BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF049A23

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612011.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    187   6e-52   Nicotiana tomentosiformis
ref|XP_006351808.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    182   2e-50   Solanum tuberosum [potatoes]
ref|XP_004230547.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    180   2e-49   
ref|XP_009762535.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    177   1e-48   Nicotiana sylvestris
dbj|BAQ02862.1|  alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosi...    171   4e-48   Nicotiana tabacum [American tobacco]
gb|KDO56532.1|  hypothetical protein CISIN_1g0476211mg                  164   1e-46   Citrus sinensis [apfelsine]
ref|XP_011092407.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    172   1e-46   Sesamum indicum [beniseed]
ref|XP_009628814.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    171   2e-46   Nicotiana tomentosiformis
ref|XP_009801214.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    171   2e-46   Nicotiana sylvestris
emb|CAN77623.1|  hypothetical protein VITISV_007589                     160   3e-46   Vitis vinifera
emb|CAJ65922.1|  xylan 1,4-beta-xylosidase                              168   3e-45   Populus tremula x Populus alba [gray poplar]
ref|XP_002298197.2|  beta-glucosidase family protein                    168   4e-45   
emb|CAJ65921.1|  xylan 1,4-beta-xylosidase                              165   3e-44   Populus tremula x Populus alba [gray poplar]
ref|XP_011015574.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    166   3e-44   Populus euphratica
ref|XP_011046123.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    166   3e-44   Populus euphratica
ref|XP_002303181.1|  beta-glucosidase family protein                    165   3e-44   
ref|XP_006493288.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    165   4e-44   Citrus sinensis [apfelsine]
ref|XP_006432467.1|  hypothetical protein CICLE_v10000355mg             165   4e-44   Citrus clementina [clementine]
ref|XP_011004967.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    164   8e-44   Populus euphratica
ref|XP_010546362.1|  PREDICTED: beta-D-xylosidase 4                     163   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_008344154.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    162   3e-43   
gb|EPS65933.1|  hypothetical protein M569_08842                         162   4e-43   Genlisea aurea
ref|XP_002513707.1|  Beta-glucosidase, putative                         162   5e-43   Ricinus communis
ref|XP_010243340.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    162   6e-43   Nelumbo nucifera [Indian lotus]
gb|KDP30704.1|  hypothetical protein JCGZ_16402                         162   7e-43   Jatropha curcas
ref|XP_008339210.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    161   1e-42   
ref|XP_009354080.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    161   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_009347830.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    161   1e-42   
emb|CBI40687.3|  unnamed protein product                                160   1e-42   Vitis vinifera
ref|XP_002264183.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    160   2e-42   Vitis vinifera
ref|XP_009379698.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    160   2e-42   
ref|NP_001233910.1|  beta-D-xylosidase 1 precursor                      160   2e-42   Solanum lycopersicum
ref|XP_002268626.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    160   3e-42   Vitis vinifera
ref|XP_006341844.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    160   4e-42   Solanum tuberosum [potatoes]
emb|CDY18705.1|  BnaA09g06900D                                          159   6e-42   Brassica napus [oilseed rape]
ref|XP_009112141.1|  PREDICTED: beta-D-xylosidase 4-like                159   6e-42   Brassica rapa
ref|XP_010520456.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    158   1e-41   
ref|XP_007148433.1|  hypothetical protein PHAVU_006G208200g             158   2e-41   Phaseolus vulgaris [French bean]
ref|XP_010065531.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    158   2e-41   Eucalyptus grandis [rose gum]
gb|EYU35409.1|  hypothetical protein MIMGU_mgv1a001738mg                158   2e-41   Erythranthe guttata [common monkey flower]
ref|XP_010103839.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2      158   2e-41   Morus notabilis
sp|A5JTQ3.1|XYL2_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    157   2e-41   Medicago sativa subsp. x varia
ref|XP_007043027.1|  Beta-D-xylosidase 4                                157   2e-41   
gb|KFK28148.1|  hypothetical protein AALP_AA8G478800                    157   3e-41   Arabis alpina [alpine rockcress]
ref|XP_010261102.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    157   3e-41   Nelumbo nucifera [Indian lotus]
emb|CDY46812.1|  BnaC02g43200D                                          157   5e-41   Brassica napus [oilseed rape]
gb|KEH31243.1|  beta-xylosidase/alpha-L-arabinofuranosidase-like ...    156   6e-41   Medicago truncatula
emb|CDX81229.1|  BnaC09g06400D                                          156   6e-41   
ref|XP_006280038.1|  hypothetical protein CARUB_v10025915mg             156   7e-41   Capsella rubella
gb|KHG10349.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           156   7e-41   Gossypium arboreum [tree cotton]
ref|XP_004504774.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    156   7e-41   Cicer arietinum [garbanzo]
gb|KJB31995.1|  hypothetical protein B456_005G218000                    156   8e-41   Gossypium raimondii
ref|XP_010065527.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    156   8e-41   Eucalyptus grandis [rose gum]
ref|XP_006394136.1|  hypothetical protein EUTSA_v10003678mg             156   9e-41   Eutrema salsugineum [saltwater cress]
gb|KCW63061.1|  hypothetical protein EUGRSUZ_G006532                    145   9e-41   Eucalyptus grandis [rose gum]
ref|XP_010444394.1|  PREDICTED: beta-D-xylosidase 4-like                155   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_003547598.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    155   2e-40   Glycine max [soybeans]
ref|XP_007225245.1|  hypothetical protein PRUPE_ppa001692mg             155   2e-40   Prunus persica
ref|XP_003531557.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    154   4e-40   Glycine max [soybeans]
ref|NP_201262.1|  beta-D-xylosidase 4                                   154   5e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461983.1|  PREDICTED: beta-D-xylosidase 4-like                154   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_002866623.1|  beta-xylosidase 4                                  154   5e-40   Arabidopsis lyrata subsp. lyrata
emb|CDY31313.1|  BnaA02g34280D                                          154   5e-40   Brassica napus [oilseed rape]
