498

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = +3

Query  198  SSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESAT  377
            +S EI + ++PL++G     E+YS  A ILPF FPALGGLLYGYDIGATS A IS++S++
Sbjct  16   TSSEIENPRQPLINGVTSS-ESYSATAAILPFFFPALGGLLYGYDIGATSGAKISLQSSS  74

Query  378  SSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTA  557
             SG +WY+LSS++IGL+ SGSLYGALIGS LAF IADFLGRRREL+LS++LY +G L+TA
Sbjct  75   LSGTTWYNLSSLEIGLVVSGSLYGALIGSALAFTIADFLGRRRELLLSAVLYFVGALLTA  134

Query  558  FAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
             AP + +MVIGRFVYG GI LAMHAAPM
Sbjct  135  LAPNFPVMVIGRFVYGTGIGLAMHAAPM  162



>ref|XP_006408343.1| hypothetical protein EUTSA_v10020565mg [Eutrema salsugineum]
 gb|ESQ49796.1| hypothetical protein EUTSA_v10020565mg [Eutrema salsugineum]
Length=502

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +3

Query  219  VQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWY  398
            V+EPL+  +    EN+SV+A I PFLFPALG LL+GY+IGATSCATISI S T SGISWY
Sbjct  27   VKEPLIK-ENHSPENFSVLAAIPPFLFPALGALLFGYEIGATSCATISIRSPTLSGISWY  85

Query  399  DLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVI  578
            +LS V +G+ITSGSLYGALIGS +AF++AD +GRR+EL+L++ +YL+G ++TA APV+ +
Sbjct  86   NLSPVDVGIITSGSLYGALIGSIVAFSVADIIGRRKELILAAFVYLVGAIVTAIAPVFSV  145

Query  579  MVIGRFVYGVGIXLAMHAAPM  641
            ++IGR +YG+GI L MHAAPM
Sbjct  146  LIIGRLMYGIGIGLTMHAAPM  166



>ref|XP_008644912.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Zea mays]
Length=518

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +3

Query  138  KMATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  317
            K    + E++  SS G    +  +    + PLL       E YSV A + PFLFPALGGL
Sbjct  16   KQGQSEHEEIHVSSGGVLAYTDDDDCESRRPLLLRTPASAECYSVSAAVFPFLFPALGGL  75

Query  318  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  497
            LYGYDIGATS ATIS++S+T SG +WY+LSSVQ GL+ SGSLYGALIGS LA+ IADFLG
Sbjct  76   LYGYDIGATSGATISLKSSTFSGTTWYNLSSVQTGLVVSGSLYGALIGSVLAYTIADFLG  135

Query  498  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            RR+EL+L+SI Y IG  +TA AP + IMV+GRF+YG+GI LAMHAAPM
Sbjct  136  RRKELILASISYFIGAFLTAVAPNFTIMVVGRFLYGIGIGLAMHAAPM  183



>dbj|BAJ88105.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  258  ENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSG  437
            E YSV A ILPF FPALGGLLYGYDIGATS ATIS++S+TSSG +WYDLSSVQ GL+ SG
Sbjct  33   EAYSVSAAILPFFFPALGGLLYGYDIGATSGATISLKSSTSSGTTWYDLSSVQTGLVVSG  92

Query  438  SLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIX  617
            SLYGALIGS  AF +ADFLGRRREL++SSI+YL+G L+TA AP ++IMV+GRF+YG+GI 
Sbjct  93   SLYGALIGSATAFTVADFLGRRRELVVSSIMYLVGALLTAVAPNFLIMVVGRFLYGIGIG  152

Query  618  LAMHAAPM  641
            LAMHAAPM
Sbjct  153  LAMHAAPM  160



>ref|XP_006662109.1| PREDICTED: D-xylose-proton symporter-like 2-like [Oryza brachyantha]
Length=500

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 126/166 (76%), Gaps = 5/166 (3%)
 Frame = +3

Query  150  DDPEQLTFSSIGQPGKSSGEIGSVQ--EPLLHGQQPHIENYSVVACIlpflfpalgglly  323
            D+P   + S+     ++ G     +  EPLL    PH E Y + A ILPFLFPALGGLLY
Sbjct  3    DEPLSNSNSTTNNKRRAEGIRPDCESTEPLLLA--PH-EPYRLSAAILPFLFPALGGLLY  59

Query  324  gyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRR  503
            GYDIGATS ATIS++S+T SG +WY+LSS+Q GL+ SGSLYGALIGS LAFNIADFLGRR
Sbjct  60   GYDIGATSGATISLKSSTFSGTTWYNLSSLQTGLVVSGSLYGALIGSILAFNIADFLGRR  119

Query  504  RElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            REL+ SS+ YLIG L+TA AP + IMV+GRF YG+GI LAMHAAPM
Sbjct  120  RELIFSSVSYLIGALLTAAAPNFPIMVVGRFFYGIGIGLAMHAAPM  165



>gb|EMS55132.1| D-xylose-proton symporter-like 2 [Triticum urartu]
Length=495

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  258  ENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSG  437
            E YSV A ILPF FPALGGLLYGYDIGATS ATIS++S TSSG +WYDLSSVQ GL+ SG
Sbjct  33   EAYSVSAAILPFFFPALGGLLYGYDIGATSGATISLKSPTSSGTAWYDLSSVQTGLVVSG  92

Query  438  SLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIX  617
            SLYGALIGS  AF IADFLGRRREL++SSI+YLIG L+TA AP ++IMV+GRF+YG+GI 
Sbjct  93   SLYGALIGSATAFTIADFLGRRRELVVSSIMYLIGALLTAVAPNFLIMVVGRFLYGIGIG  152

Query  618  LAMHAAPM  641
            LAMHAAPM
Sbjct  153  LAMHAAPM  160



>ref|XP_008644913.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Zea mays]
 gb|AFW69044.1| hypothetical protein ZEAMMB73_344214 [Zea mays]
Length=517

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 121/161 (75%), Gaps = 0/161 (0%)
 Frame = +3

Query  159  EQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIG  338
            E++  SS G    +  +    + PLL       E YSV A + PFLFPALGGLLYGYDIG
Sbjct  22   EEIHVSSGGVLAYTDDDDCESRRPLLLRTPASAECYSVSAAVFPFLFPALGGLLYGYDIG  81

Query  339  ATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElml  518
            ATS ATIS++S+T SG +WY+LSSVQ GL+ SGSLYGALIGS LA+ IADFLGRR+EL+L
Sbjct  82   ATSGATISLKSSTFSGTTWYNLSSVQTGLVVSGSLYGALIGSVLAYTIADFLGRRKELIL  141

Query  519  ssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            +SI Y IG  +TA AP + IMV+GRF+YG+GI LAMHAAPM
Sbjct  142  ASISYFIGAFLTAVAPNFTIMVVGRFLYGIGIGLAMHAAPM  182



>ref|XP_002464862.1| hypothetical protein SORBIDRAFT_01g027800 [Sorghum bicolor]
 gb|EER91860.1| hypothetical protein SORBIDRAFT_01g027800 [Sorghum bicolor]
Length=511

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = +3

Query  159  EQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIG  338
            E++  SS G    +  +    + PLL       E YS+ A + PF FPALGGLLYGYDIG
Sbjct  16   EEIHVSSGGVQAYTDDDDCENRRPLLLRAPASAECYSISAAVFPFFFPALGGLLYGYDIG  75

Query  339  ATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElml  518
            ATS ATIS++S+T SG +WY+LSSVQ GL+ SGSLYGALIGS LA+ IADFLGRR+EL+L
Sbjct  76   ATSGATISLKSSTFSGTTWYNLSSVQTGLVVSGSLYGALIGSVLAYTIADFLGRRKELIL  135

Query  519  ssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            +SI YLIG L+TA AP + IMV+GRF+YG+GI LAMHAAPM
Sbjct  136  ASISYLIGALLTAVAPNFAIMVVGRFLYGIGIGLAMHAAPM  176



>ref|NP_001065505.1| Os10g0579200 [Oryza sativa Japonica Group]
 gb|AAG46179.1|AC018727_31 putative sugar transporter protein [Oryza sativa Japonica Group]
 gb|AAP55176.1| Sugar transporter family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27342.1| Os10g0579200 [Oryza sativa Japonica Group]
 dbj|BAG95336.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67505.1| hypothetical protein OsI_34793 [Oryza sativa Indica Group]
 gb|EEE51468.1| hypothetical protein OsJ_32598 [Oryza sativa Japonica Group]
Length=502

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 117/138 (85%), Gaps = 3/138 (2%)
 Frame = +3

Query  228  PLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLS  407
            PLL    PH E+Y + A ILPFLFPALGGLLYGYDIGATS ATIS++S+T SG +WY+LS
Sbjct  33   PLLLA--PH-ESYRLSAAILPFLFPALGGLLYGYDIGATSGATISLKSSTFSGTTWYNLS  89

Query  408  SVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVI  587
            S+Q GL+ SGSLYGALIGS LAFNIADFLGRRREL+LSS+ YLIG L+TA AP + IMV+
Sbjct  90   SLQTGLVVSGSLYGALIGSILAFNIADFLGRRRELILSSVSYLIGALLTAAAPNFPIMVV  149

Query  588  GRFVYGVGIXLAMHAAPM  641
            GRF YG+GI LAMHAAPM
Sbjct  150  GRFFYGIGIGLAMHAAPM  167



>gb|EMT10196.1| D-xylose-proton symporter-like protein 2 [Aegilops tauschii]
Length=524

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +3

Query  258  ENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSG  437
            E YSV A ILPF FPALGGLLYGYDIGATS ATIS++S TSSG +WYDLSSVQ GL+ SG
Sbjct  33   EAYSVSAAILPFFFPALGGLLYGYDIGATSGATISLKSPTSSGTAWYDLSSVQTGLVVSG  92

Query  438  SLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIX  617
            SLYGALIGS  AF IADFLGRRREL++SSI+YLIG L+TA  P ++IMV+GRF+YG+GI 
Sbjct  93   SLYGALIGSATAFTIADFLGRRRELVVSSIMYLIGALLTAVTPNFLIMVVGRFLYGIGIG  152

Query  618  LAMHAAPM  641
            LAMHAAPM
Sbjct  153  LAMHAAPM  160



>emb|CDX92028.1| BnaC03g33300D [Brassica napus]
Length=480

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 115/141 (82%), Gaps = 1/141 (1%)
 Frame = +3

Query  219  VQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWY  398
            VQEPL+  Q+   ENY V+A I  FLFPALG  L+GY+IGATSCAT+SI+S T SGISWY
Sbjct  35   VQEPLIK-QKHSPENYCVLAAIPQFLFPALGAFLFGYEIGATSCATLSIKSPTLSGISWY  93

Query  399  DLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVI  578
            +LSSV +G+ITS S YGALIGS +AFN+AD +G R+EL+ +++LYL+G ++TA APV+ +
Sbjct  94   NLSSVDVGIITSCSHYGALIGSIVAFNVADIIGIRKELITAALLYLVGAIVTATAPVFPV  153

Query  579  MVIGRFVYGVGIXLAMHAAPM  641
            ++IGR VYG+G+ L MHAAPM
Sbjct  154  LIIGRVVYGIGLGLTMHAAPM  174



>ref|XP_004983521.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2-like [Setaria italica]
Length=515

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +3

Query  222  QEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYD  401
            + PLL G     E YSV A +LPFLFPALGGLLYGYDIGATS ATIS++S+  SG +WY+
Sbjct  43   RRPLLLGTPAAAECYSVPAAVLPFLFPALGGLLYGYDIGATSGATISLKSSKFSGTTWYN  102

Query  402  LSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIM  581
            LSSVQ GL+ SGSLYGALIGS LA+ IADFLGRR+EL+LSSI YLIG L+TA AP + IM
Sbjct  103  LSSVQTGLVVSGSLYGALIGSILAYTIADFLGRRKELILSSISYLIGALLTAAAPNFAIM  162

