BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF049C19

Length=471
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU37571.1|  hypothetical protein MIMGU_mgv1a002851mg                171   5e-47   Erythranthe guttata [common monkey flower]
ref|XP_011088070.1|  PREDICTED: vacuolar-sorting receptor 3-like        166   6e-45   Sesamum indicum [beniseed]
ref|XP_011001937.1|  PREDICTED: vacuolar-sorting receptor 3             158   3e-42   Populus euphratica
gb|AIY30334.1|  vacuolar-sorting receptor 3 protein                     149   4e-42   Ziziphus jujuba [Chinese jujube]
ref|XP_002298772.1|  hypothetical protein POPTR_0001s30160g             157   6e-42   Populus trichocarpa [western balsam poplar]
ref|XP_011030346.1|  PREDICTED: vacuolar-sorting receptor 3-like        157   1e-41   Populus euphratica
ref|XP_011092498.1|  PREDICTED: vacuolar-sorting receptor 3-like        156   1e-41   Sesamum indicum [beniseed]
ref|XP_006346308.1|  PREDICTED: vacuolar-sorting receptor 3-like        156   2e-41   Solanum tuberosum [potatoes]
ref|XP_004230700.1|  PREDICTED: vacuolar-sorting receptor 3             155   2e-41   Solanum lycopersicum
ref|XP_010272410.1|  PREDICTED: vacuolar-sorting receptor 3-like        154   9e-41   Nelumbo nucifera [Indian lotus]
gb|KJB32253.1|  hypothetical protein B456_005G231800                    153   1e-40   Gossypium raimondii
ref|XP_002527509.1|  zinc finger protein, putative                      153   1e-40   Ricinus communis
ref|XP_009349164.1|  PREDICTED: vacuolar-sorting receptor 3-like        153   2e-40   Pyrus x bretschneideri [bai li]
gb|KJB79450.1|  hypothetical protein B456_013G050300                    153   2e-40   Gossypium raimondii
ref|XP_009760191.1|  PREDICTED: vacuolar-sorting receptor 3-like        152   4e-40   Nicotiana sylvestris
ref|XP_009375671.1|  PREDICTED: vacuolar-sorting receptor 3-like        152   4e-40   
ref|XP_009598407.1|  PREDICTED: vacuolar-sorting receptor 3-like        152   4e-40   Nicotiana tomentosiformis
emb|CBI22461.3|  unnamed protein product                                152   5e-40   Vitis vinifera
gb|KHF97360.1|  Vacuolar-sorting receptor 3 -like protein               152   5e-40   Gossypium arboreum [tree cotton]
ref|XP_002264769.1|  PREDICTED: vacuolar-sorting receptor 3             152   5e-40   Vitis vinifera
ref|XP_010543160.1|  PREDICTED: vacuolar-sorting receptor 2             152   6e-40   Tarenaya hassleriana [spider flower]
ref|XP_002313909.1|  vacuolar sorting receptor protein BP-80            152   7e-40   Populus trichocarpa [western balsam poplar]
emb|CAN79862.1|  hypothetical protein VITISV_021998                     151   8e-40   Vitis vinifera
ref|XP_007042634.1|  Vaculolar sorting receptor 3 isoform 2             150   8e-40   
ref|XP_002309184.1|  vacuolar sorting receptor family protein           151   9e-40   Populus trichocarpa [western balsam poplar]
ref|XP_002881098.1|  hypothetical protein ARALYDRAFT_481940             150   1e-39   Arabidopsis lyrata subsp. lyrata
ref|XP_007042633.1|  Vaculolar sorting receptor 3 isoform 1             150   1e-39   Theobroma cacao [chocolate]
ref|XP_004496877.1|  PREDICTED: vacuolar-sorting receptor 1-like        150   2e-39   Cicer arietinum [garbanzo]
ref|XP_010510382.1|  PREDICTED: vacuolar-sorting receptor 2-like        150   2e-39   Camelina sativa [gold-of-pleasure]
gb|KJB12290.1|  hypothetical protein B456_002G010300                    150   2e-39   Gossypium raimondii
emb|CDO97275.1|  unnamed protein product                                150   2e-39   Coffea canephora [robusta coffee]
ref|XP_010469873.1|  PREDICTED: vacuolar-sorting receptor 2-like        150   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_008384516.1|  PREDICTED: vacuolar-sorting receptor 3-like        150   3e-39   
ref|XP_003517598.2|  PREDICTED: vacuolar-sorting receptor 1-like ...    150   3e-39   Glycine max [soybeans]
gb|KDP44487.1|  hypothetical protein JCGZ_16320                         149   4e-39   Jatropha curcas
ref|NP_180588.1|  vacuolar-sorting receptor 2                           149   4e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189637.1|  vacuolar-sorting receptor 2                        149   5e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010111675.1|  Vacuolar-sorting receptor 3                        149   5e-39   Morus notabilis
gb|KHN05603.1|  Vacuolar-sorting receptor 1                             149   5e-39   Glycine soja [wild soybean]
ref|XP_003538018.1|  PREDICTED: vacuolar-sorting receptor 1-like        149   5e-39   Glycine max [soybeans]
ref|XP_008348888.1|  PREDICTED: vacuolar-sorting receptor 3-like        149   7e-39   
ref|XP_010529937.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    148   9e-39   Tarenaya hassleriana [spider flower]
ref|XP_010529936.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    148   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_010687358.1|  PREDICTED: vacuolar-sorting receptor 4-like        148   1e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006849341.1|  hypothetical protein AMTR_s00164p00059220          147   1e-38   
ref|XP_008236323.1|  PREDICTED: vacuolar-sorting receptor 3             147   2e-38   Prunus mume [ume]
ref|XP_006398566.1|  hypothetical protein EUTSA_v10015537mg             147   2e-38   
ref|XP_010414284.1|  PREDICTED: vacuolar-sorting receptor 2             147   2e-38   Camelina sativa [gold-of-pleasure]
gb|AES62774.2|  vacuolar-sorting receptor-like protein                  147   2e-38   Medicago truncatula
gb|KEH44022.1|  vacuolar-sorting receptor-like protein                  147   2e-38   Medicago truncatula
ref|XP_010277061.1|  PREDICTED: vacuolar-sorting receptor 3-like        147   3e-38   Nelumbo nucifera [Indian lotus]
ref|XP_011457866.1|  PREDICTED: vacuolar-sorting receptor 3             147   3e-38   Fragaria vesca subsp. vesca
gb|KJB32252.1|  hypothetical protein B456_005G231800                    147   4e-38   Gossypium raimondii
gb|KJB32254.1|  hypothetical protein B456_005G231800                    146   4e-38   Gossypium raimondii
ref|XP_008455032.1|  PREDICTED: vacuolar-sorting receptor 3-like        146   5e-38   Cucumis melo [Oriental melon]
ref|XP_004159916.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    146   7e-38   
ref|XP_004136938.1|  PREDICTED: vacuolar-sorting receptor 3-like        146   7e-38   Cucumis sativus [cucumbers]
ref|XP_003592523.1|  Vacuolar-sorting receptor                          145   7e-38   
ref|XP_004137673.1|  PREDICTED: vacuolar-sorting receptor 1-like        145   9e-38   Cucumis sativus [cucumbers]
ref|XP_008442315.1|  PREDICTED: vacuolar-sorting receptor 1             145   9e-38   Cucumis melo [Oriental melon]
ref|XP_007199755.1|  hypothetical protein PRUPE_ppa002822mg             145   9e-38   Prunus persica
ref|XP_004173121.1|  PREDICTED: vacuolar-sorting receptor 3-like        144   1e-37   
ref|XP_006296113.1|  hypothetical protein CARUB_v10025264mg             145   1e-37   
ref|XP_006290748.1|  hypothetical protein CARUB_v10016844mg             145   1e-37   Capsella rubella
gb|KJB12295.1|  hypothetical protein B456_002G010300                    144   2e-37   Gossypium raimondii
emb|CDY04821.1|  BnaAnng00030D                                          145   2e-37   
ref|XP_004152276.1|  PREDICTED: vacuolar-sorting receptor 3-like        145   2e-37   Cucumis sativus [cucumbers]
gb|KJB71518.1|  hypothetical protein B456_011G126800                    144   2e-37   Gossypium raimondii
gb|KHN30433.1|  Vacuolar-sorting receptor 1                             145   2e-37   Glycine soja [wild soybean]
ref|XP_010547949.1|  PREDICTED: vacuolar-sorting receptor 3-like        144   2e-37   Tarenaya hassleriana [spider flower]
gb|KJB71519.1|  hypothetical protein B456_011G126800                    144   2e-37   Gossypium raimondii
ref|XP_006409641.1|  hypothetical protein EUTSA_v10022594mg             144   2e-37   Eutrema salsugineum [saltwater cress]
gb|KHG14060.1|  Vacuolar-sorting receptor 1 -like protein               144   3e-37   Gossypium arboreum [tree cotton]
ref|XP_011019003.1|  PREDICTED: vacuolar-sorting receptor 1-like        144   3e-37   Populus euphratica
ref|XP_006409638.1|  hypothetical protein EUTSA_v10022598mg             144   3e-37   Eutrema salsugineum [saltwater cress]
gb|KJB12294.1|  hypothetical protein B456_002G010300                    144   4e-37   Gossypium raimondii
gb|KJB12291.1|  hypothetical protein B456_002G010300                    144   4e-37   Gossypium raimondii
ref|XP_003555992.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    144   4e-37   Glycine max [soybeans]
gb|KHN42313.1|  Vacuolar-sorting receptor 1                             144   5e-37   Glycine soja [wild soybean]
emb|CDX91478.1|  BnaC04g06720D                                          144   5e-37   
gb|KJB12292.1|  hypothetical protein B456_002G010300                    144   5e-37   Gossypium raimondii
ref|XP_009143376.1|  PREDICTED: vacuolar-sorting receptor 1-like        143   5e-37   Brassica rapa
gb|KHN06808.1|  Vacuolar-sorting receptor 1                             144   5e-37   Glycine soja [wild soybean]
ref|XP_003536576.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    144   5e-37   Glycine max [soybeans]
ref|XP_008454392.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    144   5e-37   Cucumis melo [Oriental melon]
ref|XP_008454393.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    144   5e-37   Cucumis melo [Oriental melon]
ref|XP_002528694.1|  Vacuolar sorting receptor 1 precursor, putative    143   5e-37   Ricinus communis
gb|KFK24686.1|  hypothetical protein AALP_AA8G011700                    143   6e-37   Arabis alpina [alpine rockcress]
gb|KDO57883.1|  hypothetical protein CISIN_1g006786mg                   141   7e-37   Citrus sinensis [apfelsine]
ref|XP_002885935.1|  VSR-2                                              143   7e-37   
gb|ABR17683.1|  unknown                                                 143   7e-37   Picea sitchensis
ref|XP_006300216.1|  hypothetical protein CARUB_v10016452mg             143   8e-37   Capsella rubella
ref|XP_010488908.1|  PREDICTED: vacuolar-sorting receptor 4             143   9e-37   Camelina sativa [gold-of-pleasure]
gb|KFK39977.1|  hypothetical protein AALP_AA3G313900                    143   1e-36   Arabis alpina [alpine rockcress]
ref|NP_179081.1|  vacuolar-sorting receptor 3                           142   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488909.1|  PREDICTED: vacuolar-sorting receptor 3             142   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002883854.1|  hypothetical protein ARALYDRAFT_899691             142   1e-36   
ref|XP_009136249.1|  PREDICTED: vacuolar-sorting receptor 3             142   1e-36   Brassica rapa
ref|XP_007033521.1|  Vacuolar sorting receptor isoform 1                142   1e-36   
emb|CDY65441.1|  BnaCnng47180D                                          142   1e-36   Brassica napus [oilseed rape]
gb|KFK39979.1|  hypothetical protein AALP_AA3G314200                    142   1e-36   Arabis alpina [alpine rockcress]
ref|NP_179079.1|  vacuolar-sorting receptor 4                           142   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007033523.1|  Vacuolar sorting receptor isoform 3                142   1e-36   
ref|XP_006429591.1|  hypothetical protein CICLE_v10011298mg             142   1e-36   Citrus clementina [clementine]
gb|AAN60346.1|  unknown                                                 136   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517675.1|  PREDICTED: vacuolar-sorting receptor 4-like        142   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_007157213.1|  hypothetical protein PHAVU_002G052000g             142   2e-36   Phaseolus vulgaris [French bean]
emb|CDY60753.1|  BnaA05g34780D                                          142   2e-36   Brassica napus [oilseed rape]
gb|KGN58683.1|  hypothetical protein Csa_3G728010                       141   2e-36   Cucumis sativus [cucumbers]
ref|XP_010467255.1|  PREDICTED: vacuolar-sorting receptor 4-like        142   2e-36   Camelina sativa [gold-of-pleasure]
gb|KDO64109.1|  hypothetical protein CISIN_1g0100101mg                  139   2e-36   Citrus sinensis [apfelsine]
emb|CDX73599.1|  BnaC08g24040D                                          142   3e-36   
emb|CDY38157.1|  BnaA07g02260D                                          139   3e-36   Brassica napus [oilseed rape]
ref|XP_008669942.1|  PREDICTED: vacuolar-sorting receptor 1-like        141   3e-36   Zea mays [maize]
ref|XP_010547948.1|  PREDICTED: vacuolar-sorting receptor 3             141   4e-36   Tarenaya hassleriana [spider flower]
ref|XP_009801642.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    141   4e-36   Nicotiana sylvestris
ref|XP_009123210.1|  PREDICTED: vacuolar-sorting receptor 3-like        141   4e-36   Brassica rapa
ref|XP_009801640.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    141   4e-36   Nicotiana sylvestris
gb|KDO64107.1|  hypothetical protein CISIN_1g0100101mg                  139   5e-36   Citrus sinensis [apfelsine]
emb|CDY37219.1|  BnaA09g08400D                                          141   5e-36   Brassica napus [oilseed rape]
gb|KDO57886.1|  hypothetical protein CISIN_1g006786mg                   140   5e-36   Citrus sinensis [apfelsine]
gb|KDO64106.1|  hypothetical protein CISIN_1g0100101mg                  139   5e-36   Citrus sinensis [apfelsine]
gb|KCW63607.1|  hypothetical protein EUGRSUZ_G01233                     140   5e-36   Eucalyptus grandis [rose gum]
pir||T00044  vacuolar sorting receptor protein homolog PV72 - cuc...    140   5e-36
ref|XP_009115984.1|  PREDICTED: vacuolar-sorting receptor 1             140   6e-36   Brassica rapa
emb|CDX81459.1|  BnaC09g08700D                                          140   6e-36   
gb|KDO57884.1|  hypothetical protein CISIN_1g006786mg                   140   6e-36   Citrus sinensis [apfelsine]
gb|KDO57885.1|  hypothetical protein CISIN_1g006786mg                   140   6e-36   Citrus sinensis [apfelsine]
ref|XP_010467256.1|  PREDICTED: vacuolar-sorting receptor 3-like        140   7e-36   Camelina sativa [gold-of-pleasure]
ref|XP_009384326.1|  PREDICTED: vacuolar-sorting receptor 1-like        140   7e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006486921.1|  PREDICTED: vacuolar-sorting receptor 3-like        140   7e-36   Citrus sinensis [apfelsine]
ref|XP_006422827.1|  hypothetical protein CICLE_v10028015mg             140   7e-36   Citrus clementina [clementine]
ref|XP_010065899.1|  PREDICTED: vacuolar-sorting receptor 1-like        140   7e-36   Eucalyptus grandis [rose gum]
ref|XP_004302536.1|  PREDICTED: vacuolar-sorting receptor 1-like        140   7e-36   Fragaria vesca subsp. vesca
ref|XP_007143116.1|  hypothetical protein PHAVU_007G045100g             140   7e-36   Phaseolus vulgaris [French bean]
pdb|4TJV|A  Chain A, Crystal Structure Of Protease-associated Dom...    133   9e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297095.1|  hypothetical protein CARUB_v10013097mg             140   1e-35   
gb|AGV54776.1|  vacuolar-sorting receptor                               140   1e-35   Phaseolus vulgaris [French bean]
emb|CDX78128.1|  BnaA09g33230D                                          140   1e-35   
ref|XP_009410512.1|  PREDICTED: vacuolar-sorting receptor 1             140   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_190853.1|  vacuolar-sorting receptor 1                           140   1e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AAB72111.1|  vacuolar sorting receptor homolog                       139   1e-35   Arabidopsis thaliana [mouse-ear cress]
gb|AAK82551.1|  AT3g52850/F8J2_20                                       139   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426913.1|  PREDICTED: vacuolar-sorting receptor 1-like        139   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010252051.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    139   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010039169.1|  PREDICTED: vacuolar-sorting receptor 1-like        132   2e-35   
ref|XP_009125765.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    139   2e-35   Brassica rapa
gb|EMT19677.1|  Vacuolar-sorting receptor 1                             139   2e-35   
ref|XP_011002594.1|  PREDICTED: vacuolar-sorting receptor 1-like        139   3e-35   Populus euphratica
emb|CDP06387.1|  unnamed protein product                                139   3e-35   Coffea canephora [robusta coffee]
ref|XP_008788526.1|  PREDICTED: vacuolar-sorting receptor 1-like        139   3e-35   Phoenix dactylifera
ref|XP_010517715.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    139   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010517708.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    138   4e-35   Camelina sativa [gold-of-pleasure]
ref|XP_008370266.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    138   4e-35   
ref|XP_008370265.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    138   4e-35   
ref|XP_006403762.1|  hypothetical protein EUTSA_v10010181mg             139   4e-35   
gb|KHG23770.1|  Vacuolar-sorting receptor 1 -like protein               138   4e-35   Gossypium arboreum [tree cotton]
ref|XP_009611966.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    138   4e-35   Nicotiana tomentosiformis
ref|XP_009611965.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    138   4e-35   Nicotiana tomentosiformis
ref|XP_004977384.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    138   4e-35   
ref|XP_004978527.1|  PREDICTED: vacuolar-sorting receptor 1-like        138   4e-35   
ref|XP_002876170.1|  hypothetical protein ARALYDRAFT_906663             138   5e-35   Arabidopsis lyrata subsp. lyrata
gb|EPS57970.1|  hypothetical protein M569_16845                         137   6e-35   Genlisea aurea
gb|KJB29888.1|  hypothetical protein B456_005G122400                    138   6e-35   Gossypium raimondii
gb|KJB29887.1|  hypothetical protein B456_005G122400                    138   6e-35   Gossypium raimondii
gb|KJB29886.1|  hypothetical protein B456_005G122400                    138   6e-35   Gossypium raimondii
gb|AAB72112.1|  vacuolar sorting receptor homolog                       138   6e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504032.1|  PREDICTED: vacuolar-sorting receptor 1             138   6e-35   Camelina sativa [gold-of-pleasure]
dbj|BAK03786.1|  predicted protein                                      138   6e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006403761.1|  hypothetical protein EUTSA_v10010181mg             137   7e-35   Eutrema salsugineum [saltwater cress]
gb|EMT24279.1|  Vacuolar-sorting receptor 1                             137   7e-35   
ref|XP_007207200.1|  hypothetical protein PRUPE_ppa002877mg             137   8e-35   Prunus persica
ref|XP_010253065.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    137   8e-35   Nelumbo nucifera [Indian lotus]
ref|XP_004510100.1|  PREDICTED: vacuolar-sorting receptor 1-like        137   9e-35   Cicer arietinum [garbanzo]
ref|XP_006362349.1|  PREDICTED: vacuolar-sorting receptor 1-like        137   9e-35   Solanum tuberosum [potatoes]
gb|KFK34530.1|  hypothetical protein AALP_AA5G158000                    137   1e-34   Arabis alpina [alpine rockcress]
gb|EEE52644.1|  hypothetical protein OsJ_35003                          136   1e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010327707.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    137   2e-34   Solanum lycopersicum
tpg|DAA39323.1|  TPA: hypothetical protein ZEAMMB73_720222              137   2e-34   
ref|XP_010327706.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    137   2e-34   Solanum lycopersicum
ref|XP_009611473.1|  PREDICTED: vacuolar-sorting receptor 1-like        136   2e-34   Nicotiana tomentosiformis
ref|XP_002450144.1|  hypothetical protein SORBIDRAFT_05g001160          136   2e-34   Sorghum bicolor [broomcorn]
gb|EEC67546.1|  hypothetical protein OsI_34875                          136   2e-34   Oryza sativa Indica Group [Indian rice]
gb|EEE51529.1|  hypothetical protein OsJ_32728                          136   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004511311.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    137   2e-34   
ref|XP_009775401.1|  PREDICTED: vacuolar-sorting receptor 1-like        136   2e-34   Nicotiana sylvestris
ref|NP_001169650.1|  hypothetical protein precursor                     135   2e-34   
gb|EEC68730.1|  hypothetical protein OsI_37233                          136   2e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_003529053.2|  PREDICTED: vacuolar-sorting receptor 1-like        136   3e-34   Glycine max [soybeans]
ref|XP_003579018.1|  PREDICTED: vacuolar-sorting receptor 1             136   3e-34   Brachypodium distachyon [annual false brome]
ref|XP_008677615.1|  PREDICTED: uncharacterized protein LOC100383...    136   3e-34   
ref|XP_006411071.1|  hypothetical protein EUTSA_v10016384mg             136   3e-34   Eutrema salsugineum [saltwater cress]
ref|NP_001065992.1|  Os12g0116000                                       137   3e-34   
dbj|BAK00302.1|  predicted protein                                      136   4e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN66483.1|  hypothetical protein VITISV_015390                     135   5e-34   Vitis vinifera
ref|XP_006842496.1|  hypothetical protein AMTR_s00077p00095230          135   5e-34   Amborella trichopoda
ref|XP_010931377.1|  PREDICTED: vacuolar-sorting receptor 1-like        135   5e-34   Elaeis guineensis
ref|XP_008244809.1|  PREDICTED: vacuolar-sorting receptor 1-like        135   5e-34   Prunus mume [ume]
ref|XP_002267833.2|  PREDICTED: vacuolar-sorting receptor 1             134   9e-34   Vitis vinifera
ref|XP_010515761.1|  PREDICTED: vacuolar-sorting receptor 1-like        134   1e-33   
ref|XP_010253066.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    134   1e-33   Nelumbo nucifera [Indian lotus]
emb|CDY13344.1|  BnaC06g14130D                                          134   1e-33   Brassica napus [oilseed rape]
ref|XP_010093546.1|  Vacuolar-sorting receptor 1                        134   1e-33   Morus notabilis
gb|KDP21863.1|  hypothetical protein JCGZ_00650                         134   1e-33   Jatropha curcas
ref|XP_010922756.1|  PREDICTED: vacuolar-sorting receptor 1-like        134   2e-33   
ref|XP_009125234.1|  PREDICTED: vacuolar-sorting receptor 1-like        133   2e-33   Brassica rapa
emb|CDX67539.1|  BnaA07g15790D                                          133   3e-33   
sp|P93484.1|VSR1_PEA  RecName: Full=Vacuolar-sorting receptor 1; ...    133   4e-33   Pisum sativum [garden pea]
ref|XP_008792241.1|  PREDICTED: vacuolar-sorting receptor 1-like        132   5e-33   Phoenix dactylifera
ref|XP_006650048.1|  PREDICTED: vacuolar-sorting receptor 1-like        132   7e-33   Oryza brachyantha