ref|XP_010484241.1|  PREDICTED: beta-D-xylosidase 4                     154   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009130462.1|  PREDICTED: beta-D-xylosidase 4-like                154   5e-40   Brassica rapa
ref|XP_009401393.1|  PREDICTED: beta-D-xylosidase 4-like                153   7e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010065529.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    152   2e-39   Eucalyptus grandis [rose gum]
ref|XP_011087838.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    152   2e-39   Sesamum indicum [beniseed]
ref|XP_008784548.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    152   2e-39   
ref|XP_008218886.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    152   3e-39   Prunus mume [ume]
ref|XP_007159080.1|  hypothetical protein PHAVU_002G206800g             151   4e-39   Phaseolus vulgaris [French bean]
ref|XP_011465594.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    151   6e-39   Fragaria vesca subsp. vesca
ref|XP_004300692.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    151   7e-39   Fragaria vesca subsp. vesca
ref|XP_011087839.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    150   1e-38   Sesamum indicum [beniseed]
ref|XP_004136861.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    149   2e-38   
gb|KFK25272.1|  hypothetical protein AALP_AA8G090500                    149   3e-38   Arabis alpina [alpine rockcress]
ref|XP_008455235.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    149   4e-38   Cucumis melo [Oriental melon]
ref|XP_004155509.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    149   5e-38   
ref|XP_010937054.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    148   5e-38   Elaeis guineensis
emb|CDY51290.1|  BnaA06g23560D                                          148   6e-38   Brassica napus [oilseed rape]
ref|XP_009150540.1|  PREDICTED: beta-D-xylosidase 4                     148   6e-38   Brassica rapa
emb|CDY56487.1|  BnaCnng30450D                                          148   7e-38   Brassica napus [oilseed rape]
dbj|BAE44362.1|  alpha-L-arabinofuranosidase                            148   9e-38   Raphanus sativus
ref|NP_196535.1|  beta-xylosidase 3                                     147   1e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDY52884.1|  BnaC06g27770D                                          142   2e-37   Brassica napus [oilseed rape]
ref|XP_006827121.1|  hypothetical protein AMTR_s00010p00246460          147   2e-37   Amborella trichopoda
ref|XP_010065530.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    147   2e-37   Eucalyptus grandis [rose gum]
ref|XP_002873418.1|  beta-xylosidase 3                                  146   4e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_009403180.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    145   4e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003593145.1|  Beta-xylosidase/alpha-L-arabinofuranosidase        145   6e-37   Medicago truncatula
ref|XP_004485551.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    145   6e-37   Cicer arietinum [garbanzo]
ref|XP_010452969.1|  PREDICTED: beta-D-xylosidase 3-like                145   8e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006399455.1|  hypothetical protein EUTSA_v10012739mg             145   1e-36   Eutrema salsugineum [saltwater cress]
gb|KJB77499.1|  hypothetical protein B456_012G140300                    144   1e-36   Gossypium raimondii
ref|XP_010422951.1|  PREDICTED: beta-D-xylosidase 3 isoform X2          144   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010422950.1|  PREDICTED: beta-D-xylosidase 3 isoform X1          144   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010687471.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    144   2e-36   Beta vulgaris subsp. vulgaris [field beet]
sp|A5JTQ2.1|XYL1_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    144   3e-36   Medicago sativa subsp. x varia
gb|KHN06823.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           138   3e-36   Glycine soja [wild soybean]
gb|KHG02719.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           143   3e-36   Gossypium arboreum [tree cotton]
ref|XP_004301992.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    143   4e-36   Fragaria vesca subsp. vesca
ref|XP_010491610.1|  PREDICTED: beta-D-xylosidase 3-like isoform X1     143   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010491611.1|  PREDICTED: beta-D-xylosidase 3-like isoform X2     142   5e-36   Camelina sativa [gold-of-pleasure]
emb|CDY21595.1|  BnaC09g46970D                                          142   1e-35   Brassica napus [oilseed rape]
ref|XP_003524073.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    140   1e-35   
ref|XP_009629821.1|  PREDICTED: beta-D-xylosidase 1-like isoform X2     132   2e-35   Nicotiana tomentosiformis
emb|CDY01780.1|  BnaC06g28200D                                          140   4e-35   
emb|CDX96113.1|  BnaA07g26180D                                          141   4e-35   
ref|XP_010491609.1|  PREDICTED: beta-D-xylosidase 4-like                140   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009105246.1|  PREDICTED: beta-D-xylosidase 3-like                140   6e-35   Brassica rapa
ref|XP_010068200.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    138   6e-35   Eucalyptus grandis [rose gum]
emb|CDX97115.1|  BnaC09g45100D                                          139   6e-35   
gb|EYU18508.1|  hypothetical protein MIMGU_mgv1a001685mg                139   1e-34   Erythranthe guttata [common monkey flower]
gb|EYU18507.1|  hypothetical protein MIMGU_mgv1a001685mg                139   1e-34   Erythranthe guttata [common monkey flower]
ref|XP_003531047.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    139   1e-34   Glycine max [soybeans]
ref|XP_009629820.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1     130   1e-34   Nicotiana tomentosiformis
ref|XP_009122535.1|  PREDICTED: beta-D-xylosidase 3-like                139   1e-34   Brassica rapa
emb|CDY35825.1|  BnaC09g37570D                                          139   1e-34   Brassica napus [oilseed rape]
gb|ABR17218.1|  unknown                                                 130   1e-34   Picea sitchensis
emb|CDX69892.1|  BnaA10g22410D                                          139   2e-34   
dbj|BAJ89945.1|  predicted protein                                      136   2e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90420.1|  predicted protein                                      137   8e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90315.1|  predicted protein                                      137   8e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT32951.1|  Beta-D-xylosidase 4                                     137   9e-34   
emb|CAJ86028.1|  B0414F07.1                                             132   1e-33   Oryza sativa [red rice]
ref|XP_010424711.1|  PREDICTED: beta-D-xylosidase 4-like                136   1e-33   
gb|AAK38481.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase iso...    135   4e-33   Hordeum vulgare [barley]