Query  582  VIGRFVYGVGIXLAMHAAPM  641
            V+GR +YG+GI LAMHAAPM
Sbjct  163  VVGRLLYGIGIGLAMHAAPM  182



>ref|XP_006854111.1| hypothetical protein AMTR_s00048p00147550 [Amborella trichopoda]
 gb|ERN15578.1| hypothetical protein AMTR_s00048p00147550 [Amborella trichopoda]
Length=505

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 126/165 (76%), Gaps = 10/165 (6%)
 Frame = +3

Query  174  SSIGQP--GKSSG-------EIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllyg  326
            S + QP  GKS+G       E  S +EPL+      +E YSV A ILPFLFPALGGLLYG
Sbjct  6    SDLEQPRDGKSNGVTVSSPSEDDSAREPLVP-VTASVEAYSVAATILPFLFPALGGLLYG  64

Query  327  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  506
            YDIGATS A+IS+ES   SG SWYDL+S ++GL+ SGSLYGALIGS LAF + +FLGRRR
Sbjct  65   YDIGATSGASISLESPELSGTSWYDLNSFEVGLVVSGSLYGALIGSILAFGVENFLGRRR  124

Query  507  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            EL++SS+LYL+G L+TA AP + ++V+GR VYG+GI +AMHAAPM
Sbjct  125  ELLVSSMLYLVGALVTALAPDFPVLVVGRLVYGLGIGMAMHAAPM  169



>ref|XP_010489652.1| PREDICTED: D-xylose-proton symporter-like 1, partial [Camelina 
sativa]
Length=469

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 92/104 (88%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            +IGATSCATISI+S T SGISWYDLSSV +G+ITSGSLYGALIGS +AF++AD +GRR+E
Sbjct  30   EIGATSCATISIKSPTLSGISWYDLSSVDVGIITSGSLYGALIGSIVAFSVADIIGRRKE  89

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L++ LYL+G ++TA APV+ +++IGR +YG+GI L MHAAPM
Sbjct  90   LILAAFLYLVGAIVTAVAPVFPVLIIGRVMYGIGIGLTMHAAPM  133



>gb|ADP37177.1| putative vacuolar glucose transporter [Vitis vinifera]
Length=453

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATSCA ISIES++ SGISWYDLSSVQIGL TSGSLYGALIGS LAFNIADF GRRRE
Sbjct  14   DIGATSCALISIESSSLSGISWYDLSSVQIGLTTSGSLYGALIGSVLAFNIADFFGRRRE  73

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L+++LYL+G L+TA AP +++MVIGRFV+G+GI L+MHAAPM
Sbjct  74   LILAALLYLVGALVTAVAPSFIVMVIGRFVFGIGIGLSMHAAPM  117



>emb|CAN72732.1| hypothetical protein VITISV_037854 [Vitis vinifera]
Length=458

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATSCA ISIES++ SGISWYDLSSVQIGL TSGSLYGALIGS LAFNIADF GRRRE
Sbjct  30   DIGATSCALISIESSSLSGISWYDLSSVQIGLTTSGSLYGALIGSVLAFNIADFFGRRRE  89

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L+++LYL+G L+TA AP +++MVIGRFV+G+GI L+MHAAPM
Sbjct  90   LILAALLYLVGALVTAVAPSFIVMVIGRFVFGIGIGLSMHAAPM  133



>ref|XP_001773171.1| predicted protein [Physcomitrella patens]
 gb|EDQ62024.1| predicted protein, partial [Physcomitrella patens]
Length=464

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS A +SI S   SG  WY+LSS+QIGL+ SGSLYGAL+GS +AFNIADFLGRR+E
Sbjct  23   DIGATSGAAVSIVSPELSGTDWYNLSSIQIGLVVSGSLYGALLGSVVAFNIADFLGRRKE  82

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            LM++S+LY+ G LIT FAP + I+VIGR ++G+GI L MHAAPM
Sbjct  83   LMVASLLYIFGSLITGFAPSFAILVIGRIIFGLGIGLTMHAAPM  126



>ref|XP_008222102.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Prunus mume]
Length=562

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 140/209 (67%), Gaps = 16/209 (8%)
 Frame = +3

Query  18   EENCFLFVGIHFSTSPMPISFPGNCSRYN*GFLPIFLELAKMATDDPEQLTFS-SIGQPG  194
            ++   LF   HF T P+  ++  +C R N G                 +L FS  +G P 
Sbjct  29   KKPVILFSHAHF-TPPLRSTY-NDCFRANYG---------TFTNHSAPRLRFSVKVGSPD  77

Query  195  KSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESA  374
             SSG+    +   L  +    E++S V+ I+PFLFPALGGLL+GYDIGATS ATIS++S 
Sbjct  78   YSSGD----EAQSLISEATQQEDFSWVSVIIPFLFPALGGLLFGYDIGATSGATISLQSP  133

Query  375  TSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliT  554
              SG +W++LS+VQ+GL+ SGSLYGAL GS L + IADFLGRRREL++S++LYL+GGLIT
Sbjct  134  ELSGTAWFNLSAVQLGLVVSGSLYGALFGSLLVYPIADFLGRRRELIISAVLYLLGGLIT  193

Query  555  AFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            A+AP   ++++GR +YG+GI +AMH AP+
Sbjct  194  AYAPSLSVLLVGRLLYGLGIGMAMHGAPL  222



>ref|XP_003563522.2| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Brachypodium 
distachyon]
Length=568

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS+ SA  SG +W++LSSVQ+GL+ SGSLYGAL GS LA+ IADFLGRR E
Sbjct  125  DIGATSGATISVHSADLSGTTWFNLSSVQLGLVASGSLYGALGGSILAYRIADFLGRRIE  184

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++ LY+ G L+T FAP +V+++IGR +YGVGI LAMH AP+
Sbjct  185  LVTAAALYISGALVTGFAPNFVVLIIGRLLYGVGIGLAMHGAPL  228



>ref|XP_010261641.1| PREDICTED: D-xylose-proton symporter-like 2, partial [Nelumbo 
nucifera]
Length=429

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +3

Query  366  ESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyligg  545
            +S+T SGI+WY+LSSV+IGLI SGSLYGALIGS LAF +ADFLGRRRELMLS++LYL+G 
Sbjct  2    QSSTLSGITWYNLSSVEIGLIVSGSLYGALIGSVLAFTVADFLGRRRELMLSALLYLVGA  61

Query  546  liTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+TA AP + +MVIGRF++G+GI LAMHAAPM
Sbjct  62   LVTALAPDFPVMVIGRFIFGIGIGLAMHAAPM  93



>gb|ABK24923.1| unknown [Picea sitchensis]
Length=521

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 115/146 (79%), Gaps = 3/146 (2%)
 Frame = +3

Query  207  EIGSVQEPLLHGQQ-PHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSS  383
             I   +EPL+  ++ P +  +S  A ILPFLFPALGG+L+GYDIGATS A++S++SA  S
Sbjct  38   NIEGTREPLISSKESPEVFTWS--ALILPFLFPALGGVLFGYDIGATSGASVSLQSAELS  95

Query  384  GISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFA  563
            G +WY+LSS+Q GL+ SGSLYGAL GS +AFN++DFLGRRREL++++ LYL G LITA A
Sbjct  96   GTTWYNLSSIQTGLVVSGSLYGALCGSLIAFNVSDFLGRRRELIVAAALYLSGALITALA  155

Query  564  PVYVIMVIGRFVYGVGIXLAMHAAPM  641
            P   ++++GR ++G GI LAMHAAP+
Sbjct  156  PGLPVLIVGRLLFGFGIGLAMHAAPL  181



>gb|EMT28553.1| D-xylose-proton symporter-like protein 3 [Aegilops tauschii]
Length=374

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS+ SA  SG +W++LSS+Q+GL+ SGSLYGAL GS LA+ IADFLGRR E
Sbjct  53   DIGATSGATISVHSAELSGTTWFNLSSLQLGLVASGSLYGALGGSILAYRIADFLGRRIE  112

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            LM ++ LY+ G L T  AP +V+++IGR +YGVGI LAMH AP+
Sbjct  113  LMTAAALYISGALTTGLAPNFVVLIIGRLLYGVGIGLAMHGAPL  156



>ref|NP_197203.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 emb|CAC01714.1| sugar transporter-like protein [Arabidopsis thaliana]
 gb|AED92371.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=440

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 130/173 (75%), Gaps = 11/173 (6%)
 Frame = +3

Query  141  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggl  317
            MA D  +Q   SS+ +  +SSGEI   +EPL+  ++ H+ ENYSVVA ILPFLFPALGGL
Sbjct  1    MALDPEQQQPISSVSR--ESSGEISPEREPLI--KENHVPENYSVVAAILPFLFPALGGL  56

Query  318  lygyDIGATSCATISIESATSSGISWYDL-----SSVQIGLITSGSLYGALIGSFLAFNI  482
            LYGY+IGATSCATIS++   +  +S+Y +     + ++   +TSGSLYGAL GS +AF I
Sbjct  57   LYGYEIGATSCATISLQEPMTL-LSYYAVPFSAVAFIKWNFMTSGSLYGALFGSIVAFTI  115

Query  483  ADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            AD +GRR+EL+L+++LYL+G L+TA AP Y +++IGR +YGV + LAMHAAPM
Sbjct  116  ADVIGRRKELILAALLYLVGALVTALAPTYSVLIIGRVIYGVSVGLAMHAAPM  168



>ref|XP_007207311.1| hypothetical protein PRUPE_ppa003611mg [Prunus persica]
 gb|EMJ08510.1| hypothetical protein PRUPE_ppa003611mg [Prunus persica]
Length=562

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 141/209 (67%), Gaps = 16/209 (8%)
 Frame = +3

Query  18   EENCFLFVGIHFSTSPMPISFPGNCSRYN*GFLPIFLELAKMATDDPEQLTFS-SIGQPG  194
            ++   LF   HF T P+  S   +C R N G    F  L+        +L FS  +G P 
Sbjct  29   KKPVILFSHAHF-TPPLR-STNNDCFRANYG---TFTNLSA------PRLRFSVKVGSPD  77

Query  195  KSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESA  374
             SSG+    +   L  +    E +S V+ I+PFLFPALGGLL+GYDIGATS ATIS++S 
Sbjct  78   HSSGD----EAQSLISEATQQEEFSWVSVIIPFLFPALGGLLFGYDIGATSGATISLQSP  133

Query  375  TSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliT  554
              SG +W++LS+VQ+GL+ SGSLYGAL GS L + IADFLGRRREL++S++LYL+GGLIT
Sbjct  134  ELSGTAWFNLSAVQLGLVVSGSLYGALFGSLLVYPIADFLGRRRELIISAVLYLLGGLIT  193

Query  555  AFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            A+AP   ++++GR +YG+GI +AMH AP+
Sbjct  194  AYAPSLSVLLVGRLLYGLGIGMAMHGAPL  222



>dbj|BAJ95036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=521

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  261  NYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGS  440
            +YS+ A ILPF+FPALGGLL+GYDIGATS ATIS+ SA  SG +W++LSSVQ+GL+ SGS
Sbjct  55   DYSLAAVILPFVFPALGGLLFGYDIGATSGATISVHSAELSGTTWFNLSSVQLGLVASGS  114

Query  441  LYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXL  620
            LYGAL GS LA+ +ADFLGRR EL+ ++ LY+ G L+T  AP +V+++IGR +YGVGI L
Sbjct  115  LYGALGGSILAYRVADFLGRRIELITAAALYISGALVTGLAPNFVVLIIGRLLYGVGIGL  174

Query  621  AMHAAPM  641
            AMH AP+
Sbjct  175  AMHGAPL  181



>ref|XP_007016339.1| Major facilitator superfamily protein isoform 4, partial [Theobroma 
cacao]
 gb|EOY33958.1| Major facilitator superfamily protein isoform 4, partial [Theobroma 
cacao]
Length=416

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SGI+W++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  118  DIGATSGATISLQSPELSGITWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  177

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY++GG +TA+AP   ++++GR +YG+GI LAMH AP+
Sbjct  178  LIIAALLYVLGGSLTAYAPDLSVLLVGRLLYGLGIGLAMHGAPL  221