ref|XP_003626680.1|  Vacuolar sorting receptor                          132   8e-33   Medicago truncatula
ref|XP_003521852.1|  PREDICTED: vacuolar-sorting receptor 1-like        132   9e-33   Glycine max [soybeans]
gb|KHN42141.1|  Vacuolar-sorting receptor 2                             132   9e-33   Glycine soja [wild soybean]
ref|XP_004511312.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    132   9e-33   Cicer arietinum [garbanzo]
gb|EMS51356.1|  Vacuolar-sorting receptor 1                             131   1e-32   Triticum urartu
ref|XP_003623631.1|  Vacuolar sorting receptor                          131   2e-32   Medicago truncatula
ref|XP_002992389.1|  hypothetical protein SELMODRAFT_269926             131   2e-32   
ref|XP_002967764.1|  hypothetical protein SELMODRAFT_169577             130   2e-32   Selaginella moellendorffii
ref|NP_001275302.1|  vacuolar sorting receptor protein PV72-like ...    130   2e-32   Solanum tuberosum [potatoes]
ref|XP_010043186.1|  PREDICTED: vacuolar-sorting receptor 1-like        130   3e-32   Eucalyptus grandis [rose gum]
ref|XP_002968618.1|  hypothetical protein SELMODRAFT_440462             130   4e-32   Selaginella moellendorffii
ref|XP_002975863.1|  hypothetical protein SELMODRAFT_175218             130   4e-32   
ref|XP_003610620.1|  Vacuolar-sorting receptor                          130   4e-32   
ref|XP_006341299.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    129   5e-32   Solanum tuberosum [potatoes]
ref|XP_009372030.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    130   5e-32   Pyrus x bretschneideri [bai li]
ref|XP_009372028.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    130   5e-32   Pyrus x bretschneideri [bai li]
ref|XP_009388213.1|  PREDICTED: vacuolar-sorting receptor 1-like        129   6e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011095146.1|  PREDICTED: vacuolar-sorting receptor 1-like        129   7e-32   Sesamum indicum [beniseed]
gb|EMS62484.1|  Vacuolar-sorting receptor 1                             130   9e-32   Triticum urartu
ref|XP_002467906.1|  hypothetical protein SORBIDRAFT_01g036170          129   9e-32   Sorghum bicolor [broomcorn]
ref|XP_006658133.1|  PREDICTED: vacuolar-sorting receptor 1-like        129   9e-32   Oryza brachyantha
gb|EEC82690.1|  hypothetical protein OsI_27347                          129   9e-32   Oryza sativa Indica Group [Indian rice]
gb|EYU35791.1|  hypothetical protein MIMGU_mgv1a002876mg                129   1e-31   Erythranthe guttata [common monkey flower]
ref|NP_001060643.1|  Os07g0680000                                       129   1e-31   
ref|XP_006663158.1|  PREDICTED: vacuolar-sorting receptor 1-like        129   1e-31   Oryza brachyantha
gb|EPS72005.1|  hypothetical protein M569_02753                         128   1e-31   Genlisea aurea
ref|XP_004492565.1|  PREDICTED: vacuolar-sorting receptor 1-like        129   1e-31   Cicer arietinum [garbanzo]
ref|XP_008660179.1|  PREDICTED: vacuolar-sorting receptor 1             128   2e-31   
ref|XP_004984466.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    128   3e-31   Setaria italica
ref|XP_004984464.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    128   3e-31   
ref|XP_006664280.1|  PREDICTED: vacuolar-sorting receptor 1-like        128   3e-31   Oryza brachyantha
gb|EEC66779.1|  hypothetical protein OsI_33169                          122   4e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_009404782.1|  PREDICTED: vacuolar-sorting receptor 4-like        127   5e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG44286.1|  vacuolar sorting receptor 3 precursor                   126   5e-31   Zea mays [maize]
ref|XP_004984465.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    127   5e-31   
ref|XP_004984463.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    127   6e-31   
gb|EYU42029.1|  hypothetical protein MIMGU_mgv1a002928mg                127   6e-31   Erythranthe guttata [common monkey flower]
ref|XP_011086922.1|  PREDICTED: vacuolar-sorting receptor 1-like        126   1e-30   Sesamum indicum [beniseed]
gb|AFW68894.1|  hypothetical protein ZEAMMB73_054159                    125   1e-30   
gb|ACN30885.1|  unknown                                                 125   2e-30   Zea mays [maize]
ref|NP_001130741.1|  uncharacterized protein LOC100191845 precursor     125   2e-30   Zea mays [maize]
ref|XP_004246285.1|  PREDICTED: vacuolar-sorting receptor 1-like        125   2e-30   Solanum lycopersicum
gb|AAF80450.1|AF161719_1  vacuolar targeting receptor bp-80             125   2e-30   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004959891.1|  PREDICTED: vacuolar-sorting receptor 1-like        125   2e-30   
ref|XP_010228654.1|  PREDICTED: vacuolar-sorting receptor 1-like        125   3e-30   Brachypodium distachyon [annual false brome]
ref|XP_004983263.1|  PREDICTED: vacuolar-sorting receptor 3-like        125   4e-30   Setaria italica
ref|XP_007134557.1|  hypothetical protein PHAVU_010G057200g             124   4e-30   Phaseolus vulgaris [French bean]
ref|XP_007140077.1|  hypothetical protein PHAVU_008G082200g             124   5e-30   Phaseolus vulgaris [French bean]
ref|XP_008388357.1|  PREDICTED: vacuolar-sorting receptor 1-like        124   5e-30   
ref|XP_003552313.1|  PREDICTED: vacuolar-sorting receptor 1-like        124   5e-30   Glycine max [soybeans]
gb|KHN40635.1|  Vacuolar-sorting receptor 1                             124   6e-30   Glycine soja [wild soybean]
gb|EMT18407.1|  Vacuolar-sorting receptor 1                             124   7e-30   
gb|AAN05373.1|  Putative vacuolar sorting receptor protein              124   8e-30   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064400.1|  Os10g0346600                                       124   8e-30   
ref|XP_006661708.1|  PREDICTED: vacuolar-sorting receptor 3-like        123   2e-29   Oryza brachyantha
ref|XP_010942821.1|  PREDICTED: vacuolar-sorting receptor 1-like        123   2e-29   Elaeis guineensis
gb|AFW68896.1|  hypothetical protein ZEAMMB73_054159                    122   2e-29   
ref|XP_009421105.1|  PREDICTED: vacuolar-sorting receptor 3-like        122   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003534638.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    122   3e-29   Glycine max [soybeans]
ref|XP_010233902.1|  PREDICTED: vacuolar-sorting receptor 1-like        122   3e-29   Brachypodium distachyon [annual false brome]
ref|XP_008805693.1|  PREDICTED: vacuolar-sorting receptor 3-like        122   3e-29   Phoenix dactylifera
gb|AFW68895.1|  hypothetical protein ZEAMMB73_054159                    122   4e-29   
dbj|BAB64531.1|  vacuolar sorting receptor                              122   4e-29   Vigna mungo [urad dal]
dbj|BAK05589.1|  predicted protein                                      122   5e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA45229.1|  TPA: hypothetical protein ZEAMMB73_518849              121   5e-29   
ref|XP_008787225.1|  PREDICTED: vacuolar-sorting receptor 3-like        120   9e-29   
ref|XP_010683480.1|  PREDICTED: vacuolar-sorting receptor 1-like        120   1e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008655380.1|  PREDICTED: vacuolar-sorting receptor 1-like        119   1e-28   
ref|XP_010938945.1|  PREDICTED: vacuolar-sorting receptor 3-like        120   1e-28   Elaeis guineensis
ref|NP_001050034.1|  Os03g0335300                                       120   1e-28   
tpg|DAA39320.1|  TPA: hypothetical protein ZEAMMB73_030788              113   2e-28   
ref|XP_002463394.1|  hypothetical protein SORBIDRAFT_02g043010          119   6e-28   
gb|KJB38063.1|  hypothetical protein B456_006G235500                    116   2e-27   
ref|XP_010036004.1|  PREDICTED: vacuolar-sorting receptor 1-like        117   3e-27   
ref|XP_003573873.1|  PREDICTED: vacuolar-sorting receptor 1-like        116   5e-27   
ref|NP_001169232.1|  hypothetical protein precursor                     116   5e-27   
gb|ABR17707.1|  unknown                                                 116   6e-27   
ref|XP_001785165.1|  predicted protein                                  114   2e-26   
gb|EPS73119.1|  hypothetical protein M569_01632                         114   2e-26   
ref|XP_001751750.1|  predicted protein                                  114   4e-26   
ref|XP_009387954.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    110   2e-25   
ref|XP_009387953.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    111   3e-25   
gb|KHN42446.1|  Vacuolar-sorting receptor 4                             102   1e-24   
gb|AFW68893.1|  hypothetical protein ZEAMMB73_054159                    109   1e-24   
ref|XP_011008227.1|  PREDICTED: vacuolar-sorting receptor 6-like        108   3e-24   
ref|XP_001765481.1|  predicted protein                                  108   4e-24   
ref|XP_002297915.2|  hypothetical protein POPTR_0001s12220g             108   4e-24   
ref|XP_002304606.1|  vacuolar sorting receptor family protein           107   5e-24   
ref|XP_006853456.1|  hypothetical protein AMTR_s00032p00189440          107   8e-24   
ref|XP_001776090.1|  predicted protein                                  107   8e-24   
gb|EEC81131.1|  hypothetical protein OsI_24020                          107   9e-24   
ref|NP_001058298.1|  Os06g0664300                                       107   9e-24   
ref|XP_002489190.1|  hypothetical protein SORBIDRAFT_0013s004040        102   1e-23   
ref|XP_004965628.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    106   1e-23   
ref|XP_004965629.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    106   1e-23   
tpg|DAA45230.1|  TPA: hypothetical protein ZEAMMB73_518849              104   2e-23   
tpg|DAA45231.1|  TPA: hypothetical protein ZEAMMB73_518849              101   2e-23   
ref|XP_009393260.1|  PREDICTED: vacuolar-sorting receptor 6             105   3e-23   
ref|XP_011022310.1|  PREDICTED: vacuolar-sorting receptor 6             105   4e-23   
ref|XP_010260770.1|  PREDICTED: vacuolar-sorting receptor 7             104   6e-23   
ref|XP_002437414.1|  hypothetical protein SORBIDRAFT_10g026544          104   1e-22   
ref|XP_009408244.1|  PREDICTED: vacuolar-sorting receptor 7             103   1e-22   
ref|NP_001152485.1|  vacuolar sorting receptor 7 precursor              103   2e-22   
gb|AFW87686.1|  vacuolar sorting receptor 7                             103   2e-22   
gb|ACN28195.1|  unknown                                                 103   2e-22   
gb|EMT30552.1|  hypothetical protein F775_21497                         103   2e-22   
emb|CBI27239.3|  unnamed protein product                                103   2e-22   
ref|XP_004232618.1|  PREDICTED: vacuolar-sorting receptor 6-like        103   3e-22   
emb|CBI32834.3|  unnamed protein product                              97.8    3e-22   
ref|XP_006363163.1|  PREDICTED: vacuolar-sorting receptor 6-like        102   3e-22   
ref|XP_002275462.3|  PREDICTED: vacuolar-sorting receptor 6-like        102   3e-22   
ref|XP_009616647.1|  PREDICTED: vacuolar-sorting receptor 6-like        102   4e-22   
gb|EMT28756.1|  hypothetical protein F775_27608                       96.7    5e-22   
ref|XP_001777810.1|  predicted protein                                  102   7e-22   
emb|CDX93144.1|  BnaA03g38660D                                          101   7e-22   
ref|XP_006656342.1|  PREDICTED: vacuolar-sorting receptor 6-like        101   7e-22   
ref|XP_001759820.1|  predicted protein                                  101   1e-21   
ref|XP_009794444.1|  PREDICTED: vacuolar-sorting receptor 6-like        101   1e-21   
dbj|BAJ97179.1|  predicted protein                                      101   1e-21   
ref|XP_003563336.1|  PREDICTED: vacuolar-sorting receptor 6             101   1e-21   
ref|XP_010914289.1|  PREDICTED: vacuolar-sorting receptor 6             101   1e-21   
emb|CDP18160.1|  unnamed protein product                                100   1e-21   
dbj|BAJ91572.1|  predicted protein                                      101   1e-21   
ref|XP_010684292.1|  PREDICTED: vacuolar-sorting receptor 7-like        100   2e-21   
gb|KJB48040.1|  hypothetical protein B456_008G051500                    100   2e-21   
ref|XP_001759928.1|  predicted protein                                  100   2e-21   
gb|KHG13712.1|  Vacuolar-sorting receptor 6 -like protein               100   2e-21   
gb|AFK35926.1|  unknown                                               96.7    3e-21   
ref|XP_004293795.1|  PREDICTED: vacuolar-sorting receptor 6           99.8    4e-21   
dbj|BAJ88964.1|  predicted protein                                    99.8    4e-21   
ref|XP_007040993.1|  Vacuolar sorting receptor 7                      99.8    5e-21   
gb|KDO77202.1|  hypothetical protein CISIN_1g0067882mg                98.2    7e-21   
ref|XP_008802338.1|  PREDICTED: vacuolar-sorting receptor 6-like      98.6    1e-20   
ref|XP_006448589.1|  hypothetical protein CICLE_v10014573mg           98.2    1e-20   
ref|XP_006468586.1|  PREDICTED: vacuolar-sorting receptor 6-like      98.2    2e-20   
ref|XP_006448590.1|  hypothetical protein CICLE_v10014573mg           98.2    2e-20   
gb|KDO77200.1|  hypothetical protein CISIN_1g0067882mg                97.8    2e-20   
gb|KEH37345.1|  vacuolar-sorting receptor                             97.8    2e-20   
ref|XP_006448592.1|  hypothetical protein CICLE_v10014573mg           97.8    2e-20   
ref|XP_010941716.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  97.4    2e-20   
ref|XP_011096860.1|  PREDICTED: vacuolar-sorting receptor 6           97.4    2e-20   
dbj|BAK00261.1|  predicted protein                                    97.4    2e-20   
gb|KDO77204.1|  hypothetical protein CISIN_1g0067882mg                95.5    3e-20   
ref|XP_010941715.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  97.1    3e-20   
gb|EYU43627.1|  hypothetical protein MIMGU_mgv1a002747mg              97.1    3e-20   
ref|XP_003581645.1|  PREDICTED: vacuolar-sorting receptor 7-like      97.1    4e-20   
gb|KJB48042.1|  hypothetical protein B456_008G051500                  96.3    4e-20   
gb|KDO77203.1|  hypothetical protein CISIN_1g0067882mg                95.5    6e-20   
ref|XP_004487890.1|  PREDICTED: vacuolar-sorting receptor 6-like      96.3    7e-20   
ref|XP_008805925.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  95.9    8e-20   
gb|KJB48041.1|  hypothetical protein B456_008G051500                  95.9    8e-20   
gb|EEE61664.1|  hypothetical protein OsJ_16123                        95.5    1e-19   
emb|CAE03573.2|  OSJNBa0085I10.18                                     95.5    1e-19   
gb|KDP43132.1|  hypothetical protein JCGZ_26665                       95.1    1e-19   
ref|NP_001053838.1|  Os04g0611400                                     95.1    1e-19   
ref|XP_007212810.1|  hypothetical protein PRUPE_ppa002849mg           94.4    3e-19   
ref|XP_008439432.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  94.0    3e-19   
ref|XP_008439431.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  94.0    4e-19   
ref|XP_004134519.1|  PREDICTED: vacuolar-sorting receptor 6-like      94.0    4e-19   
ref|XP_004976775.1|  PREDICTED: vacuolar-sorting receptor 6-like      93.6    5e-19   
ref|XP_009340258.1|  PREDICTED: vacuolar-sorting receptor 6-like      93.2    8e-19   
ref|XP_008372129.1|  PREDICTED: vacuolar-sorting receptor 7-like      89.4    1e-18   
ref|XP_010537030.1|  PREDICTED: vacuolar-sorting receptor 7           91.3    4e-18   
ref|XP_008225932.1|  PREDICTED: vacuolar-sorting receptor 7           90.9    4e-18   
ref|XP_002447079.1|  hypothetical protein SORBIDRAFT_06g028180        90.9    5e-18   
gb|EAZ37923.1|  hypothetical protein OsJ_22274                        85.1    6e-18   
gb|EMT02959.1|  Vacuolar-sorting receptor 4                           90.1    8e-18   
ref|XP_003064631.1|  predicted protein                                90.5    8e-18   
ref|XP_008383256.1|  PREDICTED: vacuolar-sorting receptor 6-like      90.1    8e-18   
ref|XP_003546387.1|  PREDICTED: vacuolar-sorting receptor 6-like      89.0    2e-17   
ref|XP_009368555.1|  PREDICTED: vacuolar-sorting receptor 7-like      88.6    3e-17   
ref|XP_009363270.1|  PREDICTED: vacuolar-sorting receptor 6-like      88.6    3e-17   
ref|XP_010100622.1|  Vacuolar-sorting receptor 6                      88.6    3e-17   
gb|KFK28654.1|  hypothetical protein AALP_AA7G027800                  88.6    3e-17   
ref|XP_008371928.1|  PREDICTED: vacuolar-sorting receptor 6-like      88.2    4e-17   
gb|EYU23258.1|  hypothetical protein MIMGU_mgv1a0227552mg             85.5    4e-17   
ref|XP_007138862.1|  hypothetical protein PHAVU_009G243800g           87.8    5e-17   
gb|EMS45035.1|  hypothetical protein TRIUR3_18121                     83.2    5e-17   
ref|XP_005848603.1|  hypothetical protein CHLNCDRAFT_144100           87.8    6e-17   
gb|KCW75576.1|  hypothetical protein EUGRSUZ_E04321                   86.7    8e-17   
ref|XP_003603017.1|  Vacuolar sorting receptor                        81.6    1e-16   
emb|CDY50060.1|  BnaCnng18670D                                        87.0    1e-16   
ref|XP_009133482.1|  PREDICTED: vacuolar-sorting receptor 7           87.0    1e-16   
emb|CDX78975.1|  BnaA01g10420D                                        86.7    1e-16   
gb|EMS67136.1|  hypothetical protein TRIUR3_12943                     86.7    1e-16   
ref|XP_003534862.1|  PREDICTED: vacuolar-sorting receptor 6-like      86.7    1e-16   
gb|KCW75573.1|  hypothetical protein EUGRSUZ_E04321                   86.3    2e-16   
emb|CDY43178.1|  BnaCnng11060D                                        86.3    2e-16   
gb|KFK41675.1|  hypothetical protein AALP_AA2G158300                  86.3    2e-16   
ref|XP_010058066.1|  PREDICTED: vacuolar-sorting receptor 6           86.3    2e-16   
gb|EMT00254.1|  hypothetical protein F775_19349                       80.9    3e-16   
emb|CDY02347.1|  BnaA09g25550D                                        85.5    3e-16   
ref|XP_002536854.1|  hypothetical protein RCOM_1789310                80.1    3e-16   
ref|XP_009115026.1|  PREDICTED: vacuolar-sorting receptor 6           85.5    3e-16   
ref|XP_002890913.1|  hypothetical protein ARALYDRAFT_313733           85.1    4e-16   
gb|AAF98196.1|AC000107_19  F17F8.23                                   85.1    5e-16   
ref|NP_174375.1|  vacuolar sorting receptor 6                         85.1    5e-16   
ref|XP_006306993.1|  hypothetical protein CARUB_v10008569mg           85.1    5e-16   
ref|XP_005643138.1|  hypothetical protein COCSUDRAFT_26335            85.1    6e-16   
ref|XP_006415395.1|  hypothetical protein EUTSA_v10007059mg           84.7    7e-16   
ref|NP_001190777.1|  vacuolar-sorting receptor 7                      84.7    7e-16   
ref|NP_193744.1|  vacuolar-sorting receptor 7                         84.7    7e-16   
emb|CAA16619.1|  vacuolar sorting receptor-like protein               84.7    7e-16   
gb|AAM96969.1|  vacuolar sorting receptor-like protein                84.3    8e-16   
ref|XP_006413899.1|  hypothetical protein EUTSA_v10024676mg           84.3    9e-16   
ref|XP_010460907.1|  PREDICTED: vacuolar-sorting receptor 6-like      83.2    2e-15   
ref|XP_010478532.1|  PREDICTED: vacuolar-sorting receptor 6           83.2    2e-15   
ref|XP_010499644.1|  PREDICTED: vacuolar-sorting receptor 6-like      83.2    2e-15   
ref|XP_002869948.1|  hypothetical protein ARALYDRAFT_492857           82.8    3e-15   
gb|AES73268.2|  vacuolar sorting receptor protein, putative           77.0    3e-15   
ref|XP_010449220.1|  PREDICTED: vacuolar-sorting receptor 7-like      82.4    4e-15   
ref|XP_010434318.1|  PREDICTED: vacuolar-sorting receptor 7           82.4    4e-15   
ref|XP_010439615.1|  PREDICTED: vacuolar-sorting receptor 7-like      82.4    4e-15   
ref|XP_010509684.1|  PREDICTED: vacuolar-sorting receptor 5           81.6    8e-15   
gb|EMS63262.1|  Vacuolar-sorting receptor 1                           80.1    4e-14   
ref|NP_181040.1|  vacuolar-sorting receptor 5                         79.3    5e-14   
ref|XP_006295863.1|  hypothetical protein CARUB_v10024993mg           79.0    6e-14   
ref|XP_006283299.1|  hypothetical protein CARUB_v10004337mg           77.8    2e-13   
ref|XP_009141412.1|  PREDICTED: vacuolar-sorting receptor 5           77.4    2e-13   
gb|ACS91931.1|  vacuolar sorting receptor protein                     77.4    2e-13   
emb|CDY64650.1|  BnaAnng19540D                                        77.4    2e-13   
ref|XP_010504984.1|  PREDICTED: vacuolar-sorting receptor 5-like ...  76.6    4e-13   
ref|XP_010504983.1|  PREDICTED: vacuolar-sorting receptor 5-like ...  76.6    4e-13   
ref|XP_010519023.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...  76.3    6e-13   
ref|XP_002501193.1|  predicted protein                                75.9    7e-13   
emb|CDY43647.1|  BnaA04g20440D                                        75.5    9e-13   
ref|XP_010516663.1|  PREDICTED: vacuolar-sorting receptor 5-like      75.1    1e-12   
ref|XP_002879526.1|  hypothetical protein ARALYDRAFT_321210           73.6    4e-12   
ref|XP_011401748.1|  Vacuolar-sorting receptor 1                      70.9    3e-11   
ref|XP_006410651.1|  hypothetical protein EUTSA_v10016381mg           70.9    3e-11   
ref|XP_007513418.1|  predicted protein                                68.9    1e-10   
gb|AEW09228.1|  hypothetical protein UMN_755_01                       63.5    2e-10   
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                  68.9    2e-10   
ref|XP_003057973.1|  predicted protein                                67.4    7e-10   
gb|AFG69854.1|  hypothetical protein UMN_755_01                       61.6    1e-09   
ref|XP_002501531.1|  predicted protein                                65.1    3e-09   
ref|XP_001419041.1|  predicted protein                                64.7    4e-09   
ref|XP_003080572.1|  vacuolar sorting receptor, putative (ISS)        63.5    1e-08   
emb|CEG01308.1|  EGF-type aspartate/asparagine hydroxylation site     63.2    1e-08   
gb|EJY73103.1|  Vacuolar sorting receptor                             62.0    3e-08   
ref|XP_006653756.1|  PREDICTED: vacuolar-sorting receptor 6-like      58.9    3e-07   
emb|CDW90025.1|  UNKNOWN                                              55.5    3e-06   
gb|KDD75638.1|  hypothetical protein H632_c577p0                      55.1    4e-06   
emb|CDP17487.1|  unnamed protein product                              54.3    9e-06   
gb|EJY76506.1|  Vacuolar sorting receptor 3                           52.8    3e-05   
emb|CDW89394.1|  vacuolar sorting receptor 3                          52.0    4e-05   
ref|WP_043097279.1|  hypothetical protein                             52.0    7e-05   
gb|EJY86065.1|  Vacuolar-sorting receptor 1                           50.4    2e-04   
ref|XP_005643046.1|  hypothetical protein COCSUDRAFT_49231            50.1    3e-04   
gb|EJY73798.1|  Vacuolar sorting receptor 3                           48.1    8e-04   