ref|XP_002448619.1|  hypothetical protein SORBIDRAFT_06g030270          133   1e-32   Sorghum bicolor [broomcorn]
ref|XP_009804071.1|  PREDICTED: beta-D-xylosidase 1 isoform X2          132   2e-32   Nicotiana sylvestris
gb|EYU18509.1|  hypothetical protein MIMGU_mgv1a001665mg                130   3e-32   Erythranthe guttata [common monkey flower]
ref|XP_002974833.1|  hypothetical protein SELMODRAFT_101733             132   3e-32   Selaginella moellendorffii
ref|XP_009804070.1|  PREDICTED: beta-D-xylosidase 1 isoform X1          132   4e-32   Nicotiana sylvestris
ref|XP_008445351.1|  PREDICTED: probable beta-D-xylosidase 7            132   4e-32   Cucumis melo [Oriental melon]
ref|XP_002963750.1|  hypothetical protein SELMODRAFT_80102              132   4e-32   Selaginella moellendorffii
ref|XP_004976989.1|  PREDICTED: beta-D-xylosidase 4-like isoform X2     132   5e-32   Setaria italica
ref|NP_001054038.1|  Os04g0640700                                       131   5e-32   
emb|CAE03635.1|  OSJNBb0003B01.27                                       132   5e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003615011.1|  Beta-D-xylosidase                                  123   7e-32   
ref|XP_003615012.1|  Auxin-induced beta-glucosidase                     124   7e-32   
ref|XP_006855294.1|  hypothetical protein AMTR_s00057p00049120          131   7e-32   Amborella trichopoda
ref|XP_002515300.1|  Beta-glucosidase, putative                         131   8e-32   Ricinus communis
ref|XP_004976988.1|  PREDICTED: beta-D-xylosidase 4-like isoform X1     131   8e-32   
gb|AFW59619.1|  putative O-Glycosyl hydrolase superfamily protein       128   9e-32   
gb|EYU44008.1|  hypothetical protein MIMGU_mgv1a0207571mg               124   1e-31   Erythranthe guttata [common monkey flower]
emb|CDP18762.1|  unnamed protein product                                128   2e-31   Coffea canephora [robusta coffee]
gb|EYU23815.1|  hypothetical protein MIMGU_mgv1a0042532mg               126   2e-31   Erythranthe guttata [common monkey flower]
ref|XP_008661822.1|  PREDICTED: uncharacterized protein LOC100279...    129   5e-31   
gb|KHG24361.1|  Beta-D-xylosidase 1 -like protein                       123   6e-31   Gossypium arboreum [tree cotton]
ref|XP_006653810.1|  PREDICTED: beta-D-xylosidase 4-like                127   2e-30   
gb|KDP28242.1|  hypothetical protein JCGZ_14013                         127   2e-30   Jatropha curcas
ref|XP_003625957.1|  Beta-xylosidase                                    127   2e-30   Medicago truncatula
ref|XP_008234021.1|  PREDICTED: probable beta-D-xylosidase 7            126   4e-30   Prunus mume [ume]
ref|XP_004163321.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    126   4e-30   
ref|XP_003580652.1|  PREDICTED: beta-D-xylosidase 4-like                126   4e-30   Brachypodium distachyon [annual false brome]
ref|XP_004150696.1|  PREDICTED: probable beta-D-xylosidase 7-like       126   4e-30   Cucumis sativus [cucumbers]
ref|XP_010657638.1|  PREDICTED: beta-D-xylosidase 4-like                120   5e-30   
ref|XP_002285805.1|  PREDICTED: probable beta-D-xylosidase 7            126   5e-30   Vitis vinifera
gb|KDP44489.1|  hypothetical protein JCGZ_16322                         126   6e-30   Jatropha curcas
ref|XP_004170761.1|  PREDICTED: beta-D-xylosidase 1-like                120   6e-30   
gb|KJB38536.1|  hypothetical protein B456_006G259500                    124   7e-30   Gossypium raimondii
gb|KHN30647.1|  Putative beta-D-xylosidase 2                            124   8e-30   Glycine soja [wild soybean]
ref|XP_003615003.1|  Xylan 1 4-beta-xylosidase                          125   1e-29   Medicago truncatula
emb|CBI19138.3|  unnamed protein product                                126   1e-29   Vitis vinifera
gb|KJB77632.1|  hypothetical protein B456_012G147500                    125   1e-29   Gossypium raimondii
ref|XP_011015623.1|  PREDICTED: probable beta-D-xylosidase 2            124   1e-29   Populus euphratica
ref|XP_003519750.1|  PREDICTED: probable beta-D-xylosidase 2-like       124   2e-29   Glycine max [soybeans]
ref|XP_011041424.1|  PREDICTED: probable beta-D-xylosidase 2            124   2e-29   Populus euphratica
ref|XP_002980053.1|  hypothetical protein SELMODRAFT_112087             124   2e-29   Selaginella moellendorffii
gb|AES97966.2|  glycoside hydrolase family 3 protein                    124   2e-29   Medicago truncatula
ref|XP_011011483.1|  PREDICTED: probable beta-D-xylosidase 7            124   2e-29   Populus euphratica
ref|XP_003615008.1|  Xylan 1 4-beta-xylosidase                          124   2e-29   
ref|XP_007035744.1|  Periplasmic beta-glucosidase, putative             124   2e-29   
gb|KJB38535.1|  hypothetical protein B456_006G259500                    124   2e-29   Gossypium raimondii
ref|XP_010914548.1|  PREDICTED: probable beta-D-xylosidase 2            124   2e-29   Elaeis guineensis
ref|XP_002306583.2|  hypothetical protein POPTR_0005s16660g             124   2e-29   Populus trichocarpa [western balsam poplar]
gb|KEH28065.1|  glycoside hydrolase family 3 amino-terminal domai...    123   2e-29   Medicago truncatula
ref|XP_011074159.1|  PREDICTED: probable beta-D-xylosidase 7            124   2e-29   Sesamum indicum [beniseed]
gb|KJB16241.1|  hypothetical protein B456_002G219100                    124   2e-29   Gossypium raimondii
ref|XP_002987446.1|  hypothetical protein SELMODRAFT_426206             124   2e-29   Selaginella moellendorffii
ref|XP_007225247.1|  hypothetical protein PRUPE_ppa001675mg             124   2e-29   Prunus persica
ref|NP_001266104.1|  SlArf/Xyl1 protein precursor                       124   3e-29   
ref|XP_002527511.1|  Beta-glucosidase, putative                         124   3e-29   Ricinus communis
gb|KJB59941.1|  hypothetical protein B456_009G282000                    122   3e-29   Gossypium raimondii
ref|XP_003592512.1|  Xylosidase                                         124   3e-29   Medicago truncatula
ref|XP_007145157.1|  hypothetical protein PHAVU_007G215100g             124   3e-29   Phaseolus vulgaris [French bean]
ref|XP_009757165.1|  PREDICTED: probable beta-D-xylosidase 2            124   3e-29   Nicotiana sylvestris
ref|XP_010676938.1|  PREDICTED: probable beta-D-xylosidase 7            124   3e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN08645.1|  Putative beta-D-xylosidase 2                            123   3e-29   Glycine soja [wild soybean]
ref|XP_011100796.1|  PREDICTED: beta-D-xylosidase 1                     124   3e-29   Sesamum indicum [beniseed]
ref|XP_003535953.1|  PREDICTED: probable beta-D-xylosidase 2            124   3e-29   Glycine max [soybeans]
ref|NP_001266114.1|  SlArf/Xyl4 protein precursor                       124   3e-29   Solanum lycopersicum
gb|KHG14371.1|  Beta-D-xylosidase 1 -like protein                       124   3e-29   Gossypium arboreum [tree cotton]
ref|XP_010457247.1|  PREDICTED: probable beta-D-xylosidase 2            124   3e-29   Camelina sativa [gold-of-pleasure]