>ref|XP_007016338.1| Major facilitator superfamily protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY33957.1| Major facilitator superfamily protein isoform 3, partial [Theobroma 
cacao]
Length=463

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SGI+W++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  118  DIGATSGATISLQSPELSGITWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  177

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY++GG +TA+AP   ++++GR +YG+GI LAMH AP+
Sbjct  178  LIIAALLYVLGGSLTAYAPDLSVLLVGRLLYGLGIGLAMHGAPL  221



>ref|XP_007016337.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY33956.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
Length=493

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SGI+W++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  118  DIGATSGATISLQSPELSGITWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  177

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY++GG +TA+AP   ++++GR +YG+GI LAMH AP+
Sbjct  178  LIIAALLYVLGGSLTAYAPDLSVLLVGRLLYGLGIGLAMHGAPL  221



>ref|XP_004981232.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Setaria italica]
Length=563

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++SA  SG +W++LSSVQ+GL+ SGSLYGAL GS LA+ IADFLGRR E
Sbjct  120  DIGATSGATISVQSADLSGTTWFNLSSVQLGLVASGSLYGALGGSILAYRIADFLGRRIE  179

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++ LY++G L+T FAP +V ++IGR +YG+GI LAMH AP+
Sbjct  180  LVTAAALYILGALVTGFAPNFVGLIIGRILYGIGIGLAMHGAPL  223



>ref|XP_006651969.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Oryza brachyantha]
Length=473

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS A+IS++SA  SG +W+ LSS+Q+GL+ SGSLYGAL GS LA+ IADFLGRR E
Sbjct  30   DIGATSGASISLQSAELSGTTWFSLSSIQLGLVASGSLYGALGGSILAYRIADFLGRRIE  89

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++ LY+ G L+T FAP +V+++IGR +YG+GI LAMH AP+
Sbjct  90   LVTAAALYISGALVTGFAPDFVVLIIGRLLYGLGIGLAMHGAPL  133



>ref|XP_008222111.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Prunus mume]
Length=521

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 120/154 (78%), Gaps = 4/154 (3%)
 Frame = +3

Query  180  IGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATI  359
            +G P  SSG+    +   L  +    E++S V+ I+PFLFPALGGLL+GYDIGATS ATI
Sbjct  32   VGSPDYSSGD----EAQSLISEATQQEDFSWVSVIIPFLFPALGGLLFGYDIGATSGATI  87

Query  360  SIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyli  539
            S++S   SG +W++LS+VQ+GL+ SGSLYGAL GS L + IADFLGRRREL++S++LYL+
Sbjct  88   SLQSPELSGTAWFNLSAVQLGLVVSGSLYGALFGSLLVYPIADFLGRRRELIISAVLYLL  147

Query  540  ggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            GGLITA+AP   ++++GR +YG+GI +AMH AP+
Sbjct  148  GGLITAYAPSLSVLLVGRLLYGLGIGMAMHGAPL  181



>ref|XP_007016336.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY33955.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=561

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SGI+W++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  118  DIGATSGATISLQSPELSGITWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  177

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY++GG +TA+AP   ++++GR +YG+GI LAMH AP+
Sbjct  178  LIIAALLYVLGGSLTAYAPDLSVLLVGRLLYGLGIGLAMHGAPL  221



>ref|XP_006590767.1| PREDICTED: D-xylose-proton symporter-like 2-like isoform X2 [Glycine 
max]
Length=435

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = +3

Query  360  SIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyli  539
            +++S T SG+SWY LSSV+IGL+TSGSLYGALIGS LAFN+ADFLGRR+EL+ ++++YL+
Sbjct  6    TLQSPTLSGVSWYKLSSVEIGLLTSGSLYGALIGSLLAFNVADFLGRRKELIGAAVVYLV  65

Query  540  ggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            G L+TA AP + ++V+GR V+G+GI LAMHAAPM
Sbjct  66   GALVTALAPNFPVLVLGRLVFGIGIGLAMHAAPM  99



>ref|XP_004953925.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Setaria italica]
Length=162

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++SA  SG +W++ SSVQ+GL+ SGSLYGAL GS L   IADFLGRR E
Sbjct  29   DIGATSGATISVQSADLSGTTWFNRSSVQLGLVASGSLYGALGGSILTHRIADFLGRRIE  88

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++ LY++G L+T FAP +V ++IGR +YG+GI LAMH AP+
Sbjct  89   LVTAAALYILGALVTGFAPNFVGLIIGRILYGIGIGLAMHGAPL  132



>ref|XP_011035268.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Populus euphratica]
Length=555

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++SA  SGISW++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  112  DIGATSGATLSLQSAELSGISWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  171

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +++LY+ GGL+T +AP   +++ GR +YG+GI LAMH AP+
Sbjct  172  LIAAALLYVFGGLVTGYAPGLNVLLFGRLLYGLGIGLAMHGAPL  215



>ref|XP_011035266.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Populus euphratica]
Length=557

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++SA  SGISW++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  114  DIGATSGATLSLQSAELSGISWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  173

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +++LY+ GGL+T +AP   +++ GR +YG+GI LAMH AP+
Sbjct  174  LIAAALLYVFGGLVTGYAPGLNVLLFGRLLYGLGIGLAMHGAPL  217



>ref|XP_010256836.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Nelumbo 
nucifera]
Length=568

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L F IADFLGRRRE
Sbjct  125  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVFPIADFLGRRRE  184

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L++ LY++GGLIT FAP   ++++GR +YG+GI LAMH AP+
Sbjct  185  LILAASLYILGGLITGFAPDLGVLIVGRVLYGLGIGLAMHGAPL  228



>gb|AFK37407.1| unknown [Lotus japonicus]
Length=563

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = +3

Query  213  GSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGIS  392
            G   EPL    + + E +S+ + ILPFLFPALGGLL+GYDIGATS ATIS++S   SGI+
Sbjct  82   GGKSEPLASDAK-YQEEFSLSSVILPFLFPALGGLLFGYDIGATSGATISLQSPELSGIT  140

Query  393  WYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVY  572
            W++LSS+Q+GL+ SGSLYGAL+GS LAF +ADFLGR+R+L+++++LY++GG ITA AP  
Sbjct  141  WFNLSSIQLGLVVSGSLYGALLGSILAFAVADFLGRKRQLIVAALLYILGGAITAAAPEL  200

Query  573  VIMVIGRFVYGVGIXLAMHAAPM  641
             +++ GR +YG+GI LAMH AP+
Sbjct  201  NVLLAGRLLYGLGIGLAMHGAPL  223



>ref|XP_008681531.1| PREDICTED: uncharacterized protein LOC100274077 isoform X2 [Zea 
mays]
Length=559

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG  W+ LSS+Q+GL+ SGSLYGAL GS LA+ IADFLGRR E
Sbjct  116  DIGATSGATISVQSPDLSGTDWFSLSSLQLGLVASGSLYGALGGSLLAYRIADFLGRRIE  175

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++ LY++G L+T FAP +V ++IGR +YG+GI LAMH AP+
Sbjct  176  LVTAAALYILGALVTGFAPNFVALIIGRVLYGIGIGLAMHGAPL  219



>gb|KHN32151.1| D-xylose-proton symporter-like 3, chloroplastic [Glycine soja]
Length=560

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SGISW++LS++Q+GL+ SGSLYGAL+GS +AF IADFLGR+++
Sbjct  117  DIGATSGATISLQSPELSGISWFNLSAIQLGLVVSGSLYGALLGSLVAFAIADFLGRKKQ  176

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +++LYL GG+ITA+AP   +++ GR +YG+GI LAMH AP+
Sbjct  177  LITAALLYLFGGVITAYAPELGVLLAGRLIYGLGIGLAMHGAPL  220



>ref|XP_003539594.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006592182.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X2 [Glycine max]
Length=560

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SGISW++LS++Q+GL+ SGSLYGAL+GS +AF IADFLGR+++
Sbjct  117  DIGATSGATISLQSPELSGISWFNLSAIQLGLVVSGSLYGALLGSLVAFAIADFLGRKKQ  176

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +++LYL GG+ITA+AP   +++ GR +YG+GI LAMH AP+
Sbjct  177  LITAALLYLFGGVITAYAPELGVLLAGRLIYGLGIGLAMHGAPL  220



>ref|XP_007132040.1| hypothetical protein PHAVU_011G061800g [Phaseolus vulgaris]
 gb|ESW04034.1| hypothetical protein PHAVU_011G061800g [Phaseolus vulgaris]
Length=558

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++SA  SGI+W++LS++Q+GL+ SGSLYGAL+GS LA+ IADFLGR+R+
Sbjct  115  DIGATSGATISLQSADLSGITWFNLSAIQLGLVVSGSLYGALLGSLLAYGIADFLGRKRQ  174

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +++LY+ GG++TA AP   +++ GR +YG+GI LAMH AP+
Sbjct  175  LIAAALLYIFGGVVTANAPELGVLLAGRLLYGLGIGLAMHGAPL  218



>ref|XP_009605737.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=457

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 127/189 (67%), Gaps = 22/189 (12%)
 Frame = +3

Query  87   NCSRYN*GFLPIFLELAKMATDDPEQLTFSSIG----QPGKSSGEIGSVQEPLLHGQQPH  254
             C+R N  F         MA ++  +L    IG    +   SSGE           +  +
Sbjct  37   QCTRRNCSF---------MARNNERKLPLLPIGRLRLKVSASSGE---------EAESAY  78

Query  255  IENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITS  434
            +E +S  + ILPFLFPALGGLL+GYDIGATS ATIS++SA  SG +WY+ S+VQ+GL+ S
Sbjct  79   LEEFSWSSVILPFLFPALGGLLFGYDIGATSGATISLQSAELSGTTWYNFSAVQLGLVVS  138

Query  435  GSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGI  614
            GSLYGALIGS LA+  ADFLGRRREL+++++LY +GG +TA+AP    +++GR VYG+GI
Sbjct  139  GSLYGALIGSILAYPFADFLGRRRELIIAALLYAVGGSLTAYAPGLGALLLGRLVYGLGI  198

Query  615  XLAMHAAPM  641
             LAMH AP+
Sbjct  199  GLAMHGAPL  207



>ref|XP_010907806.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Elaeis 
guineensis]
 ref|XP_010907807.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Elaeis 
guineensis]
Length=564

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS A+IS++SA  SG +W++LS+VQ+GL+ SGSLYGAL GS +A+ IAD LGRRRE
Sbjct  121  DIGATSGASISLQSAELSGTTWFNLSAVQLGLVVSGSLYGALAGSIIAYPIADLLGRRRE  180

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++ LYL+GGLIT +AP   +++IGRF+YG+GI LAMH  P+
Sbjct  181  LITAAALYLVGGLITGYAPDLFVLIIGRFLYGIGIGLAMHGGPL  224



>ref|XP_010685696.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=565

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS+VQ GL+ SGSLYGAL GS + F IADFLGRRRE
Sbjct  123  DIGATSGATISLQSPELSGTTWFNLSAVQQGLVVSGSLYGALFGSIMVFPIADFLGRRRE  182

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L++++ LY IGGL TAFAP   +++ GR +YG+GI  AMHAAP+
Sbjct  183  LLIAATLYAIGGLTTAFAPGLEVLLFGRLIYGLGIGWAMHAAPL  226



>gb|KDP42213.1| hypothetical protein JCGZ_02943 [Jatropha curcas]
Length=559

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++SA  SG +W++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGR RE
Sbjct  116  DIGATSGATISLQSAELSGTTWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRNRE  175

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++S LY++GGLITA+AP   +++ GR +YG+GI LAMH AP+
Sbjct  176  LIIASALYMLGGLITAYAPELNVLLAGRLLYGLGIGLAMHGAPL  219



>ref|XP_009605730.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=547

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 127/189 (67%), Gaps = 22/189 (12%)
 Frame = +3

Query  87   NCSRYN*GFLPIFLELAKMATDDPEQLTFSSIG----QPGKSSGEIGSVQEPLLHGQQPH  254
             C+R N  F         MA ++  +L    IG    +   SSGE           +  +
Sbjct  37   QCTRRNCSF---------MARNNERKLPLLPIGRLRLKVSASSGE---------EAESAY  78