>gb|EYU37571.1| hypothetical protein MIMGU_mgv1a002851mg [Erythranthe guttata]
Length=631

 Score =   171 bits (434),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 85/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +3

Query  129  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  308
            MG SE+ KA +LLG  LL L E AAGRFVVEKN+L+V SP+SIKG +DSA+GNFGIPQYG
Sbjct  1    MGCSERSKAAVLLGFSLLILAELAAGRFVVEKNSLRVISPESIKGNHDSAIGNFGIPQYG  60

Query  309  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GSM+GTV+YPKDN+KGCK FD FGISF +KAG+LP FV+VDRGDC FALK WNA
Sbjct  61   GSMSGTVLYPKDNKKGCKNFDDFGISFKAKAGALPNFVLVDRGDCFFALKVWNA  114



>ref|XP_011088070.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=629

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  129  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  308
            MG SE+PK  ILLGLLLLTL E   GRFVVEKN+L+V SPDSIKGT+DSA+GNFGIPQYG
Sbjct  1    MGCSERPKGAILLGLLLLTLAEIVVGRFVVEKNSLRVLSPDSIKGTHDSAIGNFGIPQYG  60

Query  309  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            G M GTVVYP+DNRKGCK FD  GISF +KAG+LP FV+VDRGDC FALK WNA
Sbjct  61   GRMGGTVVYPRDNRKGCKSFDDSGISFKAKAGALPNFVLVDRGDCFFALKVWNA  114



>ref|XP_011001937.1| PREDICTED: vacuolar-sorting receptor 3 [Populus euphratica]
Length=630

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S+  RFVVEKN+L++ SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FDG
Sbjct  23   SSIARFVVEKNSLRITSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFDG  82

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            FGISF SK G+LPTFV+VDRGDC FALK WNA
Sbjct  83   FGISFQSKPGALPTFVLVDRGDCFFALKVWNA  114



>gb|AIY30334.1| vacuolar-sorting receptor 3 protein, partial [Ziziphus jujuba]
Length=155

 Score =   149 bits (375),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKNNL+V SP+ I+GT+DSA+GNFGIPQYGGSM G VVYPK+N+KGCK F  FGI
Sbjct  28   ARFVVEKNNLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKEFTDFGI  87

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G+LPTFV+VDRGDC FALK WNA
Sbjct  88   SFKSKPGALPTFVLVDRGDCFFALKVWNA  116



>ref|XP_002298772.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
 gb|EEE83577.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
Length=630

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FDGFGI
Sbjct  26   ARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFDGFGI  85

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G+LPTFV+VDRGDC FALK WNA
Sbjct  86   SFQSKPGALPTFVLVDRGDCFFALKVWNA  114



>ref|XP_011030346.1| PREDICTED: vacuolar-sorting receptor 3-like [Populus euphratica]
Length=630

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L++ SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FDGFGI
Sbjct  26   ARFVVEKNSLRITSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFDGFGI  85

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G+LPTFV+VDRGDC FALK WNA
Sbjct  86   SFQSKPGALPTFVLVDRGDCFFALKVWNA  114



>ref|XP_011092498.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=630

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
            ++  GRFVVEKN+L+V SP+SIKGT+DSA+GNFGIPQYGGSM G VVYPKDNRKGCK FD
Sbjct  22   QAVVGRFVVEKNSLRVTSPESIKGTHDSAIGNFGIPQYGGSMAGIVVYPKDNRKGCKNFD  81

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             FGISF +KAG++P FV+VDRGDC FALK WNA
Sbjct  82   DFGISFKAKAGAMPNFVLVDRGDCFFALKVWNA  114



>ref|XP_006346308.1| PREDICTED: vacuolar-sorting receptor 3-like [Solanum tuberosum]
Length=630

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  129  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  308
            MG S+  KA I LG L L L +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYG
Sbjct  1    MGVSKTSKATIFLGFLWLNLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYG  60

Query  309  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GS+ GTVVYPK+NRKGC+ F+  G SF SK+G++PTFV+VDRGDC FALK WNA
Sbjct  61   GSIPGTVVYPKENRKGCRNFEDSGTSFKSKSGAMPTFVLVDRGDCFFALKVWNA  114



>ref|XP_004230700.1| PREDICTED: vacuolar-sorting receptor 3 [Solanum lycopersicum]
Length=630

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  129  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  308
            MG S+  KA I LG L L L +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYG
Sbjct  1    MGVSKTSKATIFLGFLWLNLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYG  60

Query  309  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GS+ GTVVYPK+NRKGC+ F+  G SF SK+G++PTFV+VDRGDC FALK WNA
Sbjct  61   GSIPGTVVYPKENRKGCRNFEDSGTSFKSKSGAMPTFVLVDRGDCFFALKVWNA  114



>ref|XP_010272410.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=635

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A  RFVVEKN+L V SPDSIKGT+DSA+GNFGIPQYGGSM GTV+YPK+N KGCK FD F
Sbjct  29   ATARFVVEKNSLTVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENMKGCKDFDDF  88

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GISF +K+G+LPTFV+VDRGDC FALK WNA
Sbjct  89   GISFKTKSGALPTFVLVDRGDCFFALKVWNA  119



>gb|KJB32253.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=559

 Score =   153 bits (387),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L++ SP+ IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD FGI
Sbjct  26   ARFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFDDFGI  85

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWN  467
            SF SK G+LP FV+VDRGDC FALK WN
Sbjct  86   SFKSKPGALPAFVLVDRGDCFFALKVWN  113



>ref|XP_002527509.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34907.1| zinc finger protein, putative [Ricinus communis]
Length=633

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V YPKDN+KGCK FD 
Sbjct  26   SCVGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVTYPKDNKKGCKEFDD  85

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            FG+SF S+ G+LPTFV++DRGDC FALK WNA
Sbjct  86   FGVSFKSRPGALPTFVLLDRGDCFFALKVWNA  117



>ref|XP_009349164.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   153 bits (386),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 69/91 (76%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEF  81

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GI F S+ G+LPTFV+VDRGDC FALK WNA
Sbjct  82   GIKFESRPGALPTFVLVDRGDCFFALKVWNA  112



>gb|KJB79450.1| hypothetical protein B456_013G050300 [Gossypium raimondii]
Length=628

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+L V SP+ IKGTYDSA+GNFGIPQYGGSM GTVVYPKDN+KGCK FD F I
Sbjct  24   GRFVVEKNSLTVTSPEKIKGTYDSAIGNFGIPQYGGSMAGTVVYPKDNQKGCKAFDEFSI  83

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWN  467
            SF SK GSLPTFV+VDRGDC FALK WN
Sbjct  84   SFPSKPGSLPTFVLVDRGDCFFALKVWN  111



>ref|XP_009760191.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana sylvestris]
Length=631

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
            +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGS+ GTVVYPK N+KGC+ FD
Sbjct  23   QSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSLPGTVVYPKGNQKGCRNFD  82

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              GISF SK+G++PTFV+VDRGDC FALK WNA
Sbjct  83   DSGISFKSKSGAMPTFVLVDRGDCFFALKVWNA  115



>ref|XP_009375671.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   152 bits (384),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKN+L+V SPD IKGTYD+A+GNFGIPQYGGSM G V+YPK N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDTAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEF  81

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GI F S+ G+LPTFV+VDRGDC FALK WNA
Sbjct  82   GIKFESRPGALPTFVLVDRGDCFFALKVWNA  112



>ref|XP_009598407.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana tomentosiformis]
Length=631

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
            +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGS+ GTVVYPK N+KGC+ FD
Sbjct  23   QSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSLPGTVVYPKGNQKGCRNFD  82

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              GISF SK+G++PTFV+VDRGDC FALK WNA
Sbjct  83   DSGISFKSKSGAMPTFVLVDRGDCFFALKVWNA  115



>emb|CBI22461.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             +FVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N KGCKGFD +GI
Sbjct  27   AKFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGI  86

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G+LPTFV+VDRGDC FALK WNA
Sbjct  87   SFKSKIGALPTFVVVDRGDCFFALKVWNA  115



>gb|KHF97360.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=628

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+L V SP+ IKGTYDSA+GNFGIPQYGGSM GTVVYPKDN+K CK FD F I
Sbjct  24   GRFVVEKNSLTVTSPEKIKGTYDSAIGNFGIPQYGGSMAGTVVYPKDNQKACKAFDEFSI  83

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWN  467
            SF SK GSLPTFV+VDRGDC FALK WN
Sbjct  84   SFQSKPGSLPTFVLVDRGDCFFALKVWN  111



>ref|XP_002264769.1| PREDICTED: vacuolar-sorting receptor 3 [Vitis vinifera]
Length=636

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             +FVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N KGCKGFD +GI
Sbjct  32   AKFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGI  91