emb|CDY00033.1|  BnaC09g02680D                                          123   4e-29   
gb|ACD93208.1|  beta xylosidase                                         123   4e-29   Camellia sinensis [black tea]
ref|XP_006301942.1|  hypothetical protein CARUB_v10022420mg             123   4e-29   Capsella rubella
gb|AFU54452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           123   4e-29   Prunus salicina [Japanese plum]
gb|AFU54451.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           123   4e-29   Prunus salicina [Japanese plum]
ref|XP_004513829.1|  PREDICTED: probable beta-D-xylosidase 7-like       123   5e-29   Cicer arietinum [garbanzo]
ref|XP_010259348.1|  PREDICTED: putative beta-D-xylosidase              123   5e-29   Nelumbo nucifera [Indian lotus]
gb|AES97964.2|  glycoside hydrolase family 3 amino-terminal domai...    123   5e-29   Medicago truncatula
ref|XP_009111875.1|  PREDICTED: beta-D-xylosidase 1-like                123   6e-29   Brassica rapa
gb|AAS17751.2|  beta xylosidase                                         123   6e-29   Fragaria x ananassa
emb|CDY15255.1|  BnaC05g01340D                                          123   6e-29   Brassica napus [oilseed rape]
ref|XP_006826952.1|  hypothetical protein AMTR_s00010p00188970          123   6e-29   Amborella trichopoda
gb|KHG13360.1|  putative beta-D-xylosidase 7 -like protein              123   6e-29   Gossypium arboreum [tree cotton]
ref|XP_002519194.1|  Periplasmic beta-glucosidase precursor, puta...    123   6e-29   Ricinus communis
gb|KCW68842.1|  hypothetical protein EUGRSUZ_F02442                     122   6e-29   Eucalyptus grandis [rose gum]
ref|XP_004295104.1|  PREDICTED: putative beta-D-xylosidase              123   6e-29   Fragaria vesca subsp. vesca
emb|CDP17081.1|  unnamed protein product                                122   6e-29   Coffea canephora [robusta coffee]
ref|XP_002885319.1|  beta-1,4-xylosidase                                123   6e-29   
gb|KJB59940.1|  hypothetical protein B456_009G282000                    123   6e-29   Gossypium raimondii
ref|XP_006354009.1|  PREDICTED: probable beta-D-xylosidase 7-like       123   6e-29   Solanum tuberosum [potatoes]
gb|KDO87029.1|  hypothetical protein CISIN_1g0041902mg                  114   7e-29   Citrus sinensis [apfelsine]
ref|XP_002320310.2|  hypothetical protein POPTR_0014s11730g             122   7e-29   
ref|XP_004300463.1|  PREDICTED: probable beta-D-xylosidase 2            122   7e-29   Fragaria vesca subsp. vesca
gb|KHN43468.1|  Putative beta-D-xylosidase 2                            123   8e-29   Glycine soja [wild soybean]
ref|XP_010064766.1|  PREDICTED: probable beta-D-xylosidase 7            122   8e-29   Eucalyptus grandis [rose gum]
ref|XP_009369955.1|  PREDICTED: putative beta-D-xylosidase              122   8e-29   
ref|XP_010113184.1|  putative beta-D-xylosidase 5                       118   8e-29   Morus notabilis
ref|XP_011082425.1|  PREDICTED: probable beta-D-xylosidase 2            122   9e-29   Sesamum indicum [beniseed]
gb|KJB72795.1|  hypothetical protein B456_011G198200                    122   9e-29   Gossypium raimondii
ref|XP_008386729.1|  PREDICTED: probable beta-D-xylosidase 2            122   9e-29   
gb|KFK42187.1|  hypothetical protein AALP_AA2G222800                    122   1e-28   Arabis alpina [alpine rockcress]
ref|XP_008223305.1|  PREDICTED: putative beta-D-xylosidase              122   1e-28   Prunus mume [ume]
ref|XP_008341125.1|  PREDICTED: putative beta-D-xylosidase              122   1e-28   
ref|XP_007225668.1|  hypothetical protein PRUPE_ppa001718mg             122   1e-28   Prunus persica
ref|XP_008390557.1|  PREDICTED: putative beta-D-xylosidase              122   1e-28   
ref|XP_009339788.1|  PREDICTED: probable beta-D-xylosidase 2            122   1e-28   Pyrus x bretschneideri [bai li]
emb|CDX89954.1|  BnaA10g01280D                                          122   1e-28   
ref|XP_007042636.1|  Glycosyl hydrolase family protein                  122   1e-28   
ref|XP_009593976.1|  PREDICTED: probable beta-D-xylosidase 2            122   1e-28   Nicotiana tomentosiformis
ref|XP_010269208.1|  PREDICTED: probable beta-D-xylosidase 7            122   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_009119616.1|  PREDICTED: probable beta-D-xylosidase 2            122   1e-28   Brassica rapa
ref|XP_011042236.1|  PREDICTED: probable beta-D-xylosidase 2            122   1e-28   Populus euphratica
ref|XP_008808663.1|  PREDICTED: beta-D-xylosidase 1-like                122   2e-28   Phoenix dactylifera
ref|XP_011020382.1|  PREDICTED: putative beta-D-xylosidase              122   2e-28   Populus euphratica
ref|XP_006352077.1|  PREDICTED: beta-D-xylosidase 1-like                121   2e-28   Solanum tuberosum [potatoes]
dbj|BAF00595.1|  xylosidase                                             117   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAF17692.1|AC009243_19  F28K19.27                                    121   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010534139.1|  PREDICTED: probable beta-D-xylosidase 7            114   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_010481135.1|  PREDICTED: probable beta-D-xylosidase 2            121   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002302285.1|  glycosyl hydrolase family 3 family protein         121   2e-28   
ref|XP_008384517.1|  PREDICTED: probable beta-D-xylosidase 5            121   2e-28   
ref|XP_002302758.2|  hypothetical protein POPTR_0002s19830g             121   2e-28   
gb|KHG05051.1|  putative beta-D-xylosidase 2 -like protein              121   3e-28   Gossypium arboreum [tree cotton]
ref|NP_177929.1|  putative beta-D-xylosidase 7                          121   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003594795.1|  Beta xylosidase                                    121   3e-28   Medicago truncatula
gb|KJB09457.1|  hypothetical protein B456_001G143600                    121   3e-28   Gossypium raimondii
ref|NP_001266107.1|  SlArf/Xyl2 protein precursor                       121   3e-28   Solanum lycopersicum
ref|XP_009348894.1|  PREDICTED: putative beta-D-xylosidase              121   3e-28   
ref|XP_008454299.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    121   3e-28   Cucumis melo [Oriental melon]
ref|XP_007136230.1|  hypothetical protein PHAVU_009G029300g             121   3e-28   Phaseolus vulgaris [French bean]
ref|XP_006830079.1|  hypothetical protein AMTR_s00125p00113140          121   3e-28   
ref|XP_003591420.1|  Beta xylosidase                                    120   3e-28   Medicago truncatula
ref|XP_002311398.2|  beta-D-xylosidase family protein                   120   3e-28   
emb|CAJ41429.1|  beta (1,4)-xylosidase                                  120   3e-28   Populus tremula x Populus alba [gray poplar]
dbj|BAB02547.1|  beta-1,4-xylosidase                                    121   4e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008454298.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    120   4e-28   Cucumis melo [Oriental melon]