Query  255  IENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITS  434
            +E +S  + ILPFLFPALGGLL+GYDIGATS ATIS++SA  SG +WY+ S+VQ+GL+ S
Sbjct  79   LEEFSWSSVILPFLFPALGGLLFGYDIGATSGATISLQSAELSGTTWYNFSAVQLGLVVS  138

Query  435  GSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGI  614
            GSLYGALIGS LA+  ADFLGRRREL+++++LY +GG +TA+AP    +++GR VYG+GI
Sbjct  139  GSLYGALIGSILAYPFADFLGRRRELIIAALLYAVGGSLTAYAPGLGALLLGRLVYGLGI  198

Query  615  XLAMHAAPM  641
             LAMH AP+
Sbjct  199  GLAMHGAPL  207



>gb|ACU20080.1| unknown [Glycine max]
Length=250

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SGISW+ LS++Q+GL+ SGSLYGAL+GS +AF IADFLGR+++
Sbjct  109  DIGATSGATISLQSPELSGISWFKLSAIQLGLVVSGSLYGALLGSLVAFAIADFLGRKKQ  168

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +++LYL GG+ITA+AP   +++  R +YG+GI LAMH AP+
Sbjct  169  LITAALLYLFGGVITAYAPELGVLLAERLLYGLGIGLAMHGAPL  212



>ref|XP_001760396.1| predicted protein [Physcomitrella patens]
 gb|EDQ74787.1| predicted protein [Physcomitrella patens]
Length=584

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS A +SI S   SG  WY+LSS+Q GL+ SGSLYGAL GS LAF IADFLGRR+E
Sbjct  140  DIGATSGAAVSIVSPEHSGTDWYNLSSLQTGLVVSGSLYGALAGSVLAFGIADFLGRRKE  199

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+L++ LY +G L+T FAP    +V+GR ++G+GI L+MHAAPM
Sbjct  200  LLLAAFLYSVGALVTGFAPNLAAVVVGRLIFGLGIGLSMHAAPM  243



>ref|XP_003537973.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Glycine max]
Length=552

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SGISW+ LS++Q+GL+ SGSLYGAL+GS +AF IADFLGR+++
Sbjct  109  DIGATSGATISLQSPELSGISWFKLSAIQLGLVVSGSLYGALLGSLVAFAIADFLGRKKQ  168

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +++LYL GG+ITA+AP   +++ GR +YG+GI LAMH AP+
Sbjct  169  LITAALLYLFGGVITAYAPELGVLLAGRLLYGLGIGLAMHGAPL  212



>ref|XP_006846330.1| hypothetical protein AMTR_s00012p00255880 [Amborella trichopoda]
 gb|ERN08005.1| hypothetical protein AMTR_s00012p00255880 [Amborella trichopoda]
Length=570

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 114/148 (77%), Gaps = 2/148 (1%)
 Frame = +3

Query  198  SSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESAT  377
            +SGE G + +PL+ G     E ++  + I PFLFPALGG L+GYDIGATS A+IS++SA 
Sbjct  86   ASGE-GELAKPLI-GSSTRNEAFTWSSVIFPFLFPALGGFLFGYDIGATSGASISLQSAE  143

Query  378  SSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTA  557
             SG +WY+LS++Q GL+ SGSLYGAL GS + + IADFLGRRREL++++ LY++GGLIT 
Sbjct  144  LSGTTWYNLSAIQTGLVVSGSLYGALFGSLIVYPIADFLGRRRELIVAASLYVLGGLITG  203

Query  558  FAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
             AP   +++IGR +YG+GI +AMH AP+
Sbjct  204  LAPDLAVLIIGRLIYGLGIGMAMHGAPL  231



>gb|KHN21925.1| D-xylose-proton symporter-like 3, chloroplastic [Glycine soja]
Length=552

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SGISW+ LS++Q+GL+ SGSLYGAL+GS +AF IADFLGR+++
Sbjct  109  DIGATSGATISLQSPELSGISWFKLSAIQLGLVVSGSLYGALLGSLVAFAIADFLGRKKQ  168

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +++LYL GG+ITA+AP   +++ GR +YG+GI LAMH AP+
Sbjct  169  LITAALLYLFGGVITAYAPELGVLLAGRLLYGLGIGLAMHGAPL  212



>ref|XP_004163808.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++S   SG SW++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  142  DIGATSGATLSLQSPELSGTSWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  201

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L++++ LY IG L TA++P    ++ GR +YG+GI LAMH AP+
Sbjct  202  LIIAAGLYAIGSLTTAYSPDLGFLLAGRLLYGLGIGLAMHGAPL  245



>gb|KHG28803.1| hypothetical protein F383_00413 [Gossypium arboreum]
Length=559

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS++Q+GL+ SGSLYGAL+GS L + IAD LGRRRE
Sbjct  118  DIGATSGATISLQSPELSGTTWFNLSAIQLGLVVSGSLYGALLGSLLVYPIADSLGRRRE  177

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY++GG++TAFAP   ++++GR +YG+GI LAMH AP+
Sbjct  178  LLIAALLYVLGGVLTAFAPGLSVLLVGRLLYGLGIGLAMHGAPL  221



>gb|KJB20002.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=456

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS++Q+GL+ SGSLYGAL+GS L + +AD LGRRRE
Sbjct  118  DIGATSGATISLQSPELSGTTWFNLSAIQLGLVVSGSLYGALLGSLLVYPVADSLGRRRE  177

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY++GG++TAFAP   ++++GR +YG+GI LAMH AP+
Sbjct  178  LLIAALLYVLGGVLTAFAPGLSVLLVGRLLYGLGIGLAMHGAPL  221



>gb|KJB20003.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=484

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS++Q+GL+ SGSLYGAL+GS L + +AD LGRRRE
Sbjct  118  DIGATSGATISLQSPELSGTTWFNLSAIQLGLVVSGSLYGALLGSLLVYPVADSLGRRRE  177

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY++GG++TAFAP   ++++GR +YG+GI LAMH AP+
Sbjct  178  LLIAALLYVLGGVLTAFAPGLSVLLVGRLLYGLGIGLAMHGAPL  221



>ref|XP_004294661.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=558

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 134/208 (64%), Gaps = 24/208 (12%)
 Frame = +3

Query  33   LFVGIHFSTSPMPISFPGNCSRYN*GFLPIFLELAKMAT----DDPEQLTFS-SIGQPGK  197
            LF   HF+  P P+  P  C R            AK  T       +QL FS  +G    
Sbjct  30   LFSNAHFT--PPPLRSP--CFR------------AKFGTFTNPSSSKQLRFSVKVGSQND  73

Query  198  SSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESAT  377
             S   G   + L+    P  E+YS V+ I+PF+FPALGGLL+GYDIGATS ATIS+ SA 
Sbjct  74   YSS--GDESQSLIPEASPQ-EDYSWVSVIIPFVFPALGGLLFGYDIGATSGATISLMSAE  130

Query  378  SSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTA  557
             SG SW++L++VQ+GL+ SGSLYGAL GS L + IADFLGRRREL++++ LYL+GGLIT 
Sbjct  131  LSGTSWFNLTAVQLGLVVSGSLYGALFGSLLVYPIADFLGRRRELIIAATLYLLGGLITG  190

Query  558  FAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
             AP   ++++GR +YG+GI +AMH AP+
Sbjct  191  CAPGLGVLLVGRVLYGIGIGMAMHGAPL  218



>emb|CBI16087.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SGI+W++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRR E
Sbjct  64   DIGATSGATISLQSPELSGITWFELSAVQLGLVVSGSLYGALLGSILVYPIADFLGRRGE  123

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++ILY +GGLITA AP   ++++GR +YG+GI LAMH AP+
Sbjct  124  LITAAILYALGGLITASAPELDVLLVGRLLYGLGIGLAMHGAPL  167



>gb|KJB20000.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
 gb|KJB20001.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=561

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS++Q+GL+ SGSLYGAL+GS L + +AD LGRRRE
Sbjct  118  DIGATSGATISLQSPELSGTTWFNLSAIQLGLVVSGSLYGALLGSLLVYPVADSLGRRRE  177

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY++GG++TAFAP   ++++GR +YG+GI LAMH AP+
Sbjct  178  LLIAALLYVLGGVLTAFAPGLSVLLVGRLLYGLGIGLAMHGAPL  221



>ref|XP_008457451.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Cucumis 
melo]
Length=585

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++S   SG SW++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  142  DIGATSGATLSLQSPELSGTSWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  201

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L++++ LY IG L TA++P   +++ GR +YG+GI LAMH AP+
Sbjct  202  LIIAAGLYAIGSLTTAYSPDLGVLLAGRLLYGLGIGLAMHGAPL  245



>gb|AES88921.2| sugar transporter [Medicago truncatula]
Length=493

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG++W +LSS+Q+GL+ SGSLYGAL+GS LAF IADF+GR+R+
Sbjct  113  DIGATSGATISLQSPELSGVAWSNLSSIQLGLVVSGSLYGALLGSLLAFAIADFIGRKRQ  172

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +++LY++G  ITA AP   +++ GR +YG+GI LAMH AP+
Sbjct  173  LIGAALLYVLGSAITATAPELGVLLAGRLLYGLGIGLAMHGAPL  216



>ref|XP_008777375.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Phoenix 
dactylifera]
 ref|XP_008777383.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Phoenix 
dactylifera]
Length=564

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS A+IS++SA  SG +W++LS+VQ+GL+ SGSLYGAL GS +A+ IAD LGRRRE
Sbjct  121  DIGATSGASISLQSAELSGTTWFNLSAVQLGLVVSGSLYGALAGSIIAYPIADILGRRRE  180

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++ LY++GGLIT +AP  ++++IGR +YG+GI LAMH  P+
Sbjct  181  LITAAALYVVGGLITGYAPDLLVLIIGRLLYGIGIGLAMHGGPL  224



>ref|XP_003606724.1| D-xylose-proton symporter-like protein [Medicago truncatula]
Length=485

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG++W +LSS+Q+GL+ SGSLYGAL+GS LAF IADF+GR+R+
Sbjct  113  DIGATSGATISLQSPELSGVAWSNLSSIQLGLVVSGSLYGALLGSLLAFAIADFIGRKRQ  172

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +++LY++G  ITA AP   +++ GR +YG+GI LAMH AP+
Sbjct  173  LIGAALLYVLGSAITATAPELGVLLAGRLLYGLGIGLAMHGAPL  216



>ref|XP_002280634.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Vitis 
vinifera]
 gb|ADP37178.1| putative vacuolar glucose transporter [Vitis vinifera]
Length=561

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SGI+W++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRR E
Sbjct  118  DIGATSGATISLQSPELSGITWFELSAVQLGLVVSGSLYGALLGSILVYPIADFLGRRGE  177

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++ILY +GGLITA AP   ++++GR +YG+GI LAMH AP+
Sbjct  178  LITAAILYALGGLITASAPELDVLLVGRLLYGLGIGLAMHGAPL  221



>ref|XP_004145283.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004153144.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65747.1| hypothetical protein Csa_1G524690 [Cucumis sativus]
Length=585

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++S   SG SW++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  142  DIGATSGATLSLQSPELSGTSWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  201

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L++++ LY IG L TA++P    ++ GR +YG+GI LAMH AP+
Sbjct  202  LIIAAGLYAIGSLTTAYSPDLGFLLAGRLLYGLGIGLAMHGAPL  245



>ref|XP_010106537.1| D-xylose-proton symporter-like 3 [Morus notabilis]
 gb|EXC10713.1| D-xylose-proton symporter-like 3 [Morus notabilis]
Length=500

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 120/163 (74%), Gaps = 7/163 (4%)
 Frame = +3

Query  159  EQLTFSSIG--QPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  332
             +L FS+    Q G SS E     E  L       E +S V+ ILPFLFPALGGLL+GYD
Sbjct  3    RRLRFSAKAGAQEGYSSEE-----EAALVSDAGDREEFSWVSVILPFLFPALGGLLFGYD  57