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G+LPTFV+VDRGDC FALK WNA
Sbjct  92   SFKSKIGALPTFVVVDRGDCFFALKVWNA  120



>ref|XP_010543160.1| PREDICTED: vacuolar-sorting receptor 2 [Tarenaya hassleriana]
Length=628

 Score =   152 bits (383),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 67/89 (75%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKNNL+V SP+SI+G Y+ A+GNFG+PQYGGSMTG VV+PK N+KGC+ FD F I
Sbjct  23   GRFVVEKNNLRVTSPESIRGIYECAIGNFGVPQYGGSMTGEVVFPKANQKGCQSFDQFDI  82

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SFSSK G LPTFV+VDRGDC F LKAWNA
Sbjct  83   SFSSKPGGLPTFVLVDRGDCYFTLKAWNA  111



>ref|XP_002313909.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
 gb|EEE87864.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
Length=630

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S+  RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK F+ 
Sbjct  23   SSIARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFEE  82

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF SK G+LPTFV+VDRGDC FALK WNA
Sbjct  83   FRISFQSKPGALPTFVLVDRGDCFFALKVWNA  114



>emb|CAN79862.1| hypothetical protein VITISV_021998 [Vitis vinifera]
Length=599

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  207  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  386
            +FVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N KGCKGFD +GIS
Sbjct  28   KFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGIS  87

Query  387  FSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F SK G+LPTFV+VDRGDC FALK WNA
Sbjct  88   FKSKIGALPTFVVVDRGDCFFALKVWNA  115



>ref|XP_007042634.1| Vaculolar sorting receptor 3 isoform 2, partial [Theobroma cacao]
 gb|EOX98465.1| Vaculolar sorting receptor 3 isoform 2, partial [Theobroma cacao]
Length=501

 Score =   150 bits (380),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G V+YPK+NRKGCKGFD FGI
Sbjct  22   ARFVVEKNSLMVTSPEKIKGTHDSAIGNFGIPQYGGSMAGAVIYPKENRKGCKGFDEFGI  81

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G+LPTFV++DRGDC FALK WNA
Sbjct  82   SFQSKPGALPTFVLLDRGDCFFALKVWNA  110



>ref|XP_002309184.1| vacuolar sorting receptor family protein [Populus trichocarpa]
 gb|EEE92707.1| vacuolar sorting receptor family protein [Populus trichocarpa]
Length=625

 Score =   151 bits (382),  Expect = 9e-40, Method: Composition-based stats.
 Identities = 65/89 (73%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKNNLK+ SPDS+KG Y+ A+GNFG+PQYGG++ GTV+YPK N+K CKGFDG  I
Sbjct  21   GRFVVEKNNLKLTSPDSLKGVYECAIGNFGVPQYGGTLVGTVIYPKANQKACKGFDGVDI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G LPTFV+VDRGDC F LKAWNA
Sbjct  81   SFKSRPGGLPTFVLVDRGDCYFTLKAWNA  109



>ref|XP_002881098.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57357.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   150 bits (380),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 67/92 (73%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N+KGCK FD 
Sbjct  19   SCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPKANQKGCKNFDD  78

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF S+   LPTFV+VDRGDC F LKAWNA
Sbjct  79   FEISFRSRLAGLPTFVLVDRGDCYFTLKAWNA  110



>ref|XP_007042633.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
 gb|EOX98464.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G V+YPK+NRKGCKGFD FGI
Sbjct  22   ARFVVEKNSLMVTSPEKIKGTHDSAIGNFGIPQYGGSMAGAVIYPKENRKGCKGFDEFGI  81

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G+LPTFV++DRGDC FALK WNA
Sbjct  82   SFQSKPGALPTFVLLDRGDCFFALKVWNA  110



>ref|XP_004496877.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=630

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S+  +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G V+YPKDNRKGCK FD 
Sbjct  22   SSIAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVLYPKDNRKGCKEFDD  81

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             GISF SK G+LPTFV++DRG+C FALK WNA
Sbjct  82   SGISFKSKPGALPTFVLLDRGNCFFALKVWNA  113



>ref|XP_010510382.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   150 bits (379),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 66/92 (72%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G V+YPK N+K CK FDG
Sbjct  20   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYPKANQKACKNFDG  79

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF S+   LPTFV+VDRGDC F LKAWNA
Sbjct  80   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNA  111



>gb|KJB12290.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=532

 Score =   150 bits (378),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 67/88 (76%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  FGI
Sbjct  25   ARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGDFGI  84

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWN  467
            SF SK GSLPTFV+VDRGDC FALK WN
Sbjct  85   SFKSKPGSLPTFVLVDRGDCFFALKVWN  112



>emb|CDO97275.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +3

Query  129  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  308
            MG  E+ K+ ILLG L+L L +   GRFVVEKN+L+V SPDSIKGT+DSA+GNFGIPQYG
Sbjct  1    MGRYERSKSAILLGFLVLNLTQLVMGRFVVEKNSLRVTSPDSIKGTHDSAIGNFGIPQYG  60

Query  309  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GSM+GTVV+PK+N+KGCK F  FG SF  K+G++P F++VDRGDC FALK WNA
Sbjct  61   GSMSGTVVFPKENQKGCKTFSDFGSSFKPKSGAMPNFLLVDRGDCLFALKVWNA  114



>ref|XP_010469873.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   150 bits (379),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 66/92 (72%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G V+YPK N+K CK FDG
Sbjct  20   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYPKANQKACKNFDG  79

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF S+   LPTFV+VDRGDC F LKAWNA
Sbjct  80   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNA  111



>ref|XP_008384516.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=629

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKEFSEF  81

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GI+F S  G+LPTFV+VDRGDC FALK WNA
Sbjct  82   GITFKSSPGALPTFVLVDRGDCFFALKVWNA  112



>ref|XP_003517598.2| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=643

 Score =   150 bits (378),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 66/92 (72%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  36   STMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVIYPKDNKKGCKEFDE  95

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            FGISF S  G+LPT V++DRG C FALK WNA
Sbjct  96   FGISFKSTPGALPTIVLLDRGSCFFALKVWNA  127



>gb|KDP44487.1| hypothetical protein JCGZ_16320 [Jatropha curcas]
Length=630

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V YPKDNRKGCK F+ F
Sbjct  24   SVARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVTYPKDNRKGCKDFNDF  83

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            G+SF S+ G+LPTFV++DRGDC FALK WNA
Sbjct  84   GLSFKSQPGALPTFVLLDRGDCFFALKVWNA  114



>ref|NP_180588.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 sp|O22925.1|VSR2_ARATH RecName: Full=Vacuolar-sorting receptor 2; Short=AtVSR2; AltName: 
Full=BP80-like protein c; Short=AtBP80c; AltName: Full=Epidermal 
growth factor receptor-like protein 4; Short=AtELP4; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC16948.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|ABE65874.1| vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC08366.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=625

 Score =   149 bits (376),  Expect = 4e-39, Method: Composition-based stats.
 Identities = 66/92 (72%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N+K CK FD 
Sbjct  20   SCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPKTNQKACKNFDD  79

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF S+   LPTFV+VDRGDC F LKAWNA
Sbjct  80   FEISFRSRVAGLPTFVLVDRGDCYFTLKAWNA  111



>ref|NP_001189637.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 gb|AEC08367.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=641

 Score =   149 bits (377),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 66/92 (72%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N+K CK FD 
Sbjct  20   SCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPKTNQKACKNFDD  79

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF S+   LPTFV+VDRGDC F LKAWNA
Sbjct  80   FEISFRSRVAGLPTFVLVDRGDCYFTLKAWNA  111



>ref|XP_010111675.1| Vacuolar-sorting receptor 3 [Morus notabilis]
 gb|EXC31466.1| Vacuolar-sorting receptor 3 [Morus notabilis]
Length=631

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S   RFVVEKN+L+V SPD I+GT+DSA+GNFGIPQYGGSM G VVYPKDN+KGCK F  
Sbjct  25   SLHARFVVEKNSLRVTSPDRIRGTHDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFSD  84

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            +GISF SK G+LPTFV+VDRGDC FALK WNA
Sbjct  85   YGISFQSKPGALPTFVLVDRGDCFFALKVWNA  116



>gb|KHN05603.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=628

 Score =   149 bits (376),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 66/92 (72%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  21   SIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDD  80

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            FGISF S  G+LPT V++DRG C FALK WNA
Sbjct  81   FGISFKSSPGALPTIVLLDRGSCFFALKVWNA  112



>ref|XP_003538018.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=628

 Score =   149 bits (376),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 66/92 (72%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  21   SIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDD  80

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            FGISF S  G+LPT V++DRG C FALK WNA
Sbjct  81   FGISFKSSPGALPTIVLLDRGSCFFALKVWNA  112



>ref|XP_008348888.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=628

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEF  81

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GI F S+ G+LPTFV+VDRGDC FALK WNA
Sbjct  82   GIKFESRPGALPTFVLVDRGDCFFALKVWNA  112



>ref|XP_010529937.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Tarenaya hassleriana]
Length=624

 Score =   148 bits (374),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            +A GRFVVEKNNLKV SPDSI+G Y+ A+GNFG+PQYGG++ GTVVYP  N+K CK F+ 
Sbjct  18   TALGRFVVEKNNLKVTSPDSIRGIYECAIGNFGVPQYGGTLVGTVVYPSSNQKACKNFED  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F +SF SK G LPTFV++DRGDC F LKAWNA
Sbjct  78   FDVSFKSKPGHLPTFVLIDRGDCYFTLKAWNA  109



>ref|XP_010529936.1| PREDICTED: vacuolar-sorting receptor 1 isoform X1 [Tarenaya hassleriana]
Length=626

 Score =   148 bits (374),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            +A GRFVVEKNNLKV SPDSI+G Y+ A+GNFG+PQYGG++ GTVVYP  N+K CK F+ 
Sbjct  18   TALGRFVVEKNNLKVTSPDSIRGIYECAIGNFGVPQYGGTLVGTVVYPSSNQKACKNFED  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F +SF SK G LPTFV++DRGDC F LKAWNA
Sbjct  78   FDVSFKSKPGHLPTFVLIDRGDCYFTLKAWNA  109



>ref|XP_010687358.1| PREDICTED: vacuolar-sorting receptor 4-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S   RFVVEKN+L+V SPD +KGTYD+A+GNFGIPQYGGSM GTV+YPKDN+KGCK F  
Sbjct  28   SIESRFVVEKNSLRVTSPDDVKGTYDTAIGNFGIPQYGGSMAGTVIYPKDNKKGCKDFSD  87

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF  K G LPTFV++DRGDC FALK WNA
Sbjct  88   FSISFKKKPGQLPTFVLLDRGDCFFALKVWNA  119



>ref|XP_006849341.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
 gb|ERN10922.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
Length=611

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+L V SPDSI+G +DSA+GNFG+PQYGGSM G VVYPKDN+KGCKGFD FG+
Sbjct  7    GRFVVEKNSLTVTSPDSIRGMHDSAIGNFGVPQYGGSMAGAVVYPKDNKKGCKGFDEFGL  66

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G+LPTFV++DRG C F LK WNA
Sbjct  67   SFKSKLGALPTFVMLDRGGCFFTLKVWNA  95



>ref|XP_008236323.1| PREDICTED: vacuolar-sorting receptor 3 [Prunus mume]
Length=629

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            ++ RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK+N+KGCK F  F
Sbjct  23   SSARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKENQKGCKEFSEF  82

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GISF S  G+LPTFV+VDRGDC FALK WNA
Sbjct  83   GISFKSTPGALPTFVLVDRGDCFFALKVWNA  113



>ref|XP_006398566.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
 gb|ESQ40019.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
Length=627

 Score =   147 bits (372),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 66/92 (72%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N K CK FD 
Sbjct  22   SCTGRFVVEKNNLRVTSPESIRGIYECALGNFGVPQYGGSMSGAVVYPKANHKSCKNFDD  81

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF S+   LPTFV+VDRGDC F LKAWNA
Sbjct  82   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNA  113



>ref|XP_010414284.1| PREDICTED: vacuolar-sorting receptor 2 [Camelina sativa]
Length=625

 Score =   147 bits (372),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 65/92 (71%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G V+YPK N+K CK FD 
Sbjct  20   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYPKANQKACKNFDD  79

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF S+   LPTFV+VDRGDC F LKAWNA
Sbjct  80   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNA  111



>gb|AES62774.2| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=632

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S+  +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FD 
Sbjct  23   SSMAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDE  82

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             GISF SK G+LPT V++DRG C FALK WNA
Sbjct  83   SGISFKSKPGALPTIVLLDRGSCFFALKVWNA  114



>gb|KEH44022.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=529

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S+  +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FD 
Sbjct  23   SSMAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDE  82

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             GISF SK G+LPT V++DRG C FALK WNA
Sbjct  83   SGISFKSKPGALPTIVLLDRGSCFFALKVWNA  114



>ref|XP_010277061.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=634

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A  RFVVEKN+L V SPDSIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N K CK F+ F
Sbjct  28   ATARFVVEKNSLTVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENMKACKDFNEF  87

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            G SF +K G+LPTFV+VDRGDC FALK WNA
Sbjct  88   GTSFKAKPGALPTFVLVDRGDCFFALKVWNA  118



>ref|XP_011457866.1| PREDICTED: vacuolar-sorting receptor 3 [Fragaria vesca subsp. 
vesca]
Length=630

 Score =   147 bits (370),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 63/91 (69%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  RFVVEKN+L+V SPD IKG YDSA+GNFG+PQYGGSM+G V+YPK+N+KGCK F  F
Sbjct  23   STARFVVEKNSLRVTSPDKIKGKYDSAIGNFGLPQYGGSMSGAVIYPKENQKGCKEFSDF  82

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            G+S+ S  G+LPTF++VDRGDC FALK WNA
Sbjct  83   GLSYKSTPGALPTFLLVDRGDCFFALKVWNA  113



>gb|KJB32252.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=630

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L++ SP+ IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD FGI
Sbjct  26   ARFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFDDFGI  85

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWN  467
            SF SK G+LP FV+VDRGDC FALK WN
Sbjct  86   SFKSKPGALPAFVLVDRGDCFFALKVWN  113



>gb|KJB32254.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=600

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  207  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  386
            RFVVEKN+L++ SP+ IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD FGIS
Sbjct  27   RFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFDDFGIS  86

Query  387  FSSKAGSLPTFVIVDRGDCRFALKAWN  467
            F SK G+LP FV+VDRGDC FALK WN
Sbjct  87   FKSKPGALPAFVLVDRGDCFFALKVWN  113



>ref|XP_008455032.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis melo]
Length=630

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  RFVVEKN+L+V SPD +KGTYDSA+GNFGIPQYGGSM+GTVV+PK+N+KGC+ F   
Sbjct  25   SVARFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDA  84

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GISF SK G+LPTFV+VDRGDC FALK WNA
Sbjct  85   GISFQSKPGALPTFVLVDRGDCFFALKVWNA  115



>ref|XP_004159916.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-sorting receptor 3-like 
[Cucumis sativus]
Length=631

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L+V SPD +KGTYDSA+GNFGIPQYGGSM+GTVV+PK+N+KGC+ F   GI
Sbjct  28   ARFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDAGI  87

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G+LPTFV+VDRGDC FALK WNA
Sbjct  88   SFQSKPGALPTFVLVDRGDCFFALKVWNA  116



>ref|XP_004136938.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN43851.1| hypothetical protein Csa_7G071400 [Cucumis sativus]
Length=631

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L+V SPD +KGTYDSA+GNFGIPQYGGSM+GTVV+PK+N+KGC+ F   GI
Sbjct  28   ARFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDAGI  87

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G+LPTFV+VDRGDC FALK WNA
Sbjct  88   SFQSKPGALPTFVLVDRGDCFFALKVWNA  116



>ref|XP_003592523.1| Vacuolar-sorting receptor [Medicago truncatula]
Length=601

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FD  GI
Sbjct  2    AKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDESGI  61

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G+LPT V++DRG C FALK WNA
Sbjct  62   SFKSKPGALPTIVLLDRGSCFFALKVWNA  90



>ref|XP_004137673.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus]
 ref|XP_004160331.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus]
Length=624

 Score =   145 bits (367),  Expect = 9e-38, Method: Composition-based stats.
 Identities = 65/92 (71%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+LK+ SPDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             GISF SK GSLPTFV+ DRGDC F +KAWNA
Sbjct  78   AGISFKSKPGSLPTFVLADRGDCYFTMKAWNA  109



>ref|XP_008442315.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis melo]
Length=622

 Score =   145 bits (367),  Expect = 9e-38, Method: Composition-based stats.
 Identities = 65/92 (71%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+LK+ SPDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             GISF SK GSLPTFV+ DRGDC F +KAWNA
Sbjct  78   AGISFKSKPGSLPTFVLADRGDCYFTMKAWNA  109



>ref|XP_007199755.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
 gb|EMJ00954.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
Length=629

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            ++ RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK+N+KGCK F  F
Sbjct  23   SSARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKENQKGCKEFSEF  82

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GISF S  G+LP FV+VDRGDC FALK WNA
Sbjct  83   GISFKSTPGALPKFVLVDRGDCFFALKVWNA  113



>ref|XP_004173121.1| PREDICTED: vacuolar-sorting receptor 3-like, partial [Cucumis 
sativus]
Length=517

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
              GRFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F
Sbjct  23   CMGRFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFGDF  82

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             ISF SK GSLP FV+VDRGDC FALK WNA
Sbjct  83   HISFQSKPGSLPIFVMVDRGDCLFALKVWNA  113



>ref|XP_006296113.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
 gb|EOA29011.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
Length=623

 Score =   145 bits (365),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 65/92 (71%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFGIPQYGGSM+G V+YPK N+K CK F  
Sbjct  18   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGIPQYGGSMSGAVLYPKANQKACKNFAD  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF S+   LPTFV+VDRGDC F LKAWNA
Sbjct  78   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNA  109



>ref|XP_006290748.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
 gb|EOA23646.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
Length=626

 Score =   145 bits (365),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 64/91 (70%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKNNLKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK ++ F
Sbjct  20   ALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYNDF  79

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             ISF SK G LPTFV++DRGDC F LKAW A
Sbjct  80   DISFKSKPGRLPTFVLIDRGDCFFTLKAWTA  110



>gb|KJB12295.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=477

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            FGISF SK GSLPTFV+VDRGDC FALK WN 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNV  113



>emb|CDY04821.1| BnaAnng00030D [Brassica napus]
Length=635

 Score =   145 bits (365),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP+SI+G Y+ ALGNFG+PQYGGSM+G+VVYPK N+K CK F+ 
Sbjct  29   SCMGRFVVEKNSLRVTSPESIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  88

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF S+   LPTFV+VDRGDC F LKAWNA
Sbjct  89   FDISFRSRVSGLPTFVLVDRGDCYFTLKAWNA  120