ref|XP_006349198.1|  PREDICTED: probable beta-D-xylosidase 2-like       120   4e-28   Solanum tuberosum [potatoes]
ref|NP_188596.1|  putative beta-D-xylosidase 5                          120   4e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDY49607.1|  BnaA09g03310D                                          120   4e-28   Brassica napus [oilseed rape]
ref|XP_006300771.1|  hypothetical protein CARUB_v10019845mg             120   4e-28   Capsella rubella
ref|XP_003638778.1|  Xylan 1 4-beta-xylosidase                          120   4e-28   
ref|XP_006306829.1|  hypothetical protein CARUB_v10008371mg             120   4e-28   Capsella rubella
ref|XP_006287090.1|  hypothetical protein CARUB_v10000252mg             120   4e-28   
ref|XP_010094323.1|  Beta-D-xylosidase 1                                120   4e-28   Morus notabilis
ref|XP_009378701.1|  PREDICTED: probable beta-D-xylosidase 2            120   4e-28   Pyrus x bretschneideri [bai li]
ref|XP_009596711.1|  PREDICTED: probable beta-D-xylosidase 7            112   5e-28   Nicotiana tomentosiformis
ref|XP_010472005.1|  PREDICTED: probable beta-D-xylosidase 7            120   5e-28   Camelina sativa [gold-of-pleasure]
ref|XP_004301317.1|  PREDICTED: probable beta-D-xylosidase 7            120   5e-28   Fragaria vesca subsp. vesca
ref|XP_002264114.2|  PREDICTED: probable beta-D-xylosidase 5            120   5e-28   Vitis vinifera
emb|CDY33913.1|  BnaA02g30740D                                          120   5e-28   Brassica napus [oilseed rape]
ref|XP_007018823.1|  Glycosyl hydrolase family protein isoform 1        121   5e-28   
ref|XP_007018824.1|  Glycosyl hydrolase family protein isoform 2        121   5e-28   
ref|XP_007018825.1|  Glycosyl hydrolase family protein isoform 3        121   5e-28   
emb|CDY05634.1|  BnaC02g39030D                                          120   5e-28   
ref|XP_006418321.1|  hypothetical protein EUTSA_v10006876mg             120   5e-28   Eutrema salsugineum [saltwater cress]
ref|XP_002889410.1|  hypothetical protein ARALYDRAFT_470222             120   5e-28   
ref|XP_002270249.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    120   6e-28   
ref|NP_196618.1|  putative beta-D-xylosidase 6                          120   6e-28   
ref|XP_006390030.1|  hypothetical protein EUTSA_v10018160mg             120   6e-28   
ref|XP_009404942.1|  PREDICTED: probable beta-D-xylosidase 6            120   6e-28   
gb|KFK42620.1|  hypothetical protein AALP_AA1G019000                    120   6e-28   
gb|EYU23074.1|  hypothetical protein MIMGU_mgv1a019840mg                120   6e-28   
ref|XP_008362602.1|  PREDICTED: probable beta-D-xylosidase 7            117   6e-28   
gb|KDP27887.1|  hypothetical protein JCGZ_18967                         120   6e-28   
ref|XP_007163167.1|  hypothetical protein PHAVU_001G212100g             120   6e-28   
dbj|BAG28345.1|  arabinofuranosidase                                    120   6e-28   
emb|CBI22460.3|  unnamed protein product                                120   6e-28   
gb|KHN19223.1|  Putative beta-D-xylosidase 2                            119   6e-28   
ref|XP_006419427.1|  hypothetical protein CICLE_v10004369mg             120   6e-28   
gb|EYU33328.1|  hypothetical protein MIMGU_mgv1a001688mg                120   6e-28   
ref|XP_004151112.1|  PREDICTED: beta-D-xylosidase 1-like                120   6e-28   
emb|CBI22910.3|  unnamed protein product                                120   7e-28   
ref|XP_002276351.1|  PREDICTED: putative beta-D-xylosidase              120   7e-28   
emb|CAN82161.1|  hypothetical protein VITISV_035506                     120   7e-28   
gb|KFK26586.1|  hypothetical protein AALP_AA8G267600                    120   7e-28   
ref|XP_006488872.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    120   8e-28   
ref|XP_003544783.1|  PREDICTED: probable beta-D-xylosidase 7-like       119   8e-28   
gb|EPS70883.1|  hypothetical protein M569_03875                         119   9e-28   
ref|XP_009603126.1|  PREDICTED: probable beta-D-xylosidase 5            117   9e-28   
ref|XP_010416771.1|  PREDICTED: probable beta-D-xylosidase 7            119   1e-27   
gb|KDO87027.1|  hypothetical protein CISIN_1g0041902mg                  114   1e-27   
ref|XP_002873465.1|  glycosyl hydrolase family 3 protein                119   1e-27   
ref|XP_006858943.1|  hypothetical protein AMTR_s00068p00088730          119   1e-27   
ref|XP_003520749.2|  PREDICTED: probable beta-D-xylosidase 2-like       119   1e-27   
ref|XP_010687347.1|  PREDICTED: probable beta-D-xylosidase 5            119   1e-27   
ref|XP_004487789.1|  PREDICTED: beta-D-xylosidase 1-like                119   1e-27   
ref|XP_010428909.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    119   1e-27   
ref|XP_011016184.1|  PREDICTED: probable beta-D-xylosidase 7            119   1e-27   
ref|XP_009129779.1|  PREDICTED: beta-D-xylosidase 1-like                119   1e-27   
emb|CDY67410.1|  BnaCnng54810D                                          117   1e-27   
ref|XP_009383731.1|  PREDICTED: probable beta-D-xylosidase 2            119   1e-27   
ref|NP_563659.1|  probable beta-D-xylosidase 2                          119   1e-27   
ref|XP_006406478.1|  hypothetical protein EUTSA_v10022061mg             119   1e-27   
gb|KDO80914.1|  hypothetical protein CISIN_1g004054mg                   118   1e-27   
ref|XP_006399554.1|  hypothetical protein EUTSA_v10012725mg             119   1e-27   
ref|XP_004156823.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    119   1e-27   
ref|XP_010087253.1|  putative beta-D-xylosidase 2                       119   1e-27   
ref|XP_002316021.1|  beta-D-xylosidase family protein                   119   1e-27   
ref|XP_008235191.1|  PREDICTED: probable beta-D-xylosidase 2            119   1e-27   
ref|XP_010679361.1|  PREDICTED: probable beta-D-xylosidase 2            119   2e-27   
gb|AAG10624.1|AC022521_2  Similar to xylosidase                         119   2e-27   
ref|XP_006354008.1|  PREDICTED: probable beta-D-xylosidase 7-like       119   2e-27   
ref|XP_009779847.1|  PREDICTED: probable beta-D-xylosidase 5            116   2e-27   
ref|NP_199747.1|  bifunctional {beta}-D-xylosidase/{alpha}-L-arab...    119   2e-27   
gb|EYU23228.1|  hypothetical protein MIMGU_mgv1a018779mg                118   2e-27   
ref|XP_010482214.1|  PREDICTED: beta-D-xylosidase 1-like                119   2e-27   
ref|XP_003554544.1|  PREDICTED: probable beta-D-xylosidase 2-like       119   2e-27   
ref|XP_004500608.1|  PREDICTED: probable beta-D-xylosidase 7-like       119   2e-27   
ref|XP_010466113.1|  PREDICTED: probable beta-D-xylosidase 5            118   2e-27   
ref|XP_010268028.1|  PREDICTED: probable beta-D-xylosidase 2            118   2e-27   
emb|CDY58860.1|  BnaCnng33860D                                          118   2e-27   
ref|XP_006280043.1|  hypothetical protein CARUB_v10025920mg             118   2e-27   
ref|XP_010440503.1|  PREDICTED: beta-D-xylosidase 1                     118   2e-27   
ref|XP_004494414.1|  PREDICTED: probable beta-D-xylosidase 2-like       118   2e-27   