Query  333  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  512
            IGATS ATIS++S   SG +WY+LS+VQ+GL+ SGSLYGAL+G  + + IADFLGRRREL
Sbjct  58   IGATSGATISLQSPELSGTNWYNLSAVQLGLVVSGSLYGALLGCSIVYPIADFLGRRREL  117

Query  513  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            +++++LYL+GGLITA+AP   +++ GR +YG+GI LAMH AP+
Sbjct  118  IIAAVLYLLGGLITAYAPELGVLLAGRLLYGLGIGLAMHGAPL  160



>ref|XP_009779937.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Nicotiana sylvestris]
Length=462

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = +3

Query  237  HGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQ  416
            + +  ++E +S  + ILPFLFPALGGLL+GYDIGATS ATIS++SA  SG +WY+ S+VQ
Sbjct  78   NAESAYLEEFSWSSVILPFLFPALGGLLFGYDIGATSGATISLQSAELSGTTWYNFSAVQ  137

Query  417  IGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRF  596
            +GL+ SGSLYGALIGS LA+  ADFLGRRREL+++++LY  GG +TA+AP    +++GR 
Sbjct  138  LGLVVSGSLYGALIGSILAYPFADFLGRRRELIIAALLYAAGGSLTAYAPGLGALLLGRL  197

Query  597  VYGVGIXLAMHAAPM  641
            VYG+GI LAMH AP+
Sbjct  198  VYGLGIGLAMHGAPL  212



>ref|XP_010535452.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=557

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS VQ+GL+ SGSLYGAL GS L + IADFLGRRRE
Sbjct  114  DIGATSGATISLQSPELSGTAWFNLSPVQLGLVVSGSLYGALFGSLLVYGIADFLGRRRE  173

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LYL+G L+TA AP   I++ GR +YG+GI +AMH AP+
Sbjct  174  LIIAAVLYLLGSLVTACAPDLGILLFGRLLYGLGIGMAMHGAPL  217



>ref|XP_010535453.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=531

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS VQ+GL+ SGSLYGAL GS L + IADFLGRRRE
Sbjct  114  DIGATSGATISLQSPELSGTAWFNLSPVQLGLVVSGSLYGALFGSLLVYGIADFLGRRRE  173

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LYL+G L+TA AP   I++ GR +YG+GI +AMH AP+
Sbjct  174  LIIAAVLYLLGSLVTACAPDLGILLFGRLLYGLGIGMAMHGAPL  217



>ref|XP_009381068.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=557

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS A+IS++S   SG +W++LS+VQ+GL+ SGSLYGAL GS +A+  +DFLGRRRE
Sbjct  114  DIGATSGASISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALAGSLIAYPTSDFLGRRRE  173

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +S+LYL+GGL+T  AP  V+++IGR +YG+GI +AMH AP+
Sbjct  174  LITASVLYLVGGLVTGCAPDLVVLIIGRLIYGIGIGMAMHGAPL  217



>ref|XP_009779936.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Nicotiana sylvestris]
Length=552

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = +3

Query  237  HGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQ  416
            + +  ++E +S  + ILPFLFPALGGLL+GYDIGATS ATIS++SA  SG +WY+ S+VQ
Sbjct  78   NAESAYLEEFSWSSVILPFLFPALGGLLFGYDIGATSGATISLQSAELSGTTWYNFSAVQ  137

Query  417  IGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRF  596
            +GL+ SGSLYGALIGS LA+  ADFLGRRREL+++++LY  GG +TA+AP    +++GR 
Sbjct  138  LGLVVSGSLYGALIGSILAYPFADFLGRRRELIIAALLYAAGGSLTAYAPGLGALLLGRL  197

Query  597  VYGVGIXLAMHAAPM  641
            VYG+GI LAMH AP+
Sbjct  198  VYGLGIGLAMHGAPL  212



>ref|XP_008349595.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Malus 
domestica]
Length=563

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++S   SG +W++LS++Q+GL+ SGSLYGAL GS L + IADFLGRRRE
Sbjct  120  DIGATSGATLSLQSPELSGTAWFNLSAIQLGLVVSGSLYGALFGSLLVYPIADFLGRRRE  179

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +++LYL+G LITA AP   ++++GR +YG+GI +AMH AP+
Sbjct  180  LITAAVLYLLGALITATAPGLSVLLVGRVLYGLGIGMAMHGAPL  223



>ref|XP_008384924.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Malus 
domestica]
Length=563

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++S   SG +W++LS++Q+GL+ SGSLYGAL GS L + IADFLGRRRE
Sbjct  120  DIGATSGATLSLQSPELSGTAWFNLSAIQLGLVVSGSLYGALFGSLLVYPIADFLGRRRE  179

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +++LYL+G LITA AP   ++++GR +YG+GI +AMH AP+
Sbjct  180  LITAAVLYLLGALITATAPGLSVLLVGRVLYGLGIGMAMHGAPL  223



>ref|XP_009375941.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Pyrus 
x bretschneideri]
Length=563

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++S   SG +W++ S+VQ+GL+ SGSLYGAL GS L + IADFLGRRRE
Sbjct  120  DIGATSGATLSLQSPELSGTAWFNFSAVQLGLVVSGSLYGALFGSLLVYPIADFLGRRRE  179

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +++LYL+G LITA AP   ++++GR +YG+GI LAMH AP+
Sbjct  180  LITAAVLYLLGALITATAPGLSVLLVGRVLYGLGIGLAMHGAPL  223



>ref|XP_006342314.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Solanum tuberosum]
Length=545

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 7/148 (5%)
 Frame = +3

Query  198  SSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESAT  377
            SSGE G   EP       +IE +S  + ILPF+FPALGGLL+GYDIGATS ATIS++S  
Sbjct  65   SSGE-GEEAEP------GYIEEFSWSSVILPFIFPALGGLLFGYDIGATSGATISLQSPE  117

Query  378  SSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTA  557
             SG+SWY+LS+VQ+GL+ SGSLYGALIGS LA+  ADFLGRRREL++++ILYL GG +TA
Sbjct  118  LSGMSWYNLSAVQLGLVVSGSLYGALIGSILAYPFADFLGRRRELIIAAILYLAGGSLTA  177

Query  558  FAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
             AP    +++GR VYG+GI LAMH AP+
Sbjct  178  CAPGLGALLLGRLVYGLGIGLAMHGAPL  205



>ref|XP_011089518.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Sesamum 
indicum]
Length=558

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++ S+VQ+GL+ SGSLYGAL GS + + +ADFLGRRRE
Sbjct  115  DIGATSGATISLQSPELSGTNWFNFSAVQLGLVVSGSLYGALAGSLVVYPLADFLGRRRE  174

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++S+ YL G L+TA+AP   ++++ RF+YG+GI +AMH AP+
Sbjct  175  LIIASLFYLTGALLTAYAPGLGVLLVARFLYGLGIGMAMHGAPL  218



>gb|EYU45952.1| hypothetical protein MIMGU_mgv1a003885mg [Erythranthe guttata]
Length=558

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++ S+VQ+GL+ SGSLYGAL+GS + + +ADFLGRRRE
Sbjct  115  DIGATSGATISLQSPELSGTTWFNFSAVQLGLVVSGSLYGALLGSLIVYPLADFLGRRRE  174

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++S+LYL G L+TA+AP   ++++ R +YG+GI +AMH AP+
Sbjct  175  LIIASLLYLTGALLTAYAPGLGVLLVARLLYGLGIGMAMHGAPL  218



>ref|XP_006401006.1| hypothetical protein EUTSA_v10013139mg [Eutrema salsugineum]
 gb|ESQ42459.1| hypothetical protein EUTSA_v10013139mg [Eutrema salsugineum]
Length=558

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++S   SG +W++ S VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  115  DIGATSGATLSLQSPALSGTTWFNFSPVQLGLVVSGSLYGALLGSTLVYGIADFLGRRRE  174

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LYL+G LIT  AP   ++++GR +YG+GI LAMH AP+
Sbjct  175  LIIAAVLYLLGSLITGSAPNLNVLLVGRLLYGLGIGLAMHGAPL  218



>gb|ABB17074.1| putative sugar transporter [Nicotiana langsdorffii x Nicotiana 
sanderae]
Length=552

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = +3

Query  237  HGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQ  416
            + +  ++E +S  + ILPFLFPALGGLL+GYDIGATS ATIS++SA  SG +WY+ S+VQ
Sbjct  78   NAESAYLEEFSWSSVILPFLFPALGGLLFGYDIGATSGATISLQSAELSGTTWYNFSAVQ  137

Query  417  IGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRF  596
            +GL+ SGSLYGAL GS LA+  ADFLGRRREL+++++LY  GG +TA+AP    +++GR 
Sbjct  138  LGLVVSGSLYGALFGSILAYPFADFLGRRRELIIAALLYAAGGSLTAYAPGLGALLLGRL  197

Query  597  VYGVGIXLAMHAAPM  641
            VYG+GI LAMH AP+
Sbjct  198  VYGLGIGLAMHGAPL  212



>ref|XP_004951635.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X2 [Setaria italica]
Length=157

 Score =   103 bits (257),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++SA  SG +W++ SSVQ+GL+ SGSLYGAL GS LA  IADFLGRR E
Sbjct  51   DIGATSGATISVQSADLSGTTWFNRSSVQLGLVASGSLYGALGGSILAHRIADFLGRRIE  110

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAM  626
            L+ ++ LY++G L+T FAP +V ++IGR +YG+GI L +
Sbjct  111  LVTAAALYILGALVTGFAPNFVGLIIGRILYGIGIGLRL  149



>emb|CDX74227.1| BnaA03g28200D [Brassica napus]
Length=483

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 105/165 (64%), Gaps = 23/165 (14%)
 Frame = +3

Query  153  DPEQLTFSSIGQPGKSSG-EIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllyg  326
            D E+ +   + Q G  S   + SVQEPL+  +Q H  ENYSV+A I PFLFPALG  L+G
Sbjct  4    DAEKQSIVHVEQVGDLSLIGLSSVQEPLI--KQKHTPENYSVLAAIPPFLFPALGTFLFG  61

Query  327  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  506
            Y+IGATSCATISI+S T SGISWY+LSSV +G+ITSGSL   LI +   + I   +    
Sbjct  62   YEIGATSCATISIKSPTLSGISWYNLSSVDVGIITSGSLRKGLITAAFLYLIGAIV----  117

Query  507  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
                           TA APV+ +++IGR VYG+G+ L MHAAPM
Sbjct  118  ---------------TAVAPVFPVLIIGRVVYGIGVGLTMHAAPM  147



>ref|XP_002982112.1| hypothetical protein SELMODRAFT_115745 [Selaginella moellendorffii]
 gb|EFJ16780.1| hypothetical protein SELMODRAFT_115745 [Selaginella moellendorffii]
Length=470

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS A+IS+ S   SG  WY L+S+Q GL+ SGSLYGAL+GS LA+N+AD LGRR+E
Sbjct  21   DIGATSGASISLTSPELSGTDWYQLTSIQTGLVVSGSLYGALLGSILAYNVADRLGRRKE  80

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++ +Y IG L+T  AP + +++ GR  +G GI LAMH APM
Sbjct  81   LISAAAIYCIGSLVTGLAPNFPVILAGRLAFGFGIGLAMHGAPM  124



>ref|XP_002992213.1| hypothetical protein SELMODRAFT_134982 [Selaginella moellendorffii]
 gb|EFJ06710.1| hypothetical protein SELMODRAFT_134982 [Selaginella moellendorffii]
Length=470

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS A+IS+ S   SG  WY L+S+Q GL+ SGSLYGAL+GS LA+N+AD LGRR+E
Sbjct  21   DIGATSGASISLTSPELSGTDWYQLTSIQTGLVVSGSLYGALLGSILAYNVADRLGRRKE  80

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ ++ +Y IG L+T  AP + +++ GR  +G GI LAMH APM
Sbjct  81   LISAAAIYCIGSLVTGLAPNFPVILAGRLAFGFGIGLAMHGAPM  124



>ref|XP_004951634.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Setaria italica]
Length=160