>ref|XP_004152276.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN52769.1| hypothetical protein Csa_4G000880 [Cucumis sativus]
Length=632

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
              GRFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F
Sbjct  23   CMGRFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFGDF  82

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             ISF SK GSLP FV+VDRGDC FALK WNA
Sbjct  83   HISFQSKPGSLPIFVMVDRGDCLFALKVWNA  113



>gb|KJB71518.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=569

 Score =   144 bits (364),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 64/89 (72%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD F I
Sbjct  21   GRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKSFDDFDI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G LPTF++VDRGDC F LKAWNA
Sbjct  81   SFKSKPGGLPTFLLVDRGDCFFTLKAWNA  109



>gb|KHN30433.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=643

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  36   STMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVIYPKDNKKGCKEFDE  95

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            FGISF S  G+LPT V++DRG C FALK WNA
Sbjct  96   FGISFKSTPGALPTIVLLDRGSCFFALKVWNA  127



>ref|XP_010547949.1| PREDICTED: vacuolar-sorting receptor 3-like [Tarenaya hassleriana]
Length=635

 Score =   144 bits (364),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 64/89 (72%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+SIKGT+DSA+GNFG+PQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  31   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGVPQYGGSMAGTVVYPKENQKACKEFSDFSI  90

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G+LPTF+++DRGDC FALK WNA
Sbjct  91   SFKSQPGALPTFLLLDRGDCFFALKVWNA  119



>gb|KJB71519.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
 gb|KJB71520.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=621

 Score =   144 bits (364),  Expect = 2e-37, Method: Composition-based stats.
 Identities = 64/89 (72%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD F I
Sbjct  21   GRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKSFDDFDI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G LPTF++VDRGDC F LKAWNA
Sbjct  81   SFKSKPGGLPTFLLVDRGDCFFTLKAWNA  109



>ref|XP_006409641.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
 gb|ESQ51094.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
Length=631

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SPDSIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  27   ARFVVEKNSLSVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  86

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G+LPTF++VDRGDC FALK WNA
Sbjct  87   SFKSQPGALPTFLLVDRGDCFFALKVWNA  115



>gb|KHG14060.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   144 bits (364),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 64/89 (72%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD F I
Sbjct  21   GRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKSFDDFDI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G LPTF++VDRGDC F LKAWNA
Sbjct  81   SFKSKPGGLPTFLLVDRGDCFFTLKAWNA  109



>ref|XP_011019003.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   144 bits (363),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LK+ SPDS+KG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   I
Sbjct  21   GRFVVEKNSLKLTSPDSLKGVYECAIGNFGVPQYGGTLVGTVVYPKANQKACKGFDEVDI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G LPTFV+ DRGDC F LKAWNA
Sbjct  81   SFKSRPGWLPTFVLADRGDCYFTLKAWNA  109



>ref|XP_006409638.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
 gb|ESQ51091.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
Length=626

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S   RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  
Sbjct  19   SCEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSD  78

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF S+ G+LPTF++VDRGDC FALK WNA
Sbjct  79   FSISFKSQPGALPTFLLVDRGDCFFALKVWNA  110



>gb|KJB12294.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=604

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWN  467
            FGISF SK GSLPTFV+VDRGDC FALK WN
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWN  112



>gb|KJB12291.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=624

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWN  467
            FGISF SK GSLPTFV+VDRGDC FALK WN
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWN  112



>ref|XP_003555992.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  +FVVEKN+L V SPD+IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +
Sbjct  24   SMAKFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEY  83

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GISF SK G+LPT V++DRG+C FALK WNA
Sbjct  84   GISFKSKPGALPTIVLLDRGNCFFALKVWNA  114



>gb|KHN42313.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  +FVVEKN+L V SPD+IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +
Sbjct  24   SMAKFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEY  83

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GISF SK G+LPT V++DRG+C FALK WNA
Sbjct  84   GISFKSKPGALPTIVLLDRGNCFFALKVWNA  114



>emb|CDX91478.1| BnaC04g06720D [Brassica napus]
Length=620

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
            E A G F+VEKNNLKV SPDSIKG Y+ A+GNFGIP+YGG++ GTVVYP  N KGCK F 
Sbjct  15   ELAFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPMSNHKGCKSFS  74

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             FG+SF S  GSLPTF+++DRGDC FALKAWNA
Sbjct  75   EFGVSFKSSPGSLPTFLLIDRGDCYFALKAWNA  107



>gb|KJB12292.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
 gb|KJB12293.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=629

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWN  467
            FGISF SK GSLPTFV+VDRGDC FALK WN
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWN  112



>ref|XP_009143376.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=620

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
            E A G F+VEKNNLKV SPDSIKG Y+ A+GNFGIP+YGG++ GTVVYP  N KGCK F 
Sbjct  15   ELAFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPMSNHKGCKSFS  74

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             FG+SF S  GSLPTF+++DRGDC FALKAWNA
Sbjct  75   EFGVSFKSSPGSLPTFLLIDRGDCYFALKAWNA  107



>gb|KHN06808.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  +FVVEKN+L V SPD IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +
Sbjct  24   SMAKFVVEKNSLTVTSPDDIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEY  83

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GISF SK G+LPT V++DRG+C FALK WNA
Sbjct  84   GISFKSKPGALPTIVLLDRGNCFFALKVWNA  114



>ref|XP_003536576.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  +FVVEKN+L V SPD IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +
Sbjct  24   SMAKFVVEKNSLTVTSPDDIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEY  83

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GISF SK G+LPT V++DRG+C FALK WNA
Sbjct  84   GISFKSKPGALPTIVLLDRGNCFFALKVWNA  114



>ref|XP_008454392.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X1 [Cucumis 
melo]
Length=633

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
               RFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F
Sbjct  23   CMARFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFSDF  82

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             ISF SK GSLP FV+VDRGDC FALK WNA
Sbjct  83   HISFQSKPGSLPIFVMVDRGDCLFALKVWNA  113



>ref|XP_008454393.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X2 [Cucumis 
melo]
Length=632

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
               RFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F
Sbjct  23   CMARFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFSDF  82

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             ISF SK GSLP FV+VDRGDC FALK WNA
Sbjct  83   HISFQSKPGSLPIFVMVDRGDCLFALKVWNA  113



>ref|XP_002528694.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
 gb|EEF33683.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
Length=625

 Score =   143 bits (361),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 63/92 (68%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SPDS+KG ++ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD 
Sbjct  18   SCLGRFVVEKNSLRVTSPDSVKGIHECAIGNFGVPQYGGTLVGTVVYPKANQKACKGFDE  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              ISF SK G LPTF++ DRGDC F LKAWNA
Sbjct  78   VDISFKSKPGGLPTFLLADRGDCYFTLKAWNA  109



>gb|KFK24686.1| hypothetical protein AALP_AA8G011700 [Arabis alpina]
Length=627

 Score =   143 bits (361),  Expect = 6e-37, Method: Composition-based stats.
 Identities = 63/89 (71%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKNNL+V SP++I+G Y+ ALGNFG+PQYGGSM G VVYPK N+K CK F+ F I
Sbjct  24   GRFVVEKNNLRVTSPEAIRGVYECALGNFGVPQYGGSMAGAVVYPKANQKACKNFNDFDI  83

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+   LPTFV+VDRGDC F LKAWNA
Sbjct  84   SFRSRLAGLPTFVLVDRGDCYFTLKAWNA  112



>gb|KDO57883.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=410

 Score =   141 bits (356),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             FGISF +K G+LP FV+VDRGDC FALK WNA
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNA  115



>ref|XP_002885935.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62194.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
Length=627

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F
Sbjct  21   SEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  80

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             ISF S+ G+LPTF++VDRGDC FALK WNA
Sbjct  81   SISFKSQPGALPTFLLVDRGDCFFALKVWNA  111



>gb|ABR17683.1| unknown [Picea sitchensis]
Length=635

 Score =   143 bits (361),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 63/91 (69%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A  +FVVEKN+L+V SP++IKG YDSA+GNFGIPQYGG+M GT VYPK+N+ GCK FD F
Sbjct  29   AMAKFVVEKNSLRVLSPENIKGNYDSAIGNFGIPQYGGTMVGTAVYPKENQNGCKTFDTF  88

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             ISF SK G LP  V+V+RGDC FALK WNA
Sbjct  89   EISFKSKPGGLPNVVLVNRGDCYFALKVWNA  119



>ref|XP_006300216.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
 gb|EOA33114.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
Length=629

 Score =   143 bits (360),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F
Sbjct  23   SEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  82

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             ISF S+ G+LPTF++VDRGDC FALK WNA
Sbjct  83   SISFKSQPGALPTFLLVDRGDCFFALKVWNA  113



>ref|XP_010488908.1| PREDICTED: vacuolar-sorting receptor 4 [Camelina sativa]
Length=626

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G+LPTF++VDRGDC FALK WNA
Sbjct  82   SFKSQPGALPTFLLVDRGDCFFALKVWNA  110



>gb|KFK39977.1| hypothetical protein AALP_AA3G313900 [Arabis alpina]
Length=626

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G+LPTF++VDRGDC FALK WNA
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNA  111



>ref|NP_179081.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 ref|NP_849955.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 sp|O80977.1|VSR3_ARATH RecName: Full=Vacuolar-sorting receptor 3; Short=AtVSR3; AltName: 
Full=BP80-like protein a'; Short=AtBP80a'; AltName: Full=Epidermal 
growth factor receptor-like protein 2a; Short=AtELP2a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24183.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15053.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC06328.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 gb|AEC06329.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
Length=628

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  24   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  83

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G+LPTF++VDRGDC FALK WNA
Sbjct  84   SFKSQPGALPTFLLVDRGDCFFALKVWNA  112



>ref|XP_010488909.1| PREDICTED: vacuolar-sorting receptor 3 [Camelina sativa]
Length=626

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G+LPTF++VDRGDC FALK WNA
Sbjct  82   SFKSQPGALPTFLLVDRGDCFFALKVWNA  110



>ref|XP_002883854.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60113.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
Length=627

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G+LPTF++VDRGDC FALK WNA
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNA  111



>ref|XP_009136249.1| PREDICTED: vacuolar-sorting receptor 3 [Brassica rapa]
Length=631

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTV+YPK+N+K CK F  F
Sbjct  25   SEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENQKSCKEFSDF  84

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             ISF S+ G+LPTF++VDRGDC FALK WNA
Sbjct  85   SISFKSQPGALPTFLLVDRGDCFFALKVWNA  115



>ref|XP_007033521.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 ref|XP_007033522.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04447.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04448.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
Length=621

 Score =   142 bits (359),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD F I
Sbjct  21   GRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDDFDI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G LPTF++VDRGDC F +KAWNA
Sbjct  81   SFKSKPGGLPTFLLVDRGDCFFTMKAWNA  109



>emb|CDY65441.1| BnaCnng47180D [Brassica napus]
Length=631

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTV+YPK+N+K CK F  F
Sbjct  25   SEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENQKSCKEFSDF  84

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             ISF S+ G+LPTF++VDRGDC FALK WNA
Sbjct  85   SISFKSQPGALPTFLLVDRGDCFFALKVWNA  115



>gb|KFK39979.1| hypothetical protein AALP_AA3G314200 [Arabis alpina]
Length=627

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G+LPTF++VDRGDC FALK WNA
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNA  111



>ref|NP_179079.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 ref|NP_849954.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 sp|Q56ZQ3.2|VSR4_ARATH RecName: Full=Vacuolar-sorting receptor 4; Short=AtVSR4; AltName: 
Full=BP80-like protein a; Short=AtBP80a; AltName: Full=Epidermal 
growth factor receptor-like protein 2b; Short=AtELP2b; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24185.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAL32822.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15052.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAP37749.1| At2g14720 [Arabidopsis thaliana]
 gb|AEC06326.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 gb|AEC06327.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
Length=628

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  24   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  83

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G+LPTF++VDRGDC FALK WNA
Sbjct  84   SFKSQPGALPTFLLVDRGDCFFALKVWNA  112



>ref|XP_007033523.1| Vacuolar sorting receptor isoform 3 [Theobroma cacao]
 gb|EOY04449.1| Vacuolar sorting receptor isoform 3 [Theobroma cacao]
Length=515

 Score =   142 bits (357),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD F I
Sbjct  21   GRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDDFDI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G LPTF++VDRGDC F +KAWNA
Sbjct  81   SFKSKPGGLPTFLLVDRGDCFFTMKAWNA  109



>ref|XP_006429591.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
 ref|XP_006481200.1| PREDICTED: vacuolar-sorting receptor 1-like [Citrus sinensis]
 gb|ESR42831.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
Length=623

 Score =   142 bits (359),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   +
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G LPTF++VDRGDC F LKAWNA
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNA  109



>gb|AAN60346.1| unknown [Arabidopsis thaliana]
Length=216

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  17   AMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  76

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALK  458
             ISF SK G LPTFV++DRGDC F LK
Sbjct  77   DISFKSKPGRLPTFVLIDRGDCYFTLK  103



>ref|XP_010517675.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            S+ S+ G+LPTF++VDRGDC FALK WNA
Sbjct  82   SYKSQPGALPTFLLVDRGDCFFALKVWNA  110



>ref|XP_007157213.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
 gb|ESW29207.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
Length=626

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G VVYPKDN+KGCK F+ 
Sbjct  19   SIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVVYPKDNKKGCKEFED  78

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             GISF S  G+LPTFV++DRG C FALK WNA
Sbjct  79   SGISFKSTPGALPTFVLLDRGSCFFALKVWNA  110



>emb|CDY60753.1| BnaA05g34780D [Brassica napus]
Length=620

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
            E   G F+VEKNNLKV SPDSIKG Y+ A+GNFGIP+YGG++ GTVVYP  N KGCK F 
Sbjct  15   ELTFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPMSNHKGCKSFS  74

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             FG+SF S  GSLPTF+++DRGDC FALKAWNA
Sbjct  75   EFGVSFKSSPGSLPTFLLIDRGDCYFALKAWNA  107



>gb|KGN58683.1| hypothetical protein Csa_3G728010 [Cucumis sativus]
Length=522

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+LK+ SPDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             GISF SK GSLPTFV+ DRGDC F +KAWNA
Sbjct  78   AGISFKSKPGSLPTFVLADRGDCYFTMKAWNA  109



>ref|XP_010467255.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            S+ S+ G+LPTF++VDRGDC FALK WNA
Sbjct  82   SYKSQPGALPTFLLVDRGDCFFALKVWNA  110



>gb|KDO64109.1| hypothetical protein CISIN_1g0100101mg [Citrus sinensis]
Length=362

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   +
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G LPTF++VDRGDC F LKAWNA
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNA  109



>emb|CDX73599.1| BnaC08g24040D [Brassica napus]
Length=625

 Score =   142 bits (357),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   AVGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  79

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALK  458
             ISF SKAG LPTFV++DRGDC F LK
Sbjct  80   DISFKSKAGRLPTFVLIDRGDCFFTLK  106



>emb|CDY38157.1| BnaA07g02260D [Brassica napus]
Length=370

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  G FVVEKN+L+V SP+SI+G Y+ ALGNFG+PQYGGSM+G+VVYPK N+K CK F+ 
Sbjct  45   SCMGMFVVEKNSLRVTSPESIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  104

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF S+   LPTFV+VDRGDC F LKAWNA
Sbjct  105  FDISFISRVAGLPTFVLVDRGDCYFTLKAWNA  136



>ref|XP_008669942.1| PREDICTED: vacuolar-sorting receptor 1-like [Zea mays]
Length=624

 Score =   141 bits (356),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  25   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDDFDI  84

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            S+ +K G+ PTF++VDRGDC FA KAWNA
Sbjct  85   SYKAKPGAFPTFLLVDRGDCYFAKKAWNA  113



>ref|XP_010547948.1| PREDICTED: vacuolar-sorting receptor 3 [Tarenaya hassleriana]
Length=635

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+SIKGT+DSA+GNFG+PQYGGSM GTVVYPK+N K CK F  F I
Sbjct  31   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGVPQYGGSMAGTVVYPKENHKACKEFSDFSI  90

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G+LPTF+++DRGDC FALK WNA
Sbjct  91   SFKSQPGALPTFLLLDRGDCFFALKVWNA  119



>ref|XP_009801642.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
sylvestris]
Length=624

 Score =   141 bits (355),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG++ G VVYPK N+K CK F+   I
Sbjct  21   GRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTLVGNVVYPKANQKSCKSFESADI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SKAGS+P FV+VDRGDC F LKAWNA
Sbjct  81   SFKSKAGSMPVFVLVDRGDCYFTLKAWNA  109



>ref|XP_009123210.1| PREDICTED: vacuolar-sorting receptor 3-like [Brassica rapa]
Length=624

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  207  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  386
            RFVVEKN+L V SPDSIKG +D A+GNFGIPQYGGSM GTVVYPK+N+K CK F  F IS
Sbjct  21   RFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSIS  80

Query  387  FSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F S+ G+LPTF++VDRGDC FALK WNA
Sbjct  81   FKSQPGALPTFLLVDRGDCFFALKVWNA  108



>ref|XP_009801640.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
sylvestris]
Length=626

 Score =   141 bits (355),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG++ G VVYPK N+K CK F+   I
Sbjct  21   GRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTLVGNVVYPKANQKSCKSFESADI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SKAGS+P FV+VDRGDC F LKAWNA
Sbjct  81   SFKSKAGSMPVFVLVDRGDCYFTLKAWNA  109



>gb|KDO64107.1| hypothetical protein CISIN_1g0100101mg, partial [Citrus sinensis]
 gb|KDO64108.1| hypothetical protein CISIN_1g0100101mg, partial [Citrus sinensis]
Length=410

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   +
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G LPTF++VDRGDC F LKAWNA
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNA  109



>emb|CDY37219.1| BnaA09g08400D [Brassica napus]
Length=624

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  207  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  386
            RFVVEKN+L V SPDSIKG +D A+GNFGIPQYGGSM GTVVYPK+N+K CK F  F IS
Sbjct  21   RFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSIS  80

Query  387  FSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F S+ G+LPTF++VDRGDC FALK WNA
Sbjct  81   FKSQPGALPTFLLVDRGDCFFALKVWNA  108



>gb|KDO57886.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=560

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             FGISF +K G+LP FV+VDRGDC FALK WNA
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNA  115



>gb|KDO64106.1| hypothetical protein CISIN_1g0100101mg [Citrus sinensis]
Length=411

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   +
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G LPTF++VDRGDC F LKAWNA
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNA  109



>gb|KCW63607.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=578

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +A RFVVEKN+L V SPD IKG YDSA+GNFGIPQYGGSM G V YP+ NRKGCK F  F
Sbjct  36   SAARFVVEKNSLAVTSPDKIKGNYDSAIGNFGIPQYGGSMAGAVTYPEKNRKGCKEFSEF  95

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             ISF SK G LP FV+VDRGDC FALK WNA
Sbjct  96   DISFKSKPGMLPKFVLVDRGDCFFALKVWNA  126