ref|XP_010111676.1|  putative beta-D-xylosidase 5                       118   2e-27   
ref|XP_003546334.1|  PREDICTED: beta-D-xylosidase 1-like                118   2e-27   
emb|CDP01028.1|  unnamed protein product                                118   3e-27   
ref|XP_006395069.1|  hypothetical protein EUTSA_v10003681mg             118   3e-27   
ref|XP_007047697.1|  Glycosyl hydrolase family protein                  118   3e-27   
ref|XP_004152230.1|  PREDICTED: probable beta-D-xylosidase 2-like       118   3e-27   
ref|XP_009369659.1|  PREDICTED: probable beta-D-xylosidase 7            118   3e-27   
gb|KJB29303.1|  hypothetical protein B456_005G093200                    118   3e-27   
gb|KJB29304.1|  hypothetical protein B456_005G093200                    118   3e-27   
gb|KDO80913.1|  hypothetical protein CISIN_1g004054mg                   118   3e-27   
gb|EYU23224.1|  hypothetical protein MIMGU_mgv1a001695mg                118   3e-27   
ref|XP_010546993.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1     118   3e-27   
ref|XP_006472631.1|  PREDICTED: probable beta-D-xylosidase 7-like       118   3e-27   
ref|XP_008458374.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    118   3e-27   
ref|XP_006298950.1|  hypothetical protein CARUB_v10015075mg             118   3e-27   
ref|XP_008375790.1|  PREDICTED: probable beta-D-xylosidase 7            118   3e-27   
gb|EYU23824.1|  hypothetical protein MIMGU_mgv1a020334mg                118   4e-27   
ref|XP_002865732.1|  beta-xylosidase 1                                  118   4e-27   
ref|XP_009145766.1|  PREDICTED: probable beta-D-xylosidase 5            118   4e-27   
ref|XP_006434020.1|  hypothetical protein CICLE_v10000352mg             118   4e-27   
ref|XP_007200259.1|  hypothetical protein PRUPE_ppa015037mg             118   4e-27   
ref|XP_006354074.1|  PREDICTED: probable beta-D-xylosidase 7-like       118   4e-27   
ref|XP_008236322.1|  PREDICTED: probable beta-D-xylosidase 5            118   4e-27   
ref|NP_001280797.1|  putative beta-D-xylosidase precursor               118   4e-27   
ref|XP_009151303.1|  PREDICTED: beta-D-xylosidase 1                     118   4e-27   
emb|CDX85405.1|  BnaC07g27160D                                          118   4e-27   
ref|XP_009782574.1|  PREDICTED: probable beta-D-xylosidase 7            117   4e-27   
ref|XP_011079568.1|  PREDICTED: probable beta-D-xylosidase 2            117   4e-27   
emb|CDO98788.1|  unnamed protein product                                117   4e-27   
ref|XP_008353169.1|  PREDICTED: putative beta-D-xylosidase              117   4e-27   
ref|NP_001266109.1|  SlArf/Xyl3 protein precursor                       117   4e-27   
ref|XP_003533205.2|  PREDICTED: beta-D-xylosidase 1-like                117   4e-27   
ref|XP_006448620.1|  hypothetical protein CICLE_v10018262mg             117   4e-27   
dbj|BAF79669.1|  beta-D-xylosidase                                      117   4e-27   
ref|XP_009592501.1|  PREDICTED: probable beta-D-xylosidase 7            117   5e-27   
ref|XP_002513892.1|  Periplasmic beta-glucosidase precursor, puta...    117   5e-27   
gb|AGR44452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase 2         117   5e-27   
dbj|BAD98523.1|  alpha-L-arabinofuranosidase / beta-D-xylosidase        117   5e-27   
gb|EYU23223.1|  hypothetical protein MIMGU_mgv1a001417mg                117   5e-27   
ref|XP_007018826.1|  Glycosyl hydrolase family protein                  117   5e-27   
gb|KCW58370.1|  hypothetical protein EUGRSUZ_H010552                    110   5e-27   
ref|XP_007138975.1|  hypothetical protein PHAVU_009G254300g             117   6e-27   
emb|CDX97026.1|  BnaC09g45990D                                          117   6e-27   
emb|CAN72807.1|  hypothetical protein VITISV_033721                     112   6e-27   
ref|XP_007200621.1|  hypothetical protein PRUPE_ppa001656mg             117   6e-27   
gb|KCW68841.1|  hypothetical protein EUGRSUZ_F02441                     116   6e-27   
gb|KFK25328.1|  hypothetical protein AALP_AA8G098500                    117   6e-27   
gb|AAP83934.1|  auxin-induced beta-glucosidase                          117   6e-27   
ref|XP_011009934.1|  PREDICTED: putative beta-D-xylosidase              117   6e-27   
gb|EPS60429.1|  hypothetical protein M569_14372                         117   7e-27   
dbj|BAQ19511.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase          117   7e-27   
gb|KJB44020.1|  hypothetical protein B456_007G230000                    117   7e-27   
gb|EYU23226.1|  hypothetical protein MIMGU_mgv1a025071mg                117   7e-27   
ref|XP_010453089.1|  PREDICTED: probable beta-D-xylosidase 6            117   7e-27   
ref|XP_002889174.1|  glycosyl hydrolase family 3 protein                117   7e-27   
ref|XP_007051080.1|  Beta-xylosidase 2                                  117   8e-27   
ref|XP_002987447.1|  hypothetical protein SELMODRAFT_426207             117   9e-27   
ref|XP_010671663.1|  PREDICTED: beta-D-xylosidase 1                     117   9e-27   
ref|XP_003534261.1|  PREDICTED: probable beta-D-xylosidase 6-like       117   1e-26   
ref|XP_011012436.1|  PREDICTED: probable beta-D-xylosidase 5            117   1e-26   
dbj|BAO45878.1|  beta-D-xylosidase                                      116   1e-26   
ref|XP_002980054.1|  hypothetical protein SELMODRAFT_419541             116   1e-26   
ref|XP_011030348.1|  PREDICTED: probable beta-D-xylosidase 5            116   1e-26   
ref|XP_004136155.1|  PREDICTED: probable beta-D-xylosidase 2-like       116   1e-26   
ref|XP_004162442.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    116   1e-26   
gb|KHN12900.1|  Beta-D-xylosidase 1                                     116   1e-26   
ref|XP_006369735.1|  glycosyl hydrolase family 3 family protein         116   1e-26   
ref|XP_003567059.2|  PREDICTED: beta-D-xylosidase 1-like                116   1e-26   
gb|EYU25657.1|  hypothetical protein MIMGU_mgv11b023706mg               109   2e-26   
ref|XP_003542472.1|  PREDICTED: probable beta-D-xylosidase 7-like       116   2e-26   
ref|XP_010507856.1|  PREDICTED: probable beta-D-xylosidase 5            116   2e-26   
gb|KDO78723.1|  hypothetical protein CISIN_1g003606mg                   115   2e-26   
ref|XP_006466365.1|  PREDICTED: probable beta-D-xylosidase 6-like       115   2e-26   
ref|XP_009106451.1|  PREDICTED: probable beta-D-xylosidase 7            115   2e-26   
gb|KDO78722.1|  hypothetical protein CISIN_1g003606mg                   115   2e-26   
gb|AHA84290.1|  beta-D-xylosidase                                       110   2e-26   
ref|XP_006426203.1|  hypothetical protein CICLE_v10024911mg             115   2e-26   
ref|XP_006581546.1|  PREDICTED: probable beta-D-xylosidase 7-like...    114   3e-26   
emb|CDX87482.1|  BnaA07g33910D                                          115   3e-26   
ref|XP_006354073.1|  PREDICTED: probable beta-D-xylosidase 7-like       115   3e-26   
ref|XP_006444470.1|  hypothetical protein CICLE_v10018959mg             115   3e-26   
ref|XP_010061816.1|  PREDICTED: probable beta-D-xylosidase 7            115   3e-26   