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++SA  SG +W++ SSVQ+GL+ SGSLYGAL GS LA  IADFLGRR E
Sbjct  51   DIGATSGATISVQSADLSGTTWFNRSSVQLGLVASGSLYGALGGSILAHRIADFLGRRIE  110

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXL  620
            L+ ++ LY++G L+T FAP +V ++IGR +YG+GI L
Sbjct  111  LVTAAALYILGALVTGFAPNFVGLIIGRILYGIGIGL  147



>ref|NP_001287653.1| D-xylose-proton symporter-like 3, chloroplastic-like [Solanum 
lycopersicum]
 ref|XP_004235087.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Solanum lycopersicum]
 dbj|BAO96238.1| vacuolar glucose transporter 1 [Solanum lycopersicum]
 dbj|BAQ03806.1| vacuolar glucose transporter 1 [Solanum lycopersicum]
Length=545

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 106/130 (82%), Gaps = 0/130 (0%)
 Frame = +3

Query  252  HIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLIT  431
            +IE +S  + ILPF FPALGGLL+GYDIGATS ATIS++S   SG+SWY+LS+VQ+GL+ 
Sbjct  76   YIEEFSWSSVILPFFFPALGGLLFGYDIGATSGATISLQSPELSGMSWYNLSAVQLGLVV  135

Query  432  SGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVG  611
            SGSLYGALIGS LA+  ADFLGR REL++++ILYL GG +TA AP    +++GR VYG+G
Sbjct  136  SGSLYGALIGSILAYPFADFLGRSRELIIAAILYLAGGSLTACAPGLGALLLGRLVYGLG  195

Query  612  IXLAMHAAPM  641
            I LAMH AP+
Sbjct  196  IGLAMHGAPL  205



>ref|XP_010443656.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=559

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 125/194 (64%), Gaps = 32/194 (16%)
 Frame = +3

Query  72   ISFPGNCSRYN*GFLPIFLELAKMATDDPEQLTFSSIGQPGK--SSGEIGSV--QEPLLH  239
            +S PG  SRY                    Q+  + IG  G+   SGE+ SV   EP   
Sbjct  53   VSKPGLVSRYR-------------------QILQAGIGAGGEFADSGEVASVASDEP---  90

Query  240  GQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQI  419
                  E++S  + ILPF+FPALGGLL+GYDIGATS AT+S++S   SG +W++ S VQ+
Sbjct  91   ------ESFSWSSVILPFIFPALGGLLFGYDIGATSGATLSLQSPALSGTTWFNFSPVQL  144

Query  420  GLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFV  599
            GL+ SGSLYGAL+GS   + +ADFLGRRREL+++++LYL+G LIT  AP   ++++GR +
Sbjct  145  GLVVSGSLYGALLGSISVYGVADFLGRRRELIIAAVLYLLGSLITGCAPDLNVLLVGRLL  204

Query  600  YGVGIXLAMHAAPM  641
            YG GI LAMH AP+
Sbjct  205  YGFGIGLAMHGAPL  218



>ref|XP_002866311.1| hypothetical protein ARALYDRAFT_919128 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42570.1| hypothetical protein ARALYDRAFT_919128 [Arabidopsis lyrata subsp. 
lyrata]
Length=559

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++S   SG +W++ S VQ+GL+ SGSLYGAL+GS   + +ADFLGRRRE
Sbjct  116  DIGATSGATLSLQSPVLSGTTWFNFSPVQLGLVVSGSLYGALLGSISVYGVADFLGRRRE  175

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LYL+G LIT  AP   I+++GR +YG GI LAMH AP+
Sbjct  176  LIIAAVLYLLGSLITGCAPDLNILLVGRLLYGFGIGLAMHGAPL  219



>gb|KDO66624.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=496

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  116  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  175

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY +G L TA+AP   ++++GR +YG+GI LAMH AP+
Sbjct  176  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPL  219



>dbj|BAE98379.1| D-xylose-H+ symporter - like protein [Arabidopsis thaliana]
Length=558

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++S   SG +W++ S VQ+GL+ SGSLYGAL+GS   + +ADFLGRRRE
Sbjct  115  DIGATSGATLSLQSPALSGTTWFNFSPVQLGLVVSGSLYGALLGSISVYGVADFLGRRRE  174

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LYL+G LIT  AP   I+++GR +YG GI LAMH AP+
Sbjct  175  LIIAAVLYLLGSLITGCAPDLNILLVGRLLYGFGIGLAMHGAPL  218



>ref|NP_200733.2| Major facilitator superfamily protein [Arabidopsis thaliana]
 sp|Q0WWW9.2|XYLL3_ARATH RecName: Full=D-xylose-proton symporter-like 3, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09770.1| sugar transporter-like protein [Arabidopsis thaliana]
 gb|AAU05477.1| At5g59250 [Arabidopsis thaliana]
 gb|AAV85693.1| At5g59250 [Arabidopsis thaliana]
 gb|AED97162.1| Major facilitator superfamily protein [Arabidopsis thaliana]
Length=558

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++S   SG +W++ S VQ+GL+ SGSLYGAL+GS   + +ADFLGRRRE
Sbjct  115  DIGATSGATLSLQSPALSGTTWFNFSPVQLGLVVSGSLYGALLGSISVYGVADFLGRRRE  174

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LYL+G LIT  AP   I+++GR +YG GI LAMH AP+
Sbjct  175  LIIAAVLYLLGSLITGCAPDLNILLVGRLLYGFGIGLAMHGAPL  218



>ref|XP_006424897.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38137.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=553

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  110  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  169

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY +G L TA+AP   ++++GR +YG+GI LAMH AP+
Sbjct  170  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPL  213



>ref|XP_006279761.1| hypothetical protein CARUB_v10027739mg [Capsella rubella]
 gb|EOA12659.1| hypothetical protein CARUB_v10027739mg [Capsella rubella]
Length=559

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++S   SG +W++ S VQ+GL+ SGSLYGAL+GS   + IADFLGRRRE
Sbjct  115  DIGATSGATLSLQSPALSGTTWFNFSPVQLGLVVSGSLYGALLGSISVYGIADFLGRRRE  174

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY +G LIT  AP   ++++GR +YG GI LAMH AP+
Sbjct  175  LIIAAVLYFLGSLITGSAPDLNVLLVGRLLYGFGIGLAMHGAPL  218



>ref|XP_006488378.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=559

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  116  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  175

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY +G L TA+AP   ++++GR +YG+GI LAMH AP+
Sbjct  176  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPL  219



>gb|KDO66619.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=559

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  116  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  175

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY +G L TA+AP   ++++GR +YG+GI LAMH AP+
Sbjct  176  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPL  219



>ref|XP_006424895.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38135.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=534

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  116  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  175

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY +G L TA+AP   ++++GR +YG+GI LAMH AP+
Sbjct  176  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPL  219



>ref|XP_010483521.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=560

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++S   SG +W++ S VQ+GL+ SGSLYGAL+GS   + +ADFLGRRRE
Sbjct  116  DIGATSGATLSLQSPALSGTTWFNFSPVQLGLVVSGSLYGALLGSISVYGVADFLGRRRE  175

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LYL+G LIT  AP   ++++GR +YG GI LAMH AP+
Sbjct  176  LIIAAVLYLLGSLITGCAPDLNVLLVGRLLYGFGIGLAMHGAPL  219



>ref|XP_010454633.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=559

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++S   SG +W++ S VQ+GL+ SGSLYGAL+GS   + +ADFLGRRRE
Sbjct  116  DIGATSGATLSLQSPALSGTTWFNFSPVQLGLVVSGSLYGALLGSISVYGVADFLGRRRE  175

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LYL+G LIT  AP   ++++GR +YG GI LAMH AP+
Sbjct  176  LIIAAVLYLLGSLITGCAPDLNVLLVGRLLYGFGIGLAMHGAPL  219



>gb|KDO66618.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=553

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  110  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  169

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY +G L TA+AP   ++++GR +YG+GI LAMH AP+
Sbjct  170  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPL  213



>ref|XP_006488379.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=553

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  110  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  169

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY +G L TA+AP   ++++GR +YG+GI LAMH AP+
Sbjct  170  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPL  213



>gb|KDO66623.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=559

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  116  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  175

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY +G L TA+AP   ++++GR +YG+GI LAMH AP+
Sbjct  176  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPL  219



>ref|XP_008681530.1| PREDICTED: uncharacterized protein LOC100274077 isoform X1 [Zea 
mays]
Length=586

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG  W+ LSS+Q+GL+ SGSLYGAL GS LA+ IADFLGRR E
Sbjct  116  DIGATSGATISVQSPDLSGTDWFSLSSLQLGLVASGSLYGALGGSLLAYRIADFLGRRIE  175

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAM  626
            L+ ++ LY++G L+T FAP +V ++IGR +YG+GI L M
Sbjct  176  LVTAAALYILGALVTGFAPNFVALIIGRVLYGIGIGLGM  214



>emb|CDP09100.1| unnamed protein product [Coffea canephora]
Length=567

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS+ S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L + +ADFLGRRRE
Sbjct  124  DIGATSGATISLLSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSLLVYPLADFLGRRRE  183

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L++++ILY IG   TA+AP   ++++ R VYG+GI LAMH AP+
Sbjct  184  LIMAAILYAIGSASTAYAPGLAVLLLARLVYGLGIGLAMHGAPL  227



>gb|EEE60202.1| hypothetical protein OsJ_13164 [Oryza sativa Japonica Group]
Length=488

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +3

Query  345  SCATISIE-SATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmls  521
              A +SI  SA  SG +W+ LSS+Q+GL+ SGSLYGAL GS LA+ +ADFLGRR EL+ +
Sbjct  140  KIAPLSISLSAELSGTTWFSLSSIQLGLVASGSLYGALGGSLLAYRVADFLGRRIELVTA  199

Query  522  silyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            + LY+ G L+T FAP +V+++IGR +YG+GI LAMH AP+
Sbjct  200  AALYISGALVTGFAPDFVLLIIGRLLYGIGIGLAMHGAPL  239



>emb|CAN83894.1| hypothetical protein VITISV_039113 [Vitis vinifera]
Length=606

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 85/120 (71%), Gaps = 16/120 (13%)
 Frame = +3

Query  330  DIGATSCATISIE----------------SATSSGISWYDLSSVQIGLITSGSLYGALIG  461
            DIGATS ATIS++                S   SGI+W++LS+VQ+GL+ SGSLYGAL+G
Sbjct  118  DIGATSGATISLQRPVLLKLIFIILTILKSPELSGITWFELSAVQLGLVVSGSLYGALLG  177

Query  462  SFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            S L + IADFLGRR EL+ ++ILY +GGLITA AP   ++++GR +YG GI LAMH AP+
Sbjct  178  SILVYPIADFLGRRGELITAAILYALGGLITASAPELDVLLVGRLLYGJGIGLAMHGAPL  237



>gb|AAO18445.1| putative sugar transporter protein [Oryza sativa Japonica Group]
Length=525

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +3

Query  345  SCATISIE-SATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmls  521
              A +SI  SA  SG +W+ LSS+Q+GL+ SGSLYGAL GS LA+ +ADFLGRR EL+ +
Sbjct  86   KIAPLSISLSAELSGTTWFSLSSIQLGLVASGSLYGALGGSLLAYRVADFLGRRIELVTA  145

Query  522  silyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            + LY+ G L+T FAP +V+++IGR +YG+GI LAMH AP+
Sbjct  146  AALYISGALVTGFAPDFVLLIIGRLLYGIGIGLAMHGAPL  185



>gb|EEC76432.1| hypothetical protein OsI_14118 [Oryza sativa Indica Group]
Length=579

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +3

Query  345  SCATISIE-SATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmls  521
              A +SI  SA  SG +W+ LSS+Q+GL+ SGSLYGAL GS LA+ +ADFLGRR EL+ +
Sbjct  140  KIAPLSISLSAELSGTTWFSLSSIQLGLVASGSLYGALGGSLLAYRVADFLGRRIELVTA  199

Query  522  silyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            + LY+ G L+T FAP +V+++IGR +YG+GI LAMH AP+
Sbjct  200  AALYISGALVTGFAPDFVLLIIGRLLYGIGIGLAMHGAPL  239