>pir||T00044 vacuolar sorting receptor protein homolog PV72 - cucurbit
 dbj|BAA25079.1| PV72 [Cucurbita cv. Kurokawa Amakuri]
Length=624

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+LKV  PDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCFGRFVVEKNSLKVTYPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             GISF SK GSLPTFV+ DRGDC F LKAWNA
Sbjct  78   VGISFKSKPGSLPTFVLADRGDCYFTLKAWNA  109



>ref|XP_009115984.1| PREDICTED: vacuolar-sorting receptor 1 [Brassica rapa]
Length=625

 Score =   140 bits (354),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   AVGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  79

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALK  458
             I+F SKAG LPTFV++DRGDC F LK
Sbjct  80   DITFKSKAGRLPTFVLIDRGDCFFTLK  106



>emb|CDX81459.1| BnaC09g08700D [Brassica napus]
Length=624

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  207  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  386
            RFVVEKN+L V SPDSIKG +D A+GNFGIPQYGGSM GTVVYPK+N+K CK F  F IS
Sbjct  21   RFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSIS  80

Query  387  FSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F S+ G+LPTF++VDRGDC FALK WNA
Sbjct  81   FKSQPGALPTFLLVDRGDCFFALKVWNA  108



>gb|KDO57884.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=629

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             FGISF +K G+LP FV+VDRGDC FALK WNA
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNA  115



>gb|KDO57885.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=631

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             FGISF +K G+LP FV+VDRGDC FALK WNA
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNA  115



>ref|XP_010467256.1| PREDICTED: vacuolar-sorting receptor 3-like [Camelina sativa]
Length=629

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N K CK F  F
Sbjct  23   SEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENHKSCKEFSDF  82

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             ISF S+ G+LP F++VDRGDC FALK WNA
Sbjct  83   SISFKSQPGALPIFLLVDRGDCFFALKVWNA  113



>ref|XP_009384326.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384327.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=621

 Score =   140 bits (353),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 62/92 (67%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+LKV SPDS+KG Y+ A+GNFG+PQYGG+M G V YPKDN+K CK F  
Sbjct  19   SCWGRFVVEKNSLKVTSPDSLKGIYECAIGNFGVPQYGGTMVGIVAYPKDNQKACKSFRD  78

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F IS+ SK G  PTF++VDRGDC F  KAWNA
Sbjct  79   FDISYKSKPGGFPTFLLVDRGDCYFTAKAWNA  110



>ref|XP_006486921.1| PREDICTED: vacuolar-sorting receptor 3-like [Citrus sinensis]
Length=631

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             FGISF +K G+LP FV+VDRGDC FALK WNA
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNA  115



>ref|XP_006422827.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
 gb|ESR36067.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
Length=631

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             FGISF +K G+LP FV+VDRGDC FALK WNA
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNA  115



>ref|XP_010065899.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW63606.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=644

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +A RFVVEKN+L V SPD IKG YDSA+GNFGIPQYGGSM G V YP+ NRKGCK F  F
Sbjct  36   SAARFVVEKNSLAVTSPDKIKGNYDSAIGNFGIPQYGGSMAGAVTYPEKNRKGCKEFSEF  95

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             ISF SK G LP FV+VDRGDC FALK WNA
Sbjct  96   DISFKSKPGMLPKFVLVDRGDCFFALKVWNA  126



>ref|XP_004302536.1| PREDICTED: vacuolar-sorting receptor 1-like [Fragaria vesca subsp. 
vesca]
Length=625

 Score =   140 bits (353),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV SP+S+K  Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGF+ F I
Sbjct  21   GRFVVEKNSLKVTSPNSLKNVYECAIGNFGVPQYGGTLVGTVFYPKANQKACKGFEDFDI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G LPTF++ DRGDC F LKAWNA
Sbjct  81   SFKSKPGGLPTFLLADRGDCYFTLKAWNA  109



>ref|XP_007143116.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
 gb|ESW15110.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
Length=630

 Score =   140 bits (353),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  +FVVEKN+L V SPD+IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD  
Sbjct  23   SMAKFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVVYPKENQKGCKEFDDS  82

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            GISF SK G+LPT V++DRG+C FALK WNA
Sbjct  83   GISFKSKPGALPTVVLLDRGNCFFALKVWNA  113



>pdb|4TJV|A Chain A, Crystal Structure Of Protease-associated Domain Of Arabidopsis 
Vacuolar Sorting Receptor 1
 pdb|4TJX|A Chain A, Crystal Structure Of Protease-associated Domain Of Arabidopsis 
Vsr1 In Complex With Aleurain Peptide
Length=165

 Score =   133 bits (334),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  207  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  386
            RFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F IS
Sbjct  3    RFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDIS  62

Query  387  FSSKAGSLPTFVIVDRGDCRFALK  458
            F SK G LPTFV++DRGDC F LK
Sbjct  63   FKSKPGRLPTFVLIDRGDCYFTLK  86



>ref|XP_006297095.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
 gb|EOA29993.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
Length=698

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  94   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  153

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G+LP F++VDRGDC FALK WNA
Sbjct  154  SFKSQPGALPIFLLVDRGDCFFALKVWNA  182



>gb|AGV54776.1| vacuolar-sorting receptor [Phaseolus vulgaris]
Length=625

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G VVYPKD++KGCK F+ 
Sbjct  19   SIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVVYPKDDKKGCKEFED  78

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             GISF S  G+LPTFV++DRG C FALK WNA
Sbjct  79   SGISFKSTPGALPTFVLLDRGSCFFALKVWNA  110



>emb|CDX78128.1| BnaA09g33230D [Brassica napus]
Length=625

 Score =   140 bits (352),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   AMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  79

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALK  458
             I+F SKAG LPTFV++DRGDC F LK
Sbjct  80   DITFKSKAGRLPTFVLIDRGDCFFTLK  106



>ref|XP_009410512.1| PREDICTED: vacuolar-sorting receptor 1 [Musa acuminata subsp. 
malaccensis]
Length=622

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  G+FVVEKN+LKV SPDS+KG Y+ A+GNFG+PQYGG+M G V YPK NRKGC+GFD 
Sbjct  20   SCWGKFVVEKNSLKVTSPDSLKGIYECAIGNFGVPQYGGTMVGIVAYPKANRKGCQGFDN  79

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F IS+ SK G  PTF++VDRGDC F  KAWNA
Sbjct  80   FDISYKSKPGGFPTFLLVDRGDCYFTAKAWNA  111



>ref|NP_190853.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
 sp|P93026.2|VSR1_ARATH RecName: Full=Vacuolar-sorting receptor 1; Short=AtVSR1; AltName: 
Full=BP80-like protein b; Short=AtBP80b; AltName: Full=Epidermal 
growth factor receptor-like protein 1; Short=AtELP; 
Short=AtELP1; AltName: Full=Spot 3 protein; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA69222.1| Spot 3 protein [Arabidopsis thaliana]
 gb|AAB46988.1| EGF receptor like protein [Arabidopsis thaliana]
 gb|AEE79000.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
Length=623

 Score =   140 bits (352),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  17   AMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  76

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALK  458
             ISF SK G LPTFV++DRGDC F LK
Sbjct  77   DISFKSKPGRLPTFVLIDRGDCYFTLK  103



>gb|AAB72111.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=623

 Score =   139 bits (351),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  17   AMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  76

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALK  458
             ISF SK G LPTFV++DRGDC F LK
Sbjct  77   DISFKSKPGRLPTFVLIDRGDCYFTLK  103



>gb|AAK82551.1| AT3g52850/F8J2_20 [Arabidopsis thaliana]
Length=623

 Score =   139 bits (351),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  17   AMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  76

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALK  458
             ISF SK G LPTFV++DRGDC F LK
Sbjct  77   DISFKSKPGRLPTFVLIDRGDCYFTLK  103



>ref|XP_010426913.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score =   139 bits (351),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKNNLKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   ALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYTDF  79

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALK  458
             ISF SK G LPTFV++DRGDC FALK
Sbjct  80   DISFKSKPGRLPTFVLIDRGDCYFALK  106



>ref|XP_010252051.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=624

 Score =   139 bits (350),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+LKV SP+ +KG Y+ A+GNFG+PQYGG+M GTV+YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKVTSPEDLKGVYECAIGNFGVPQYGGTMIGTVIYPKANQKACKDFDE  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              +SF SK G LPTF++ DRGDC F LKAWNA
Sbjct  78   VDLSFKSKPGGLPTFLLADRGDCFFTLKAWNA  109



>ref|XP_010039169.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
Length=195

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
            ES +GRF V KN+L+V SP+S+KG YDS++G+FG+P+ GG+M GT+VYPK NRK CK F 
Sbjct  17   ESCSGRFTVAKNSLEVTSPESMKGFYDSSIGSFGVPKRGGTMAGTIVYPKSNRKACKSFG  76

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             FG+SF+S +G LPTF++ DRGDC F+LKAWNA
Sbjct  77   DFGLSFNSNSGGLPTFLLADRGDCFFSLKAWNA  109



>ref|XP_009125765.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-sorting receptor 2 [Brassica 
rapa]
Length=643

 Score =   139 bits (350),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V S + I+G Y+ ALGNFG+PQYGGSM+G+VVYPK N+K CK F+ 
Sbjct  30   SCMGRFVVEKNSLRVTSAEFIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  89

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF S+   LPTFV+VDRGDC F LKAWNA
Sbjct  90   FDISFRSRVSGLPTFVLVDRGDCYFTLKAWNA  121



>gb|EMT19677.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=618

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
               GRFVVEKN+LKV +PDS+KG+Y+ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  18   CCEGRFVVEKNSLKVTAPDSLKGSYECAIGNFGVPQYGGTMVGVVAYPKSNRKACKSFDD  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F IS+ +K GSLPTF++VDRGDC F  KAWNA
Sbjct  78   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNA  109



>ref|XP_011002594.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LK+ SP+S+KG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   I
Sbjct  21   GRFVVEKNSLKLTSPESLKGVYECAIGNFGVPQYGGTLVGTVVYPKANQKACKGFDEVDI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G LPTFV+ DRGDC F LKAWNA
Sbjct  81   SFKSRPGGLPTFVLADRGDCYFTLKAWNA  109



>emb|CDP06387.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   139 bits (349),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S +GRFVVEKN+LK+ SPDS+K  Y+ A+GNFG+PQYGG+M GTVVYPK ++K CK FD 
Sbjct  22   SCSGRFVVEKNSLKITSPDSLKRVYECAIGNFGVPQYGGTMIGTVVYPKADQKACKSFDD  81

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              ISF SK G  PTF++ DRGDC F LKAWNA
Sbjct  82   VDISFKSKPGGRPTFLLADRGDCYFTLKAWNA  113



>ref|XP_008788526.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=624

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S+ GRFVVEKN+LKV SP+S+KG Y+ A+GNFG+PQYGG+M G VVYPK NRK C  FD 
Sbjct  21   SSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYPKANRKACSKFDD  80

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF SK GS PTF++VDRGDC F  KAWNA
Sbjct  81   FDISFKSKPGSFPTFLLVDRGDCYFTAKAWNA  112



>ref|XP_010517715.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X2 [Camelina 
sativa]
Length=626

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP++IKGT+DSA+GNFGIPQYGGSM GTVVYP++N K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPETIKGTHDSAIGNFGIPQYGGSMAGTVVYPRENHKSCKEFSDFSI  81

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G+LP F++VDRGDC FALK WNA
Sbjct  82   SFKSQPGALPIFLLVDRGDCFFALKVWNA  110



>ref|XP_010517708.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X1 [Camelina 
sativa]
Length=626

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP++IKGT+DSA+GNFGIPQYGGSM GTVVYP++N K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPETIKGTHDSAIGNFGIPQYGGSMAGTVVYPRENHKSCKEFSDFSI  81

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF S+ G+LP F++VDRGDC FALK WNA
Sbjct  82   SFKSQPGALPIFLLVDRGDCFFALKVWNA  110



>ref|XP_008370266.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Malus 
domestica]
Length=625

 Score =   138 bits (348),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 61/89 (69%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGF+ F  
Sbjct  21   GRFVVEKNSLKVTSPSSMKGLYECAIGNFGVPQYGGTLVGTVYYPKTNQKACKGFEDFDE  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF  K G LPTF++VDRGDC F LKAWNA
Sbjct  81   SFKPKPGGLPTFLLVDRGDCYFTLKAWNA  109



>ref|XP_008370265.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Malus 
domestica]
Length=626

 Score =   138 bits (348),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 61/89 (69%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGF+ F  
Sbjct  21   GRFVVEKNSLKVTSPSSMKGLYECAIGNFGVPQYGGTLVGTVYYPKTNQKACKGFEDFDE  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF  K G LPTF++VDRGDC F LKAWNA
Sbjct  81   SFKPKPGGLPTFLLVDRGDCYFTLKAWNA  109



>ref|XP_006403762.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
 gb|ESQ45215.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
Length=654

 Score =   139 bits (349),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   ALGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  79

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALK  458
             ISF S+ G LPTFV++DRGDC F LK
Sbjct  80   DISFKSRPGRLPTFVLIDRGDCFFTLK  106



>gb|KHG23770.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   138 bits (348),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD F I
Sbjct  21   GRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDEFDI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G LPTF++V+RGDC F LKAWNA
Sbjct  81   SFKSKPGGLPTFLLVNRGDCFFTLKAWNA  109



>ref|XP_009611966.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=624

 Score =   138 bits (348),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP+SIK  Y+ A+GNFG+PQYGG++ G V YPK N+K CK F+ 
Sbjct  18   SCYGRFVVEKNSLRVTSPESIKDVYECAIGNFGVPQYGGTLVGNVAYPKANQKSCKSFES  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              ISF SKAGS+P FV+VDRGDC F LKAWNA
Sbjct  78   ADISFKSKAGSMPVFVLVDRGDCYFTLKAWNA  109



>ref|XP_009611965.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=626

 Score =   138 bits (348),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP+SIK  Y+ A+GNFG+PQYGG++ G V YPK N+K CK F+ 
Sbjct  18   SCYGRFVVEKNSLRVTSPESIKDVYECAIGNFGVPQYGGTLVGNVAYPKANQKSCKSFES  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              ISF SKAGS+P FV+VDRGDC F LKAWNA
Sbjct  78   ADISFKSKAGSMPVFVLVDRGDCYFTLKAWNA  109



>ref|XP_004977384.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=624

 Score =   138 bits (348),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 59/89 (66%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD F I
Sbjct  25   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANKKACKSFDDFDI  84

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            S+ +K G+ PTF++VDRGDC F  KAWNA
Sbjct  85   SYKAKPGAFPTFLLVDRGDCYFTKKAWNA  113



>ref|XP_004978527.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=624

 Score =   138 bits (348),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 59/89 (66%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD F I
Sbjct  25   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANKKACKSFDDFDI  84

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            S+ +K G+ PTF++VDRGDC F  KAWNA
Sbjct  85   SYKAKPGAFPTFLLVDRGDCYFTKKAWNA  113



>ref|XP_002876170.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52429.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   138 bits (347),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            + GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  17   SMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  76

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALK  458
             ISF SK G LPTFV++DRGDC F LK
Sbjct  77   DISFKSKPGRLPTFVLIDRGDCYFTLK  103



>gb|EPS57970.1| hypothetical protein M569_16845, partial [Genlisea aurea]
Length=598

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 77/90 (86%), Gaps = 4/90 (4%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPK-DNRKGCKGFDGFG  380
            GRFVVEKN+L+V SP+SIKGT+DSA+GNFGIPQYGGSM GTV+YPK DNRKGCK FD   
Sbjct  1    GRFVVEKNSLRVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVLYPKDDNRKGCKTFDA--  58

Query  381  ISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             SF + AG+LP F++VDRGDC FALK WNA
Sbjct  59   -SFKANAGALPNFLLVDRGDCFFALKVWNA  87



>gb|KJB29888.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   138 bits (347),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD F I
Sbjct  21   GRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDEFDI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G LPTF++V+RGDC F LKAWNA
Sbjct  81   SFKSKPGGLPTFLLVNRGDCFFTLKAWNA  109



>gb|KJB29887.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   138 bits (347),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD F I
Sbjct  21   GRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDEFDI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G LPTF++V+RGDC F LKAWNA
Sbjct  81   SFKSKPGGLPTFLLVNRGDCFFTLKAWNA  109



>gb|KJB29886.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=623

 Score =   138 bits (347),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD F I
Sbjct  21   GRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDEFDI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G LPTF++V+RGDC F LKAWNA
Sbjct  81   SFKSKPGGLPTFLLVNRGDCFFTLKAWNA  109



>gb|AAB72112.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=630

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 77/93 (83%), Gaps = 2/93 (2%)
 Frame = +3

Query  198  AAGRFVV--EKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
            +  RFVV  EKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F 
Sbjct  22   SEARFVVSNEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFS  81

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             F ISF S+ G+LPTF++VDRGDC FALK WNA
Sbjct  82   DFSISFKSQPGALPTFLLVDRGDCFFALKVWNA  114



>ref|XP_010504032.1| PREDICTED: vacuolar-sorting receptor 1 [Camelina sativa]
Length=626

 Score =   138 bits (347),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKNNLKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   ALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYTDF  79

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALK  458
             ISF SK G LPTFV++DRGDC F LK
Sbjct  80   DISFKSKPGRLPTFVLIDRGDCYFTLK  106



>dbj|BAK03786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV +PDS+KG+Y+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  96   GRFVVEKNSLKVTAPDSLKGSYECAIGNFGVPQYGGTMVGVVAYPKANRKACKSFDDFDI  155

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            S+ +K GSLPTF++VDRGDC F  KAWNA
Sbjct  156  SYKAKPGSLPTFLLVDRGDCFFTKKAWNA  184



>ref|XP_006403761.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
 gb|ESQ45214.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
Length=626

 Score =   137 bits (346),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   ALGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  79

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALK  458
             ISF S+ G LPTFV++DRGDC F LK
Sbjct  80   DISFKSRPGRLPTFVLIDRGDCFFTLK  106



>gb|EMT24279.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=625

 Score =   137 bits (346),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L+V +P+++KG Y+ A+GNFG+PQYGG+M G V YPK NRK CKGFD F +
Sbjct  26   ARFVVEKNSLRVTAPEALKGAYECAIGNFGVPQYGGTMVGVVAYPKANRKACKGFDDFDV  85

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF ++ G+LPTF++VDRGDC F  KAWNA
Sbjct  86   SFKARPGALPTFLLVDRGDCYFTKKAWNA  114



>ref|XP_007207200.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
 gb|EMJ08399.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
Length=625

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
              GRFVVEKN+LKV SP S+K  Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGFD F
Sbjct  19   CVGRFVVEKNSLKVTSPSSLKSVYECAIGNFGVPQYGGTLVGTVYYPKANQKACKGFDDF  78