ref|XP_001775759.1|  predicted protein                                  115   3e-26   
ref|NP_001067710.2|  Os11g0291500                                       108   3e-26   
ref|XP_006448621.1|  hypothetical protein CICLE_v10014325mg             115   3e-26   
ref|XP_009400278.1|  PREDICTED: probable beta-D-xylosidase 6            115   3e-26   
ref|XP_011016128.1|  PREDICTED: probable beta-D-xylosidase 7            115   3e-26   
ref|NP_001145980.1|  putative O-Glycosyl hydrolase superfamily pr...    115   3e-26   
gb|KDP20226.1|  hypothetical protein JCGZ_09858                         115   4e-26   
ref|XP_008385726.1|  PREDICTED: probable beta-D-xylosidase 6            115   4e-26   
ref|XP_006605998.1|  PREDICTED: probable beta-D-xylosidase 5-like       115   4e-26   
ref|XP_003526589.1|  PREDICTED: probable beta-D-xylosidase 7-like...    115   4e-26   
emb|CDX88410.1|  BnaC06g38540D                                          115   4e-26   
gb|KCW61272.1|  hypothetical protein EUGRSUZ_H04033                     115   4e-26   
ref|XP_010491733.1|  PREDICTED: probable beta-D-xylosidase 6            115   4e-26   
gb|KDO49896.1|  hypothetical protein CISIN_1g003980mg                   115   4e-26   
ref|XP_008236660.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    115   4e-26   
ref|XP_006487370.1|  PREDICTED: probable beta-D-xylosidase 5-like       115   4e-26   
emb|CDP01027.1|  unnamed protein product                                115   4e-26   
gb|EYU33325.1|  hypothetical protein MIMGU_mgv1a001753mg                114   5e-26   
gb|KJB49844.1|  hypothetical protein B456_008G140600                    114   5e-26   
ref|XP_009599906.1|  PREDICTED: probable beta-D-xylosidase 7            114   5e-26   
ref|XP_010024778.1|  PREDICTED: putative beta-D-xylosidase              114   5e-26   
ref|NP_001068441.1|  Os11g0673200                                       114   5e-26   
ref|XP_011099456.1|  PREDICTED: probable beta-D-xylosidase 6            114   5e-26   
ref|XP_004238520.1|  PREDICTED: probable beta-D-xylosidase 7            114   5e-26   
ref|XP_008236665.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    114   6e-26   
ref|XP_006468650.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    114   6e-26   
ref|XP_010664313.1|  PREDICTED: probable beta-D-xylosidase 7            114   7e-26   
ref|XP_002302284.2|  glycosyl hydrolase family 3 family protein         114   7e-26   
ref|XP_006423474.1|  hypothetical protein CICLE_v10027856mg             114   7e-26   
ref|XP_010937520.1|  PREDICTED: uncharacterized protein LOC105056876    115   7e-26   
gb|ABA95273.1|  Beta-D-xylosidase, putative, expressed                  114   7e-26   
ref|XP_007206430.1|  hypothetical protein PRUPE_ppa001583mg             114   7e-26   
emb|CDX69822.1|  BnaA10g21710D                                          114   7e-26   
gb|KJB59094.1|  hypothetical protein B456_009G239100                    114   8e-26   
gb|KJB29307.1|  hypothetical protein B456_005G093300                    114   8e-26   
ref|XP_008808189.1|  PREDICTED: probable beta-D-xylosidase 7            114   9e-26   
ref|XP_010522822.1|  PREDICTED: probable beta-D-xylosidase 2            114   9e-26   
ref|XP_009782575.1|  PREDICTED: probable beta-D-xylosidase 7            114   9e-26   
gb|KDP20227.1|  hypothetical protein JCGZ_09859                         114   1e-25   
gb|EYU46800.1|  hypothetical protein MIMGU_mgv1a018473mg                114   1e-25   
ref|XP_008451490.1|  PREDICTED: probable beta-D-xylosidase 2            114   1e-25   
ref|XP_010556264.1|  PREDICTED: beta-D-xylosidase 1-like                114   1e-25   
gb|EAY81823.1|  hypothetical protein OsI_36995                          114   1e-25   
ref|XP_002513887.1|  hypothetical protein RCOM_1034150                  108   2e-25   
ref|XP_003612944.1|  Beta-D-xylosidase                                  112   2e-25   
ref|XP_004143540.1|  PREDICTED: probable beta-D-xylosidase 6-like       112   2e-25   
ref|XP_004160150.1|  PREDICTED: probable beta-D-xylosidase 6-like       112   2e-25   
gb|EYU44551.1|  hypothetical protein MIMGU_mgv1a001559mg                112   3e-25   
ref|XP_004979939.1|  PREDICTED: probable beta-D-xylosidase 2-like       112   3e-25   
gb|ABY48135.1|  beta-D-xylosidase                                       112   3e-25   
ref|XP_009122041.1|  PREDICTED: probable beta-D-xylosidase 6            112   3e-25   
gb|EAY87550.1|  hypothetical protein OsI_08961                          107   3e-25   
gb|KHG30322.1|  putative beta-D-xylosidase 7 -like protein              110   3e-25   
ref|XP_010683056.1|  PREDICTED: probable beta-D-xylosidase 6            112   4e-25   
gb|KHG02565.1|  putative beta-D-xylosidase 7                            112   4e-25   
gb|KDP45919.1|  hypothetical protein JCGZ_15479                         106   6e-25   
ref|XP_009612183.1|  PREDICTED: probable beta-D-xylosidase 6            111   6e-25   
ref|XP_007140931.1|  hypothetical protein PHAVU_008G153300g             111   6e-25   
emb|CBI25987.3|  unnamed protein product                                111   7e-25   
ref|XP_009390583.1|  PREDICTED: probable beta-D-xylosidase 7            111   7e-25   
ref|XP_002274591.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    111   7e-25   
ref|XP_010676949.1|  PREDICTED: probable beta-D-xylosidase 7            111   7e-25   
emb|CDP02677.1|  unnamed protein product                                111   8e-25   
ref|XP_010254644.1|  PREDICTED: probable beta-D-xylosidase 6            111   8e-25   
ref|XP_006840294.1|  hypothetical protein AMTR_s00045p00064060          111   9e-25   
gb|EAY80660.1|  hypothetical protein OsI_35838                          110   1e-24   
gb|EYU33329.1|  hypothetical protein MIMGU_mgv1a001598mg                111   1e-24   
ref|XP_010250379.1|  PREDICTED: probable beta-D-xylosidase 5            110   1e-24   
ref|XP_010693351.1|  PREDICTED: probable beta-D-xylosidase 7            110   1e-24   
gb|KHG02566.1|  putative beta-D-xylosidase 7                            110   1e-24   
ref|XP_007158321.1|  hypothetical protein PHAVU_002G142900g             110   1e-24   
ref|XP_006468195.1|  PREDICTED: probable beta-D-xylosidase 5-like       110   1e-24   
ref|XP_006449653.1|  hypothetical protein CICLE_v10017977mg             110   1e-24   
gb|KJB16243.1|  hypothetical protein B456_002G219200                    110   2e-24   
gb|KJB16242.1|  hypothetical protein B456_002G219200                    110   2e-24   
ref|XP_009782577.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    109   2e-24   
ref|XP_010069867.1|  PREDICTED: probable beta-D-xylosidase 2            110   2e-24   
ref|XP_002513891.1|  hypothetical protein RCOM_1034290                  107   2e-24   
ref|XP_002451244.1|  hypothetical protein SORBIDRAFT_05g026400          110   2e-24   
ref|XP_003383638.1|  PREDICTED: beta-D-xylosidase 1-like                110   2e-24   
gb|EYU39877.1|  hypothetical protein MIMGU_mgv1a018879mg                110   2e-24   