>ref|XP_002300123.2| hypothetical protein POPTR_0001s25100g [Populus trichocarpa]
 gb|EEE84928.2| hypothetical protein POPTR_0001s25100g [Populus trichocarpa]
Length=559

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++SA  SGISW++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  116  DIGATSGATLSLQSAELSGISWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  175

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+ +++LYL GGL+T +AP   ++++GR +YG+GI LAMH AP+
Sbjct  176  LIAAALLYLFGGLVTGYAPGLNVLLLGRLLYGLGIGLAMHGAPL  219



>ref|XP_002520519.1| sugar transporter, putative [Ricinus communis]
 gb|EEF41932.1| sugar transporter, putative [Ricinus communis]
Length=505

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SG +W++LS++Q+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  62   DIGATSGATISLQSPELSGTTWFNLSAIQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  121

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY++GGLITA+AP   I++ GR +YG+GI LAMH AP+
Sbjct  122  LIIAAVLYMLGGLITAYAPSLGILLGGRLLYGLGIGLAMHGAPL  165



>ref|XP_009120413.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Brassica 
rapa]
Length=555

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++SAT SG +W++LS VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  111  DIGATSGATLSLQSATLSGTTWFNLSPVQLGLVVSGSLYGALLGSTLVYGIADFLGRRRE  170

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L++++ LYL+G LIT  AP   ++++GR +YG+GI LAMH AP+
Sbjct  171  LIIAAGLYLLGSLITGCAPDLNVLLLGRLLYGLGIGLAMHGAPL  214



>emb|CDY33006.1| BnaA10g12120D [Brassica napus]
Length=555

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++SAT SG +W++LS VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  111  DIGATSGATLSLQSATLSGTTWFNLSPVQLGLVVSGSLYGALLGSTLVYGIADFLGRRRE  170

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++S LYL+G LIT  AP   ++++GR +YG+GI LAMH AP+
Sbjct  171  LIIASGLYLLGSLITGCAPDLNVLLLGRLLYGLGIGLAMHGAPL  214



>gb|KDO66622.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=436

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  366  ESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyligg  545
            +S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+REL+++++LY +G 
Sbjct  5    QSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRELIIAAVLYALGA  64

Query  546  liTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L TA+AP   ++++GR +YG+GI LAMH AP+
Sbjct  65   LTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPL  96



>gb|ABF99614.1| sugar transporter family protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=545

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = +3

Query  345  SCATISIE-SATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmls  521
              A +SI  SA  SG +W+ LSS+Q+GL+ SGSLYGAL GS LA+ +ADFLGRR EL+ +
Sbjct  140  KIAPLSISLSAELSGTTWFSLSSIQLGLVASGSLYGALGGSLLAYRVADFLGRRIELVTA  199

Query  522  silyliggliTAFAPVYVIMVIGRFVYGVGIXL  620
            + LY+ G L+T FAP +V+++IGR +YG+GI L
Sbjct  200  AALYISGALVTGFAPDFVLLIIGRLLYGIGIGL  232



>gb|KHN18956.1| D-xylose-proton symporter-like 3, chloroplastic [Glycine soja]
Length=90

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++S   SGISW++LS++Q+GL+ SGSLYGAL+GS +AF  ADFLGR+++
Sbjct  16   DIGATSGATISLQSPELSGISWFNLSAIQLGLVVSGSLYGALLGSLVAFARADFLGRKKQ  75



>ref|XP_008455658.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Cucumis 
melo]
Length=408

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  426  ITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYG  605
            +TSGSLYGALIGS LAFN+ADFLGRRREL+LS+++YL+G +IT  AP + I++IGRF+ G
Sbjct  1    MTSGSLYGALIGSVLAFNVADFLGRRRELILSALMYLVGAIITGLAPNFAILIIGRFISG  60

Query  606  VGIXLAMHAAPM  641
             GI LAMHAAPM
Sbjct  61   TGIGLAMHAAPM  72



>emb|CDY54245.1| BnaC09g53840D [Brassica napus]
Length=559

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS AT+S++SA  SG +W++LS VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  115  DIGATSGATLSLQSAALSGTTWFNLSPVQLGLVVSGSLYGALLGSTLVYGIADFLGRRRE  174

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L++++ LYL+G LIT  AP   ++++GR +YG+GI LAMH AP+
Sbjct  175  LIIAAGLYLLGSLITGCAPDLNVLLLGRLLYGLGIGLAMHGAPL  218



>ref|XP_010043498.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Eucalyptus 
grandis]
 gb|KCW85511.1| hypothetical protein EUGRSUZ_B02309 [Eucalyptus grandis]
Length=570

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 87/127 (69%), Gaps = 4/127 (3%)
 Frame = +3

Query  129  ELAKMATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpal  308
            EL  +      +L F+ +G   +     G  + P+     P+ E +S  + ILPFLFPAL
Sbjct  64   ELPNLPLLPSSKLEFA-VGAQREYDSSAGDAELPI---SDPNQEEFSWSSVILPFLFPAL  119

Query  309  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  488
            GGLL+GYDIGATS AT+S++S   SG +WY+LS+VQ+GL+ SGSLYGAL+GS L + IAD
Sbjct  120  GGLLFGYDIGATSGATLSMQSPQLSGTTWYNLSAVQLGLVVSGSLYGALLGSLLVYPIAD  179

Query  489  FLGRRRE  509
            FLGRRRE
Sbjct  180  FLGRRRE  186



>ref|XP_005845570.1| hypothetical protein CHLNCDRAFT_25635 [Chlorella variabilis]
 gb|EFN53468.1| hypothetical protein CHLNCDRAFT_25635 [Chlorella variabilis]
Length=502

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 66/103 (64%), Gaps = 0/103 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS A +S+ S   SG  WY LS+ Q GL+ S SL GAL+GS  A    D LGRRRE
Sbjct  70   DIGATSGALVSMTSQQYSGTDWYSLSAFQSGLVVSLSLAGALLGSGAALLYGDKLGRRRE  129

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAP  638
            L+ +S LY    L+ A AP    ++ GR +YGVGI  AMHAAP
Sbjct  130  LLGASALYGAASLVVALAPGLPTVMAGRLLYGVGIGFAMHAAP  172



>gb|KJB20004.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=541

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 72/104 (69%), Gaps = 20/104 (19%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS ATIS++                     SGSLYGAL+GS L + +AD LGRRRE
Sbjct  118  DIGATSGATISLQ--------------------VSGSLYGALLGSLLVYPVADSLGRRRE  157

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            L+++++LY++GG++TAFAP   ++++GR +YG+GI LAMH AP+
Sbjct  158  LLIAALLYVLGGVLTAFAPGLSVLLVGRLLYGLGIGLAMHGAPL  201



>dbj|BAH19966.1| AT5G59250 [Arabidopsis thaliana]
Length=415

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +3

Query  417  IGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRF  596
            +GL+ SGSLYGAL+GS   + +ADFLGRRREL+++++LYL+G LIT  AP   I+++GR 
Sbjct  1    LGLVVSGSLYGALLGSISVYGVADFLGRRRELIIAAVLYLLGSLITGCAPDLNILLVGRL  60

Query  597  VYGVGIXLAMHAAPM  641
            +YG GI LAMH AP+
Sbjct  61   LYGFGIGLAMHGAPL  75



>ref|XP_011400947.1| D-xylose-proton symporter-like 3, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27940.1| D-xylose-proton symporter-like 3, chloroplastic [Auxenochlorella 
protothecoides]
Length=529

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 66/103 (64%), Gaps = 0/103 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGA+S A +S+ S T SG  WY LS +  GL+ S SL GAL+GS  AF + D LGRR E
Sbjct  81   DIGASSGAIVSMTSPTLSGTDWYALSPLLTGLVVSSSLGGALLGSAAAFVVGDRLGRRGE  140

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAP  638
            L+L++ LY  G    A AP    ++  R ++G+GI  AMHAAP
Sbjct  141  LLLAAGLYAGGAAGGALAPSLGAVLAARALFGLGIGFAMHAAP  183



>emb|CBJ33077.1| conserved unknown protein [Ectocarpus siliculosus]
Length=523

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 75/114 (66%), Gaps = 11/114 (10%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDL---SSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            DIGATS     +ES+T S +SWY++   S++  G+ITS ++ GA+IGS + F + D LGR
Sbjct  63   DIGATSSVLTQLESSTYSDVSWYNVVASSTLLQGIITSNAVLGAMIGSIICFRVGDALGR  122

Query  501  RRElmlssilyliggliTAF--APVY------VIMVIGRFVYGVGIXLAMHAAP  638
            RRE++++++L+  G +I A   + V+      V+++IGR  YGVG   AMH AP
Sbjct  123  RREILVAAVLFFFGAIIEAVSGSSVWSGDWGLVVLMIGRVSYGVGCGFAMHGAP  176



>ref|XP_005645204.1| hypothetical protein COCSUDRAFT_67173 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20660.1| hypothetical protein COCSUDRAFT_67173 [Coccomyxa subellipsoidea 
C-169]
Length=564

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS A +S++SA +SG SWY+LSS Q G + S SL GAL GS  AF + D LGR+RE
Sbjct  130  DIGATSGALVSLKSAVTSGTSWYELSSFQSGFVVSSSLLGALAGSAAAFVVGDKLGRKRE  189

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMH  629
            LML ++LY     + AFAP   ++++GR +YG+GI   MH
Sbjct  190  LMLGAVLYGTSAALMAFAPNLELLLLGRTLYGLGIGFTMH  229



>gb|EPS59382.1| hypothetical protein M569_15426, partial [Genlisea aurea]
Length=411

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  429  TSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGV  608
             SGSLYGAL+GS + + IADFLGR REL+++S+ YLIG L+TA+AP   +++I R +YG+
Sbjct  1    VSGSLYGALLGSLIVYPIADFLGRNRELIIASVFYLIGALLTAYAPGLGVLLIARLIYGL  60

Query  609  GIXLAMHAAPM  641
            GI +AMH AP+
Sbjct  61   GIGMAMHGAPL  71



>ref|XP_003062688.1| major facilitator superfamily [Micromonas pusilla CCMP1545]
 gb|EEH53507.1| major facilitator superfamily [Micromonas pusilla CCMP1545]
Length=510

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 85/135 (63%), Gaps = 1/135 (1%)
 Frame = +3

Query  240  GQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQI  419
            G++P  ++  V A  L F+FPA+ GLL+G+DIG+TS A  S+    ++G+ WY L   Q 
Sbjct  42   GERPIADDVDVRATALLFIFPAIAGLLFGWDIGSTSGALQSLTDPNTAGMDWYALDPFQR  101

Query  420  GLITSGSLYGALIGSFL-AFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRF  596
            GL+ S SL GAL+ S   A  + D LG R+EL L+++LY  G L+   A     +V+GRF
Sbjct  102  GLVVSTSLAGALVASATAALKLGDKLGSRKELQLAALLYAGGALVQGGAISLETLVLGRF  161

Query  597  VYGVGIXLAMHAAPM  641
             YG+GI  AMH AP+
Sbjct  162  TYGLGIGFAMHGAPL  176



>ref|XP_002179486.1| TRD4 [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49309.1| TRD4, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=467

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 70/115 (61%), Gaps = 12/115 (10%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDL---SSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            DIGATS A + ++S   SG+SW+     S +  G I S    GALIGS LAF I D +GR
Sbjct  34   DIGATSYAIVQMQSPVLSGVSWFHTVLSSPILRGTILSSGSAGALIGSSLAFAIGDKIGR  93

Query  501  RRElmlssilyliggliTAFAPV---------YVIMVIGRFVYGVGIXLAMHAAP  638
            RREL L S+LYL+G L+  +              ++++GR VYG+GI ++MHAAP
Sbjct  94   RRELQLGSLLYLLGALLEVWTAQSSSWGAVLGITVLILGRVVYGIGIGISMHAAP  148



>gb|KIZ01781.1| hypothetical protein MNEG_6180 [Monoraphidium neglectum]
Length=537