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             +SF SK G LPTF++VDRGDC F LKAWNA
Sbjct  79   DVSFKSKPGGLPTFLLVDRGDCFFTLKAWNA  109



>ref|XP_010253065.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   137 bits (346),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP S+KG Y+ A+GNFG+PQYGG+M GTVVYPK N+K C  FD 
Sbjct  17   SCLGRFVVEKNSLRVTSPQSLKGVYECAIGNFGVPQYGGTMVGTVVYPKVNQKACNDFDE  76

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              +SF SK G LPTF++ DRGDC F LKAWNA
Sbjct  77   VDLSFKSKPGGLPTFLLADRGDCFFTLKAWNA  108



>ref|XP_004510100.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=629

 Score =   137 bits (346),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M GTVVYPK NR GC  F+ 
Sbjct  20   SCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGTVVYPKFNRNGCNKFND  79

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
               S +SK GS PTFV+VDRGDC F LKAWNA
Sbjct  80   GDTSLTSKPGSFPTFVLVDRGDCYFTLKAWNA  111



>ref|XP_006362349.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum tuberosum]
Length=624

 Score =   137 bits (345),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 62/92 (67%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G VVYPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTMVGIVVYPKANQKSCKDFAD  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              ISF +KAG +P FV+VDRGDC F LKAWNA
Sbjct  78   SDISFKTKAGGMPVFVLVDRGDCYFTLKAWNA  109



>gb|KFK34530.1| hypothetical protein AALP_AA5G158000 [Arabis alpina]
Length=625

 Score =   137 bits (345),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK ++ F
Sbjct  20   ALGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYNDF  79

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALK  458
             ISF SK G  PTFV++DRGDC F LK
Sbjct  80   DISFKSKPGQKPTFVLIDRGDCFFTLK  106



>gb|EEE52644.1| hypothetical protein OsJ_35003 [Oryza sativa Japonica Group]
Length=591

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F IS+ +K GSLPTF++VDRGDC F  KAWNA
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNA  115



>ref|XP_010327707.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Solanum 
lycopersicum]
Length=624

 Score =   137 bits (344),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPDSIKNVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKDFAD  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              ISF +KAG +P FV+VDRGDC F LKAWNA
Sbjct  78   SDISFKTKAGGMPVFVLVDRGDCYFTLKAWNA  109



>tpg|DAA39323.1| TPA: hypothetical protein ZEAMMB73_720222, partial [Zea mays]
Length=620

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  25   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDDFDI  84

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            S+ +K G+ PTF++VDRGDC FA KAWNA
Sbjct  85   SYKAKPGAFPTFLLVDRGDCYFAKKAWNA  113



>ref|XP_010327706.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Solanum 
lycopersicum]
Length=626

 Score =   137 bits (344),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPDSIKNVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKDFAD  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              ISF +KAG +P FV+VDRGDC F LKAWNA
Sbjct  78   SDISFKTKAGGMPVFVLVDRGDCYFTLKAWNA  109



>ref|XP_009611473.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana tomentosiformis]
Length=623

 Score =   136 bits (343),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/92 (65%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP SIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPSSIKDVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKNFTD  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF SK G++P F++VDRGDC F LKAWNA
Sbjct  78   FDISFKSKPGAMPVFLLVDRGDCYFTLKAWNA  109



>ref|XP_002450144.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
 gb|EES09132.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
Length=627

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  28   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDDFDI  87

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            S+ +K G+ PTF++VDRGDC FA KAWNA
Sbjct  88   SYKAKPGAFPTFLLVDRGDCYFAKKAWNA  116



>gb|EEC67546.1| hypothetical protein OsI_34875 [Oryza sativa Indica Group]
Length=626

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F IS+ +K GSLPTF++VDRGDC F  KAWNA
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNA  115



>gb|EEE51529.1| hypothetical protein OsJ_32728 [Oryza sativa Japonica Group]
Length=626

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F IS+ +K GSLPTF++VDRGDC F  KAWNA
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNA  115



>ref|XP_004511311.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Cicer 
arietinum]
Length=654

 Score =   137 bits (344),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 63/91 (69%), Positives = 73/91 (80%), Gaps = 3/91 (3%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  RFVVEKN+L V SPD IKG +DSA+GNFGIPQYGGSM GTVVYPKDN KGCK FD  
Sbjct  20   SMARFVVEKNSLSVTSPDKIKGRHDSAIGNFGIPQYGGSMAGTVVYPKDNNKGCKDFDQ-  78

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              SF S+ G+LPT +++DRG+C FALK WNA
Sbjct  79   --SFKSRPGALPTILLLDRGNCFFALKVWNA  107



>ref|XP_009775401.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana sylvestris]
Length=623

 Score =   136 bits (343),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 60/92 (65%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP SIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPSSIKDVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKNFAD  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF SK G++P F++VDRGDC F LKAWNA
Sbjct  78   FDISFKSKPGAMPVFLLVDRGDCYFTLKAWNA  109



>ref|NP_001169650.1| hypothetical protein precursor [Zea mays]
 gb|ACN34397.1| unknown [Zea mays]
Length=521

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  24   GRFVVEKNSLKVTAPDGLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDDFDI  83

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            S+ +K G+ PTF++VDRGDC FA KAWNA
Sbjct  84   SYKAKPGAFPTFLLVDRGDCYFAKKAWNA  112



>gb|EEC68730.1| hypothetical protein OsI_37233 [Oryza sativa Indica Group]
Length=626

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F IS+ +K GSLPTF++VDRGDC F  KAWNA
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNA  115



>ref|XP_003529053.2| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
 gb|KHN25078.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=624

 Score =   136 bits (342),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 60/92 (65%), Positives = 73/92 (79%), Gaps = 3/92 (3%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M G+VVYPK N+ GC+ FD 
Sbjct  20   SCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGSVVYPKSNQNGCRNFDA  79

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
               S SSK G+ PTFV+VDRGDC F LKAWNA
Sbjct  80   ---SLSSKPGTFPTFVLVDRGDCYFTLKAWNA  108



>ref|XP_003579018.1| PREDICTED: vacuolar-sorting receptor 1 [Brachypodium distachyon]
Length=623

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV +PD+++GTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  25   GRFVVEKNSLKVTAPDALRGTYECAIGNFGVPQYGGTMVGVVAYPKANRKACKSFDDFDI  84

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            S+ +K GS PTF++VDRGDC F  KAWNA
Sbjct  85   SYKAKPGSFPTFLLVDRGDCFFTKKAWNA  113



>ref|XP_008677615.1| PREDICTED: uncharacterized protein LOC100383531 isoform X1 [Zea 
mays]
 gb|AFW64625.1| hypothetical protein ZEAMMB73_291086 [Zea mays]
Length=623

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
               GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  21   CCQGRFVVEKNSLKVTAPDGLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDD  80

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F IS+ +K G+ PTF++VDRGDC FA KAWNA
Sbjct  81   FDISYKAKPGAFPTFLLVDRGDCYFAKKAWNA  112



>ref|XP_006411071.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
 gb|ESQ52524.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
Length=622

 Score =   136 bits (342),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 58/91 (64%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            A G+F+VEKNNLKV SP++IKG Y+ A+GNFGIP+YGG++ G VV+P  N K CK F  F
Sbjct  19   ALGKFLVEKNNLKVTSPETIKGVYECAIGNFGIPKYGGTLVGAVVHPVSNHKACKSFSEF  78

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            G+SF S  G LPTF+++DRGDC F LKAWNA
Sbjct  79   GVSFKSTPGRLPTFLLIDRGDCYFTLKAWNA  109



>ref|NP_001065992.1| Os12g0116000 [Oryza sativa Japonica Group]
 gb|ABA96293.2| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29011.1| Os12g0116000 [Oryza sativa Japonica Group]
 dbj|BAG90054.1| unnamed protein product [Oryza sativa Japonica Group]
Length=728

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  126  SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  185

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F IS+ +K GSLPTF++VDRGDC F  KAWNA
Sbjct  186  FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNA  217



>dbj|BAK00302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score =   136 bits (342),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L+V +P ++KG Y+ A+GNFG+PQYGG+M G V YPK NRK CKGFD F +
Sbjct  43   ARFVVEKNSLRVTAPVALKGAYECAIGNFGVPQYGGTMVGVVAYPKANRKACKGFDDFDV  102

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF ++ G+LPTF++VDRGDC F  KAWNA
Sbjct  103  SFKARPGALPTFLLVDRGDCYFTKKAWNA  131



>emb|CAN66483.1| hypothetical protein VITISV_015390 [Vitis vinifera]
Length=625

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP+S+K  Y+ A+GNFG+PQYGG+M GTVVYPK N+K CK F+ 
Sbjct  18   SCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVPQYGGTMVGTVVYPKANQKACKSFED  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              ISF SK G LPTF++ DRGDC F LKAWNA
Sbjct  78   VEISFKSKPGGLPTFLLADRGDCFFTLKAWNA  109



>ref|XP_006842496.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
 gb|ERN04171.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
Length=622

 Score =   135 bits (340),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+L+V SPDS+K TY+ A+GNFG+PQYGG+M GTV YPK N+K C+ +    I
Sbjct  20   GRFVVEKNSLRVTSPDSLKDTYECAIGNFGVPQYGGTMVGTVTYPKSNQKACREYKEVEI  79

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G LPT V+ DRGDC F LKAWNA
Sbjct  80   SFKSKPGGLPTIVLADRGDCYFTLKAWNA  108



>ref|XP_010931377.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S+ GRFVVEKN+LKV SP+S+KGT++ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  17   SSFGRFVVEKNSLKVTSPESLKGTHECAIGNFGVPQYGGTMVGIVSYPKANRKACKSFDD  76

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF SK G  PTF+++DRGDC F  KAWNA
Sbjct  77   FDISFKSKPGGFPTFLLLDRGDCYFTEKAWNA  108



>ref|XP_008244809.1| PREDICTED: vacuolar-sorting receptor 1-like [Prunus mume]
Length=622

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
              GRFVVEKN+LKV SP S+K  Y+ A+GNFG+PQYGG++ GTV YPK N+K CK FD F
Sbjct  19   CVGRFVVEKNSLKVTSPSSLKSVYECAIGNFGVPQYGGTLVGTVYYPKANQKACKSFDDF  78

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             +SF SK G LPTF++VDRGDC F LKAWNA
Sbjct  79   DVSFKSKPGGLPTFLLVDRGDCFFTLKAWNA  109



>ref|XP_002267833.2| PREDICTED: vacuolar-sorting receptor 1 [Vitis vinifera]
 emb|CBI18031.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP+S+K  Y+ A+GNFG+PQYGG+M GTVVYPK N+K CK F+ 
Sbjct  18   SCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVPQYGGTMVGTVVYPKANQKACKSFED  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              ISF SK G LPTF++ DRGDC F LKAWNA
Sbjct  78   VEISFKSKPGGLPTFLLADRGDCFFTLKAWNA  109



>ref|XP_010515761.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score =   134 bits (338),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  207  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  386
            RFVVEKNNLKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F IS
Sbjct  23   RFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYTDFDIS  82

Query  387  FSSKAGSLPTFVIVDRGDCRFALK  458
            F SK G LPTFV++DRGDC F LK
Sbjct  83   FKSKPGRLPTFVLIDRGDCYFTLK  106



>ref|XP_010253066.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nelumbo 
nucifera]
Length=580

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+L+V SP S+KG Y+ A+GNFG+PQYGG+M GTVVYPK N+K C  FD 
Sbjct  17   SCLGRFVVEKNSLRVTSPQSLKGVYECAIGNFGVPQYGGTMVGTVVYPKVNQKACNDFDE  76

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              +SF SK G LPTF++ DRGDC F LKAWNA
Sbjct  77   VDLSFKSKPGGLPTFLLADRGDCFFTLKAWNA  108



>emb|CDY13344.1| BnaC06g14130D [Brassica napus]
Length=625

 Score =   134 bits (338),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  207  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  386
            RFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTV YPK N+K CK ++ F IS
Sbjct  23   RFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVAYPKSNQKACKSYNDFDIS  82

Query  387  FSSKAGSLPTFVIVDRGDCRFALK  458
            F SK G LPTFV++DRGDC F LK
Sbjct  83   FKSKPGGLPTFVLIDRGDCFFTLK  106



>ref|XP_010093546.1| Vacuolar-sorting receptor 1 [Morus notabilis]
 gb|EXB54253.1| Vacuolar-sorting receptor 1 [Morus notabilis]
Length=628

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
               GRFVVEKN+LKV SP+ +KG Y+ A+GNFG+PQYGG++ GTVVYP+ N+K CK F+ 
Sbjct  20   CVVGRFVVEKNSLKVTSPNPLKGVYECAIGNFGVPQYGGTLVGTVVYPQANQKACKNFED  79

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F +SF SK G LPTF++ DRGDC F LKAWNA
Sbjct  80   FSVSFKSKPGGLPTFLLADRGDCFFTLKAWNA  111



>gb|KDP21863.1| hypothetical protein JCGZ_00650 [Jatropha curcas]
Length=622

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+LKV SPDS++G Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK FD 
Sbjct  18   SCFGRFVVEKNSLKVTSPDSVRGIYECAIGNFGVPQYGGTLVGTVVYPKANQKACKEFDE  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
               SF SK G LPTFV+VDRGDC F  KAWNA
Sbjct  78   ADGSFKSKPGGLPTFVLVDRGDCYFTSKAWNA  109



>ref|XP_010922756.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S+ GRFVVEKN+LKV SP+S+KG Y+ A+GNFG+PQYGG+M G VVYPK N+K C+ F  
Sbjct  17   SSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYPKANKKACRNFAD  76

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF SK G  PTF++VDRGDC F  KAWNA
Sbjct  77   FDISFKSKPGGFPTFLLVDRGDCYFTAKAWNA  108



>ref|XP_009125234.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=625

 Score =   133 bits (335),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  207  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  386
            RFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTV YP+ N+K CK ++ F IS
Sbjct  23   RFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVAYPRSNQKACKSYNDFDIS  82

Query  387  FSSKAGSLPTFVIVDRGDCRFALK  458
            F SK G LPTFV++DRGDC F LK
Sbjct  83   FKSKPGGLPTFVLIDRGDCFFTLK  106



>emb|CDX67539.1| BnaA07g15790D [Brassica napus]
Length=625

 Score =   133 bits (335),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  207  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  386
            RFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTV YP+ N+K CK ++ F IS
Sbjct  23   RFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVAYPRSNQKACKSYNDFDIS  82

Query  387  FSSKAGSLPTFVIVDRGDCRFALK  458
            F SK G LPTFV++DRGDC F LK
Sbjct  83   FKSKPGGLPTFVLIDRGDCFFTLK  106



>sp|P93484.1|VSR1_PEA RecName: Full=Vacuolar-sorting receptor 1; AltName: Full=80 kDa 
proaleurein-binding protein; AltName: Full=BP-80; Flags: 
Precursor [Pisum sativum]
 gb|AAB72110.1| BP-80 vacuolar sorting receptor [Pisum sativum]
Length=623

 Score =   133 bits (334),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 61/91 (67%), Positives = 71/91 (78%), Gaps = 3/91 (3%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  RFVVEKN+L V SP+ IKG +DSA+GNFGIPQYGGSM G VVYPKDN KGCK FD  
Sbjct  20   STARFVVEKNSLSVTSPEKIKGKHDSAIGNFGIPQYGGSMAGNVVYPKDNSKGCKDFDS-  78

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              SF S+ G+LPT +++DRG C FALK WNA
Sbjct  79   --SFKSRPGALPTILLLDRGSCFFALKVWNA  107



>ref|XP_008792241.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=620

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S+ GRFVVEKN+LKV SP+S+KG Y+ A+GNFG+PQYGG+M G VVYPK NRK C+ FD 
Sbjct  17   SSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYPKANRKACQSFDD  76

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F ISF  K G  PTF++VDRGDC F  KAW A
Sbjct  77   FDISFKPKPGGFPTFLLVDRGDCFFTSKAWKA  108



>ref|XP_006650048.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 76/94 (81%), Gaps = 1/94 (1%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
            ++AAGRFVVEKN+L+V SPDSIKG Y+ A+GNFG+PQYGG++ G V YPK NRK CK F+
Sbjct  20   DTAAGRFVVEKNSLRVTSPDSIKGKYECAIGNFGVPQYGGTLHGWVEYPKSNRKACKSFE  79

Query  372  GFGISF-SSKAGSLPTFVIVDRGDCRFALKAWNA  470
             F ISF S+++G  P FV++DRGDC F  KAWNA
Sbjct  80   DFDISFKSTRSGGRPKFVLIDRGDCYFTTKAWNA  113



>ref|XP_003626680.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AET01156.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=625

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M GTVVYPK N+ GC  F+ 
Sbjct  18   SCMGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGTVVYPKLNKNGCTKFND  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
               S +SK GS PTFV+VDRGDC F LKAWNA
Sbjct  78   ADTSLNSKPGSFPTFVLVDRGDCYFTLKAWNA  109



>ref|XP_003521852.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=624

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 73/92 (79%), Gaps = 3/92 (3%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M G+VVYPK N+ GC+ FD 
Sbjct  20   SCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGSVVYPKSNQNGCRNFDA  79

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
               S SSK G+ PTFV+VDRGDC F LKAWNA
Sbjct  80   ---SLSSKPGTFPTFVLVDRGDCYFTLKAWNA  108



>gb|KHN42141.1| Vacuolar-sorting receptor 2 [Glycine soja]
Length=622

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 73/92 (79%), Gaps = 3/92 (3%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M G+VVYPK N+ GC+ FD 
Sbjct  18   SCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGSVVYPKSNQNGCRNFDA  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
               S SSK G+ PTFV+VDRGDC F LKAWNA
Sbjct  78   ---SLSSKPGTFPTFVLVDRGDCYFTLKAWNA  106



>ref|XP_004511312.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Cicer 
arietinum]
Length=623

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 73/91 (80%), Gaps = 3/91 (3%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  RFVVEKN+L V SPD IKG +DSA+GNFGIPQYGGSM GTVVYPKDN KGCK FD  
Sbjct  20   SMARFVVEKNSLSVTSPDKIKGRHDSAIGNFGIPQYGGSMAGTVVYPKDNNKGCKDFDQ-  78

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              SF S+ G+LPT +++DRG+C FALK WNA
Sbjct  79   --SFKSRPGALPTILLLDRGNCFFALKVWNA  107



>gb|EMS51356.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=640

 Score =   131 bits (330),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+L+V SP +++G Y+ A+GNFG+PQYGG+M G VVYPK N K CK F  FG+
Sbjct  36   GRFVVEKNSLRVTSPAALRGVYECAIGNFGMPQYGGTMHGVVVYPKANTKACKPFADFGL  95

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF+ KAG LP F++VDRGDC F  K WNA
Sbjct  96   SFNPKAGGLPVFLLVDRGDCYFTTKGWNA  124