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGATS    S+ +   SG  W +LS+ Q GL+ S SL GAL GS +A    + LGRR E
Sbjct  72   DIGATSGVLTSLTNPQLSGTDWSNLSAFQSGLVVSTSLLGALAGSLVALAAGNRLGRRTE  131

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAP  638
            ++L+++LY +       A     ++  R  YG+GI LAMHAAP
Sbjct  132  ILLAALLYGVSSASLGAADSLNWLLACRLGYGLGIGLAMHAAP  174



>gb|KDO66620.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
 gb|KDO66621.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=443

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  423  LITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVY  602
            L   GSLYGAL+GS L ++IADFLGR+REL+++++LY +G L TA+AP   ++++GR +Y
Sbjct  31   LALCGSLYGALLGSILVYSIADFLGRKRELIIAAVLYALGALTTAYAPGLGVLLVGRLLY  90

Query  603  GVGIXLAMHAAPM  641
            G+GI LAMH AP+
Sbjct  91   GLGIGLAMHGAPL  103



>ref|XP_006424896.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38136.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=443

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  423  LITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVY  602
            L   GSLYGAL+GS L ++IADFLGR+REL+++++LY +G L TA+AP   ++++GR +Y
Sbjct  31   LALCGSLYGALLGSILVYSIADFLGRKRELIIAAVLYALGALTTAYAPGLGVLLVGRLLY  90

Query  603  GVGIXLAMHAAPM  641
            G+GI LAMH AP+
Sbjct  91   GLGIGLAMHGAPL  103



>gb|KDD76485.1| sugar transporter [Helicosporidium sp. ATCC 50920]
Length=587

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIGA+S A +SI +  +SG  W+ +S+++ G++ S SL GAL+GS  A      LGRR+E
Sbjct  73   DIGASSGALVSITTPATSGTLWHGMSTLRSGMVVSSSLLGALLGSLAALLWGQALGRRKE  132

Query  510  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAP  638
            L++++  Y  G ++   AP Y +M+ GR +YG+GI LAMHAAP
Sbjct  133  LLMAAWFYGGGSVLVGIAPAYSLMLAGRVLYGIGIGLAMHAAP  175



>ref|XP_009036253.1| general sugar transporter [Aureococcus anophagefferens]
 gb|EGB09136.1| general sugar transporter [Aureococcus anophagefferens]
Length=498

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 69/117 (59%), Gaps = 14/117 (12%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDL---SSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            DIGATS     ++SA  SG+SWYDL   SS   GL+TSG + GA +G+ + F +AD LGR
Sbjct  26   DIGATSYVLTQLQSAKFSGVSWYDLVARSSALQGLVTSGGVGGAFVGASIVFKVADDLGR  85

Query  501  RRElmlssilyliggl-----------iTAFAPVYVIMVIGRFVYGVGIXLAMHAAP  638
            RREL+L + LY++G              +       ++V+GRFVYGVG    MH AP
Sbjct  86   RRELLLGAALYVLGAACEFLGGGVGPYESGAGDGLFLLVLGRFVYGVGCGFVMHGAP  142



>emb|CDY47336.1| BnaCnng14730D, partial [Brassica napus]
Length=261

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = +3

Query  429  TSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGV  608
            TS S YGAL GS +AFNIAD +G + EL+ ++ LYL+G ++TA APV+ +++ GR VYG+
Sbjct  36   TSCSHYGALNGSIVAFNIADIIGLK-ELVTAAFLYLVGAILTATAPVFPVLISGRVVYGI  94

Query  609  GIXLAMHAAPM  641
            G+ L MHAAP+
Sbjct  95   GLGLTMHAAPI  105



>ref|XP_005708849.1| MFS transporter, SP family, sugar:H+ symporter [Galdieria sulphuraria]
 gb|EME32329.1| MFS transporter, SP family, sugar:H+ symporter [Galdieria sulphuraria]
Length=592

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 71/107 (66%), Gaps = 5/107 (5%)
 Frame = +3

Query  330  DIGATSCATI---SIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            D+G TS       +I+++ SS  S+ +LSS+ +G I + SL+GAL  S LAF   D +GR
Sbjct  139  DVGCTSSVLRVLGNIQASQSS--SFGELSSLTLGFIAAASLFGALGSSLLAFRFGDSIGR  196

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            ++EL+LS+ILY IG L+ A +P   ++ + R ++G GI  +MHAAP+
Sbjct  197  KKELLLSAILYSIGTLMEALSPNLPLLFLARLIFGAGIGFSMHAAPI  243



>ref|XP_002501745.1| sugar transporter [Micromonas sp. RCC299]
 gb|ACO63003.1| sugar transporter [Micromonas sp. RCC299]
Length=506

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 59/105 (56%), Gaps = 1/105 (1%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITS-GSLYGALIGSFLAFNIADFLGRRR  506
            DIG TS A  SI    +SG+ WY L S Q G++ S       L  +  A  + D  G + 
Sbjct  71   DIGTTSGALTSIMDPNTSGVDWYALDSFQQGMVVSTSLAGALLASAAAAVKVGDEFGSKT  130

Query  507  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            EL L+++ Y  G ++   AP   ++++GRF YG+GI  AMHAAPM
Sbjct  131  ELQLAALFYGAGAIVQGLAPSLGVLIMGRFTYGLGIGFAMHAAPM  175



>ref|XP_006414919.1| hypothetical protein EUTSA_v10026911mg [Eutrema salsugineum]
 gb|ESQ56372.1| hypothetical protein EUTSA_v10026911mg [Eutrema salsugineum]
Length=80

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  363  IESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADF  491
            + S   SGISWY+LSSV++G+ITSGSLYGALIGS +   +  F
Sbjct  31   VMSPMLSGISWYNLSSVEVGIITSGSLYGALIGSIVERKLCYF  73



>ref|XP_005783754.1| hypothetical protein EMIHUDRAFT_232111 [Emiliania huxleyi CCMP1516]
 gb|EOD31325.1| hypothetical protein EMIHUDRAFT_232111 [Emiliania huxleyi CCMP1516]
Length=502

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 63/108 (58%), Gaps = 9/108 (8%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  509
            DIG+TS A  S+          ++   +    ITS SL GA +GS LAF + + LGRRRE
Sbjct  36   DIGSTSGAVRSLRLLVG-----FEAKGMWTSAITSASLMGATLGSVLAFWVGEPLGRRRE  90

Query  510  lmlssilyliggliTAFAP----VYVIMVIGRFVYGVGIXLAMHAAPM  641
            L++ S LYL G L+   AP     Y  +  GR++YG+G+  +MHAAP+
Sbjct  91   LLVGSSLYLFGSLLCVAAPESGAAYGAVFAGRWLYGLGVAFSMHAAPV  138



>emb|CEF97100.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 
3 [Ostreococcus tauri]
Length=499

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLA-FNIADFLGRRR  506
            DIG +S A  +I ++ ++G   + L+S+Q G   S SL+GAL+ S +A   I D LG RR
Sbjct  55   DIGISSGALENITTSAANGGDGFALNSIQSGQFVSASLFGALMASAVAGAGIGDRLGARR  114

Query  507  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            EL L+++LYLIG +  + A  + ++V  + VYG+G+  AM +AP+
Sbjct  115  ELALAAMLYLIGSVSGSAANGFELLVFSKLVYGLGVGFAMQSAPV  159



>gb|EWM26836.1| d-xylose-proton symporter-like protein [Nannochloropsis gaditana]
Length=663

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 70/113 (62%), Gaps = 12/113 (11%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISW---YDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            DIGAT+     ++S   +G++W    + SSV  G  T+ ++ GAL+G+ +   +   +GR
Sbjct  30   DIGATAYVLTQLQS-DKAGVAWGERIESSSVLRGFFTASAVGGALLGTVVVLQVEGSMGR  88

Query  501  RRElmlssilyliggliTAFAPVY-------VIMVIGRFVYGVGIXLAMHAAP  638
            RREL+L+++LY++GG    FA  +       V+ ++GR++YG GI  AMHAAP
Sbjct  89   RRELLLAALLYMMGGGFE-FASSFLSSDAGLVVCLLGRWIYGGGIAFAMHAAP  140



>ref|XP_009032417.1| hypothetical protein AURANDRAFT_18763 [Aureococcus anophagefferens]
 gb|EGB12775.1| hypothetical protein AURANDRAFT_18763 [Aureococcus anophagefferens]
Length=501

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 61/113 (54%), Gaps = 10/113 (9%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISWYDL--SSVQIGLITSGSLYGALIGSFLAFNIADFLGRR  503
            DIGAT+ A   + S   SG SW+    +SV  G+I S  + GA +GS L        GR 
Sbjct  41   DIGATAVALDDMGSEQWSGTSWHAAAANSVVRGVIVSAVMVGAALGSLLVLRYETDWGRV  100

Query  504  RElmlssilyliggliTAF-------APV-YVIMVIGRFVYGVGIXLAMHAAP  638
            +E+ L+S LY  G L+          AP+   +++ GR VYGVGI LAMH AP
Sbjct  101  KEMRLASALYGAGALVEGLSGSPGLSAPLGLTVLLFGRVVYGVGIGLAMHGAP  153



>ref|XP_009037217.1| hypothetical protein AURANDRAFT_26890 [Aureococcus anophagefferens]
 gb|EGB07837.1| hypothetical protein AURANDRAFT_26890 [Aureococcus anophagefferens]
Length=582

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 11/113 (10%)
 Frame = +3

Query  330  DIGATSCATISIESATSSGISW---YDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  500
            DIGATS     +E  +S G+SW      S++  GL+ S S+ GA   SFL F +A+ +GR
Sbjct  52   DIGATSYCVSELER-SSGGVSWGRAVGRSALLRGLVASASVLGAFCASFLVFAMAERIGR  110

Query  501  RRElmlssilyliggliTAFAPVY-------VIMVIGRFVYGVGIXLAMHAAP  638
            R E++  +  + +G + T  +             ++GR +YG G  LA HAAP
Sbjct  111  RGEMVRGAACFGVGTVFTFLSAELDDARAGITCFLLGRAIYGCGCALATHAAP  163



>ref|XP_005831465.1| hypothetical protein GUITHDRAFT_109605 [Guillardia theta CCMP2712]
 gb|EKX44485.1| hypothetical protein GUITHDRAFT_109605 [Guillardia theta CCMP2712]
Length=431

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 64/107 (60%), Gaps = 8/107 (7%)
 Frame = +3

Query  330  DIGATSCATISI--ESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD-FLGR  500
            DIGA+S A + I  E  T  G     L  VQ+GL+ SGSL+GA+  S     I D + GR
Sbjct  46   DIGASS-AVVRILGEKQTLFG----TLDPVQLGLVASGSLFGAVAASGALIFIGDRYFGR  100

Query  501  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIXLAMHAAPM  641
            ++EL+ S  LY +G  + A +  + +++  R +YG+GI  AMHAAP+
Sbjct  101  KQELIASGFLYTLGTALQAASSSFGMLIGSRILYGLGIGTAMHAAPL  147



>ref|WP_034274700.1| major facilitator transporter, partial [Actinospica robiniae]
Length=458

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +3

Query  396  YDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYV  575
            ++LS+ Q GLI S SL  A +G+F    +AD  GR+R   L +IL ++G L +AFAP   
Sbjct  54   WNLSTAQTGLINSISLLAAFLGAFFFGRVADLAGRKRTYGLLAILMVVGALASAFAPSLA  113

Query  576  IMVIGRFVYGVGI  614
             ++  RFV GVG+
Sbjct  114  WLLAARFVLGVGV  126



>gb|KJF15727.1| putative metabolite transport protein CsbC [Acidithrix ferrooxidans]
Length=213

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +3

Query  402  LSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIM  581
            +SS+   L+TS  L GA++G+F A  +AD +GRRR ++++++L+++G L   F+P  +++
Sbjct  57   ISSLDKELVTSLLLVGAMVGAFFAGKLADTIGRRRTVLITAVLFMVGVLGAGFSPSLLVL  116

Query  582  VIGRFVYGVGIXLAMHAAPM  641
            +I RFV GV +  A    P+
Sbjct  117  IIMRFVIGVAVGSASMVVPL  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750