>ref|XP_003623631.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AES79849.1| vacuolar sorting receptor [Medicago truncatula]
Length=625

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +3

Query  192  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  371
            E   GRF+VEKN+L++ SP S+KG+Y+ A+GNFG+PQYGG++ G+VVYP  N+KGCK F 
Sbjct  18   ECCFGRFLVEKNSLRITSPKSLKGSYECAIGNFGVPQYGGTLVGSVVYPNVNQKGCKNFT  77

Query  372  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             F  SF S  G+ PTFV+VDRGDC F LKAWNA
Sbjct  78   DFSASFHSMPGNFPTFVLVDRGDCYFTLKAWNA  110



>ref|XP_002992389.1| hypothetical protein SELMODRAFT_269926 [Selaginella moellendorffii]
 gb|EFJ06539.1| hypothetical protein SELMODRAFT_269926 [Selaginella moellendorffii]
Length=628

 Score =   131 bits (329),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  G+F+VEKN++ + +PDSIKGTYDSA+GNFG+PQYGGSM G VVYP+     C+ F  
Sbjct  22   SCWGKFLVEKNSISITTPDSIKGTYDSAIGNFGVPQYGGSMVGNVVYPEKGATACRNFSE  81

Query  375  FGISFSS-KAGSLPTFVIVDRGDCRFALKAWNA  470
            FGI+F   K+G LPT ++VDRGDC FALK W+A
Sbjct  82   FGITFKGLKSGGLPTVLLVDRGDCYFALKVWHA  114



>ref|XP_002967764.1| hypothetical protein SELMODRAFT_169577 [Selaginella moellendorffii]
 gb|EFJ31111.1| hypothetical protein SELMODRAFT_169577 [Selaginella moellendorffii]
Length=628

 Score =   130 bits (328),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  G+F+VEKN++ + +PDSIKGTYDSA+GNFG+PQYGGSM G VVYP+     C+ F  
Sbjct  22   SCWGKFLVEKNSISITTPDSIKGTYDSAIGNFGVPQYGGSMVGNVVYPEKGATACRNFSE  81

Query  375  FGISFSS-KAGSLPTFVIVDRGDCRFALKAWNA  470
            FGI+F   K+G LPT ++VDRGDC FALK W+A
Sbjct  82   FGITFKGLKSGGLPTVLLVDRGDCYFALKVWHA  114



>ref|NP_001275302.1| vacuolar sorting receptor protein PV72-like protein precursor 
[Solanum tuberosum]
 gb|ABC01915.1| vacuolar sorting receptor protein PV72-like protein [Solanum 
tuberosum]
Length=621

 Score =   130 bits (328),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  F I
Sbjct  19   GRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTMVGNVMYPKTNQKSCKNFSDFDI  78

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             + SK G +P F++VDR DC F LKAWNA
Sbjct  79   FYKSKPGGMPVFLLVDRRDCFFTLKAWNA  107



>ref|XP_010043186.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW88338.1| hypothetical protein EUGRSUZ_A00725 [Eucalyptus grandis]
Length=632

 Score =   130 bits (327),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVV+KN+LKV SP+S+KG ++ A+GNFG+PQYGG++ GTVVYP  N+  CK F  F +
Sbjct  27   GRFVVQKNSLKVTSPNSMKGAHECAIGNFGVPQYGGTLVGTVVYPSANQHACKEFREFDL  86

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF +K G LP FV+ DRGDC F LKAWNA
Sbjct  87   SFKTKPGGLPVFVLADRGDCYFTLKAWNA  115



>ref|XP_002968618.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
 gb|EFJ30872.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
Length=624

 Score =   130 bits (327),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            G+F+VEKN+L V SPDS+KGTYDSA+GNFG+PQYGG+M GTV YPKD+R  CK +     
Sbjct  22   GKFLVEKNSLSVTSPDSLKGTYDSAIGNFGVPQYGGTMVGTVTYPKDSRMACKPYSD-SD  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            +F  K+G LP  V+VDRGDC FALK WNA
Sbjct  81   TFRRKSGGLPNVVLVDRGDCYFALKVWNA  109



>ref|XP_002975863.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
 gb|EFJ22768.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
Length=624

 Score =   130 bits (327),  Expect = 4e-32, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 1/89 (1%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            G+F+VEKN+L V SPDS+KGTYDSA+GNFG+PQYGG+M GTV YPKD+R  CK +     
Sbjct  22   GKFLVEKNSLSVTSPDSLKGTYDSAIGNFGVPQYGGTMVGTVTYPKDSRMACKPYSD-SD  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            +F  K+G LP  V+VDRGDC FALK WNA
Sbjct  81   TFRRKSGGLPNVVLVDRGDCYFALKVWNA  109



>ref|XP_003610620.1| Vacuolar-sorting receptor [Medicago truncatula]
 gb|AES93578.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=622

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            +  RFVVEKN+L V SPD IKG +DSA+GNFGIPQYGGSM G VVYPKDN KGCK FD  
Sbjct  21   STARFVVEKNSLSVTSPDKIKGKHDSAIGNFGIPQYGGSMAGNVVYPKDNNKGCKDFDDS  80

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              SF SK G+LPT +++DRG C FALK WNA
Sbjct  81   S-SFKSKPGALPTILLLDRGSCFFALKVWNA  110



>ref|XP_006341299.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Solanum tuberosum]
Length=578

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
               GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  16   CCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTMVGNVMYPKTNQKSCKNFSD  75

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F I + SK G +P F++VDRGDC F LKAWNA
Sbjct  76   FDIFYKSKPGGMPVFLLVDRGDCFFTLKAWNA  107



>ref|XP_009372030.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=625

 Score =   130 bits (326),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEK++LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+  CKGF+    
Sbjct  21   ARFVVEKSSLKVTSPSSMKGEYECAIGNFGVPQYGGTLVGTVYYPKTNQMACKGFEDTDE  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF  K G LPTFV+VDRGDC F LKAWNA
Sbjct  81   SFKPKPGGLPTFVLVDRGDCYFTLKAWNA  109



>ref|XP_009372028.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=626

 Score =   130 bits (326),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEK++LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+  CKGF+    
Sbjct  21   ARFVVEKSSLKVTSPSSMKGEYECAIGNFGVPQYGGTLVGTVYYPKTNQMACKGFEDTDE  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF  K G LPTFV+VDRGDC F LKAWNA
Sbjct  81   SFKPKPGGLPTFVLVDRGDCYFTLKAWNA  109



>ref|XP_009388213.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+LKV SP+S+KG Y+SA+GNFG+PQYGG+M G V YPK N K C  F  F I
Sbjct  21   GRFVVEKNSLKVTSPNSLKGIYESAIGNFGVPQYGGTMVGIVAYPKVNWKACHNFKDFDI  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            S+ SK G  PTF++VDRGDC F  KAWNA
Sbjct  81   SYKSKPGGFPTFLLVDRGDCYFITKAWNA  109



>ref|XP_011095146.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=624

 Score =   129 bits (325),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 55/92 (60%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+LKV SPDS+KG ++ A+GNFG+PQYGG++ G+V YPK N+K C  F  
Sbjct  18   SCFGRFVVEKNSLKVASPDSLKGLHECAIGNFGVPQYGGTLVGSVFYPKSNQKACTNFQD  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              +SF +K G +P F++ DRGDC F LKAWNA
Sbjct  78   VDLSFQTKPGGIPIFLLADRGDCYFTLKAWNA  109



>gb|EMS62484.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=925

 Score =   130 bits (328),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 53/84 (63%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +3

Query  216  VEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGISFSS  395
            +EKN+L+V +P+++KG Y+ A+GNFG+PQYGG+M G V YPK NRK CKGFD F +SF +
Sbjct  330  LEKNSLRVTAPEALKGAYECAIGNFGVPQYGGTMVGVVAYPKANRKACKGFDEFDVSFKA  389

Query  396  KAGSLPTFVIVDRGDCRFALKAWN  467
            + G+LPTF++VDRGDC FA KAWN
Sbjct  390  RPGALPTFLLVDRGDCYFAKKAWN  413



>ref|XP_002467906.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
 gb|EER94904.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
Length=629

 Score =   129 bits (324),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 70/90 (78%), Gaps = 1/90 (1%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+++V SPD +KG Y+ A+GNFG+PQYGG++ G V YPK NRK C+ FD F I
Sbjct  24   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPKSNRKACQSFDQFDI  83

Query  384  SFSSK-AGSLPTFVIVDRGDCRFALKAWNA  470
            SF  K AG  PTFV+VDRG+C F  KAWNA
Sbjct  84   SFKPKQAGGRPTFVLVDRGECFFTTKAWNA  113



>ref|XP_006658133.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
             AAGRFV EKN+L+V SP  ++G Y+ A+GNFG+PQYGG+M G VVYPK NRK CK FD 
Sbjct  23   EAAGRFVGEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANRKACKAFDE  82

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F +SF  K+G LP F++VDRGDC F  K WNA
Sbjct  83   FDLSFKPKSGGLPVFLLVDRGDCYFTTKGWNA  114



>gb|EEC82690.1| hypothetical protein OsI_27347 [Oryza sativa Indica Group]
Length=626

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
             AAGRFVVEKN+L+V SP  ++G Y+ A+GNFG+PQYGG+M G VVYPK N+K C+ FD 
Sbjct  19   EAAGRFVVEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANKKACRSFDD  78

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F +SF  K G LP F++VDRGDC F  K WNA
Sbjct  79   FDLSFKPKPGGLPVFLLVDRGDCYFTTKGWNA  110



>gb|EYU35791.1| hypothetical protein MIMGU_mgv1a002876mg [Erythranthe guttata]
Length=628

 Score =   129 bits (324),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 55/89 (62%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKNNLKV SP+S++G Y+ A+GNFG+PQYGG M G+V YPK N+KGC  F    +
Sbjct  24   GRFVVEKNNLKVTSPESVRGVYECAIGNFGVPQYGGVMVGSVFYPKTNQKGCNTFQDSDL  83

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            S  +K G +P FV+ DRG+C F LKAWNA
Sbjct  84   SSKTKPGGIPLFVLADRGECYFTLKAWNA  112



>ref|NP_001060643.1| Os07g0680000 [Oryza sativa Japonica Group]
 dbj|BAC80001.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAD31218.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAF22557.1| Os07g0680000 [Oryza sativa Japonica Group]
 gb|EAZ41102.1| hypothetical protein OsJ_25594 [Oryza sativa Japonica Group]
 dbj|BAG93090.1| unnamed protein product [Oryza sativa Japonica Group]
Length=626

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
             AAGRFVVEKN+L+V SP  ++G Y+ A+GNFG+PQYGG+M G VVYPK N+K C+ FD 
Sbjct  19   EAAGRFVVEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANKKACRSFDD  78

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F +SF  K G LP F++VDRGDC F  K WNA
Sbjct  79   FDLSFKPKPGGLPIFLLVDRGDCYFTTKGWNA  110



>ref|XP_006663158.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=653

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            G FVVEKN+L+V +P  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD F I
Sbjct  54   GGFVVEKNSLRVTAPSDLKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDDFDI  113

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            S+  K GSLPTF++VDRGDC F  KAWNA
Sbjct  114  SYKPKPGSLPTFLLVDRGDCFFTKKAWNA  142



>gb|EPS72005.1| hypothetical protein M569_02753, partial [Genlisea aurea]
Length=557

 Score =   128 bits (321),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 55/92 (60%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S   RFVVEKNNLKV SP+S+KG Y+ A+GNFG+PQYGG+M G+V YPK NR  C  F G
Sbjct  15   SCTARFVVEKNNLKVTSPESLKGLYECAIGNFGVPQYGGTMPGSVYYPKSNRHACSDFRG  74

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
              I++ +K G +P F++VDRG+C F LKAWN+
Sbjct  75   SDITWRNKPGGIPAFLLVDRGECYFTLKAWNS  106



>ref|XP_004492565.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=621

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRF+VEKN+LK+ SP S+KGTY+ A+GNFG+PQYGG++ G+VVYP  N+KGC  F     
Sbjct  21   GRFLVEKNSLKITSPKSLKGTYECAIGNFGVPQYGGTLVGSVVYPNVNQKGCDNFTDVNA  80

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF SK G  PTF++VDRGDC F LKAWNA
Sbjct  81   SFQSKPGGFPTFLLVDRGDCYFTLKAWNA  109



>ref|XP_008660179.1| PREDICTED: vacuolar-sorting receptor 1 [Zea mays]
 gb|ACG42879.1| vacuolar sorting receptor 1 precursor [Zea mays]
 gb|ACL53481.1| unknown [Zea mays]
 gb|ACN34401.1| unknown [Zea mays]
 gb|AFW88458.1| vacuolar sorting receptor-like protein [Zea mays]
Length=629

 Score =   128 bits (322),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+L+V SPD +KG Y+ A+GNFG+PQYGG++ G V YPK NRK C+ FD F I
Sbjct  24   GRFVVEKNSLEVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPKSNRKACQSFDQFDI  83

Query  384  SFSSK-AGSLPTFVIVDRGDCRFALKAWNA  470
            SF  K AG  P FV+VDRG+C F  KAWNA
Sbjct  84   SFKPKQAGGRPIFVLVDRGECFFTTKAWNA  113



>ref|XP_004984466.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X4 [Setaria 
italica]
Length=629

 Score =   128 bits (321),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+++V SPD +KG Y+ A+GNFG+PQYGG++ G V YP+ NRKGC+ FD F I
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPRSNRKGCQSFDQFDI  82

Query  384  SFS-SKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF   KAG  P FV++DRG+C F +KAWNA
Sbjct  83   SFKPKKAGGRPNFVLLDRGECFFTVKAWNA  112



>ref|XP_004984464.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Setaria 
italica]
Length=656

 Score =   128 bits (321),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+++V SPD +KG Y+ A+GNFG+PQYGG++ G V YP+ NRKGC+ FD F I
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPRSNRKGCQSFDQFDI  82

Query  384  SFS-SKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF   KAG  P FV++DRG+C F +KAWNA
Sbjct  83   SFKPKKAGGRPNFVLLDRGECFFTVKAWNA  112



>ref|XP_006664280.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=698

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            G F+VEKN+L+V +P  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD F I
Sbjct  99   GGFLVEKNSLRVTAPSDLKGTYECAIGNFGVPQYGGTMVGVVTYPKANKKACKSFDDFDI  158

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            S+  K GSLPTF++VDRGDC F  KAWNA
Sbjct  159  SYKPKPGSLPTFLLVDRGDCFFTKKAWNA  187



>gb|EEC66779.1| hypothetical protein OsI_33169 [Oryza sativa Indica Group]
Length=231

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP S++G +DSA+GNFG+PQYGGSM GTVVYPKDN   C+ +DG   
Sbjct  27   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGVPQYGGSMAGTVVYPKDNADACEAYDG-DR  85

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             F +K G+LP F+++DRG+C FA K WNA
Sbjct  86   HFRAKPGALPNFLLIDRGNCLFAKKVWNA  114



>ref|XP_009404782.1| PREDICTED: vacuolar-sorting receptor 4-like [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   127 bits (319),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 59/91 (65%), Positives = 69/91 (76%), Gaps = 1/91 (1%)
 Frame = +3

Query  198  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  377
            AAGRFVVEKN+L V SP  +KG +DSA+GNFGIPQYGGSM G VVYPK+N + C  F   
Sbjct  27   AAGRFVVEKNSLMVISPSELKGKHDSAIGNFGIPQYGGSMAGAVVYPKENARACDQFSRS  86

Query  378  GISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             + F  KAG+LP FV++DRGDC FA K WNA
Sbjct  87   DL-FKPKAGALPNFVLIDRGDCLFAKKVWNA  116



>gb|ACG44286.1| vacuolar sorting receptor 3 precursor [Zea mays]
Length=575

 Score =   126 bits (317),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG   
Sbjct  21   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-  79

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             F +K G++PTF+++DRG+C FA K WNA
Sbjct  80   PFRAKPGAMPTFLLIDRGECLFAKKVWNA  108



>ref|XP_004984465.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X3 [Setaria 
italica]
Length=655

 Score =   127 bits (319),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+++V SPD +KG Y+ A+GNFG+PQYGG++ G V YP+ NRKGC+ FD F I
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPRSNRKGCQSFDQFDI  82

Query  384  SFS-SKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF   KAG  P FV++DRG+C F +KAWNA
Sbjct  83   SFKPKKAGGRPNFVLLDRGECFFTVKAWNA  112



>ref|XP_004984463.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=682

 Score =   127 bits (319),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKN+++V SPD +KG Y+ A+GNFG+PQYGG++ G V YP+ NRKGC+ FD F I
Sbjct  23   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPRSNRKGCQSFDQFDI  82

Query  384  SFS-SKAGSLPTFVIVDRGDCRFALKAWNA  470
            SF   KAG  P FV++DRG+C F +KAWNA
Sbjct  83   SFKPKKAGGRPNFVLLDRGECFFTVKAWNA  112



>gb|EYU42029.1| hypothetical protein MIMGU_mgv1a002928mg [Erythranthe guttata]
Length=624

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  374
            S  GRFVVEKN+LKV SPDS+K  Y+ A+GNFG+P YGGSM G+V YPK N K CK F  
Sbjct  18   SCLGRFVVEKNSLKVTSPDSLKDVYECAIGNFGVPDYGGSMAGSVFYPKSNEKACKNFQD  77

Query  375  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            F I+  +K G LP F++ DRG+C F LKAWNA
Sbjct  78   FDIALKTKPGGLPIFLLADRGECFFTLKAWNA  109



>ref|XP_011086922.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=631

 Score =   126 bits (316),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 53/89 (60%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
            GRFVVEKNNL+V SP S++G Y+ A+GNFG+PQYGG+M G+V YPK N+K C  F    I
Sbjct  28   GRFVVEKNNLRVTSPGSVRGIYECAIGNFGVPQYGGTMLGSVFYPKANQKACNTFQDSDI  87

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
            ++ +K G +P F++ DRGDC F LKAWNA
Sbjct  88   TWKNKPGGIPIFLLADRGDCYFTLKAWNA  116



>gb|AFW68894.1| hypothetical protein ZEAMMB73_054159 [Zea mays]
Length=618

 Score =   125 bits (315),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG   
Sbjct  28   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-  86

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             F +K G++PTF+++DRG+C FA K WNA
Sbjct  87   PFRAKPGAMPTFLLIDRGECLFAKKVWNA  115



>gb|ACN30885.1| unknown [Zea mays]
Length=625

 Score =   125 bits (315),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +3

Query  204  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  383
             RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG   
Sbjct  21   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-  79

Query  384  SFSSKAGSLPTFVIVDRGDCRFALKAWNA  470
             F +K G++PTF+++DRG+C FA K WNA
Sbjct  80   PFRAKPGAMPTFLLIDRGECLFAKKVWNA  108



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554587825180