>ref|XP_009612011.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=778

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV +QT+PV+ACD   NPG+K+  FC+  LDV +RV DLVKRLTL EKIT LVNTAG+VS
Sbjct  31   PVLAQTSPVFACDVANNPGVKNFAFCDVSLDVSSRVNDLVKRLTLEEKITMLVNTAGSVS  90

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIPTYEWWSEALHG+SYTGPGV F GVVP ATSFPQP+LT+ASFNETLF   GK
Sbjct  91   RLGIPTYEWWSEALHGISYTGPGVKFNGVVPGATSFPQPILTSASFNETLFETIGK  146



>ref|XP_006351808.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=778

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV +QT+ V+ACDT  NP LKS PFC+  L V  RV DLVKRLTL EKIT LVNTAGNVS
Sbjct  34   PVSAQTSAVFACDTATNPSLKSFPFCDVSLGVSARVKDLVKRLTLQEKITMLVNTAGNVS  93

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIP YEWWSEALHG+SYTGPGV F  +VP ATSFPQP+LT+ASFNETLF   GK
Sbjct  94   RLGIPKYEWWSEALHGISYTGPGVKFNNIVPHATSFPQPILTSASFNETLFETIGK  149



>ref|XP_004230547.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Solanum 
lycopersicum]
Length=778

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV +QT+ V+ACDT  NP LKS PFC+  L V  RV DLVKRLTL EKI+ LVNTAG+VS
Sbjct  34   PVSAQTSAVFACDTANNPSLKSFPFCDVSLGVSDRVNDLVKRLTLQEKISMLVNTAGSVS  93

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIP YEWWSEALHG+SYTGPGV F  +VP ATSFPQP+LT+ASFNETLF   GK
Sbjct  94   RLGIPKYEWWSEALHGISYTGPGVKFNNIVPHATSFPQPILTSASFNETLFQTIGK  149



>ref|XP_009762535.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=779

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 95/117 (81%), Gaps = 1/117 (1%)
 Frame = +1

Query  139  PVQSQT-APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            PV +QT +P +ACD   NPG+K+  FC+  LDV  RV DLVKRLTL EKIT LVNTAG+V
Sbjct  31   PVLAQTTSPAFACDVANNPGVKNFGFCDVSLDVSARVNDLVKRLTLEEKITMLVNTAGSV  90

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            SRLGIP YEWWSEALHG+SYTGPGV F GVVP ATSFPQP+LT+ASFNETLF   GK
Sbjct  91   SRLGIPKYEWWSEALHGISYTGPGVKFNGVVPGATSFPQPILTSASFNETLFETIGK  147



>dbj|BAQ02862.1| alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosidase, partial 
[Nicotiana tabacum]
Length=368

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  139  PVQSQT-APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            PV +QT +P +ACD   NPG+K+  FC+  LDV  RV DLVKRLTL EKIT LVNTAG+V
Sbjct  31   PVLAQTTSPAFACDVANNPGVKNFGFCDVSLDVSARVNDLVKRLTLEEKITMLVNTAGSV  90

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            SRLGIP YEWWSEALHG+SYTGPGV F GVVP ATSFP  +LT+ASFNETLF   GK
Sbjct  91   SRLGIPKYEWWSEALHGISYTGPGVKFNGVVPGATSFPPTILTSASFNETLFETIGK  147



>gb|KDO56532.1| hypothetical protein CISIN_1g0476211mg, partial [Citrus sinensis]
Length=250

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGK  144



>ref|XP_011092407.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV +QT P +ACD   NPGLK+  FC+Q LDVK+RVADLV RLTL EKI +LVNTA  VS
Sbjct  24   PVFAQTKPAFACDVSNNPGLKNFSFCDQSLDVKSRVADLVGRLTLQEKIGWLVNTAKGVS  83

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIP Y+WWSEALHG+SY GPG  F+G+VP ATSFPQ +LTAA+FNE+LF   GK
Sbjct  84   RLGIPDYQWWSEALHGVSYVGPGTKFSGLVPGATSFPQVILTAATFNESLFEIIGK  139



>ref|XP_009628814.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=781

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV +Q +PV+ACD   NPGL +L FC+  L V+TRV DLV+RLTL EKI FLV+ AG VS
Sbjct  37   PVLAQNSPVFACDITSNPGLANLTFCDASLTVETRVNDLVQRLTLSEKIGFLVSGAGGVS  96

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIP YEWWSEALHG+SYTGPGV+F+G++PAATSFPQ +LTAASFN TLF   GK
Sbjct  97   RLGIPRYEWWSEALHGVSYTGPGVHFSGLIPAATSFPQVILTAASFNVTLFETIGK  152



>ref|XP_009801214.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=784

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV +Q +PV+ACD   NPGL +L FC+  L V+TRV+DLV+RLTL EKI FLV+ AG VS
Sbjct  40   PVLAQNSPVFACDITSNPGLANLTFCDASLTVETRVSDLVQRLTLSEKIGFLVSGAGGVS  99

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIP YEWWSEALHG+SYTGPGV+F+G+VP ATSFPQ +LTAASFN TLF   GK
Sbjct  100  RLGIPRYEWWSEALHGVSYTGPGVHFSGLVPGATSFPQVILTAASFNVTLFETIGK  155



>emb|CAN77623.1| hypothetical protein VITISV_007589 [Vitis vinifera]
Length=167

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EK+ FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKVGFLVNSAASVSR  90

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGK  145



>emb|CAJ65922.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=757

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLVKRLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVKRLTLQEKILFLVNSAGSVSR  92

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGK  147



>ref|XP_002298197.2| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE83002.2| beta-glucosidase family protein [Populus trichocarpa]
Length=778

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLVKRLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVKRLTLQEKILFLVNSAGSVSR  92

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGK  147



>emb|CAJ65921.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=704

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD V NP L SL FCN  + +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  31   VSAQSSPVFACDVVSNPSLASLGFCNTSIGINDRVVDLVKRLTLQEKIVFLVNSAGNVSR  90

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF   GK
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFSDDVAGATSFPQVILTAASFNTSLFEAIGK  145



>ref|XP_011015574.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVGRLTLQEKILFLVNSAGSVSR  92

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  93   LGIPRYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGK  147



>ref|XP_011046123.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVGRLTLQEKILFLVNSAGSVSR  92

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  93   LGIPRYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGK  147



>ref|XP_002303181.1| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE78160.1| beta-glucosidase family protein [Populus trichocarpa]
Length=773

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD V NP L SL FCN  + +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  30   VSAQSSPVFACDVVSNPSLASLGFCNTSIGINDRVVDLVKRLTLQEKIVFLVNSAGNVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF   GK
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTHFSDDVAGATSFPQVILTAASFNTSLFEAIGK  144



>ref|XP_006493288.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Citrus sinensis]
Length=773

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGK  144



>ref|XP_006432467.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
 gb|ESR45707.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
Length=773

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGK  144



>ref|XP_011004967.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Populus euphratica]
Length=775

 Score =   164 bits (416),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD V+NP L SL FCN    +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  32   VSAQSSPVFACDVVRNPSLASLGFCNTSSGINDRVVDLVKRLTLQEKILFLVNSAGNVSR  91

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF   GK
Sbjct  92   LGIPKYEWWSEALHGVSYVGPGTHFSNDVAGATSFPQVILTAASFNTSLFEAIGK  146



>ref|XP_010546362.1| PREDICTED: beta-D-xylosidase 4 [Tarenaya hassleriana]
Length=781

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P ++Q++PV+ACD   NP L    FC++ L+V  RVADLV RLTL EKI FLVN A  VS
Sbjct  23   PSEAQSSPVFACDVSGNPSLAGFGFCDKSLEVNDRVADLVGRLTLQEKIGFLVNRANGVS  82

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN TLF   GK
Sbjct  83   RLGIPTYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVTLFQTIGK  138



>ref|XP_008344154.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  Q++PV+ACD   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACDVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF   G+
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTXFSSLVPGATSFPQVILTAASFNTSLFEAIGR  144



>gb|EPS65933.1| hypothetical protein M569_08842, partial [Genlisea aurea]
Length=763

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P++ACD   +P LK+L FC+  LDVKTRV DLV RLTLPEK+ +L N+A  VSRLGIP Y
Sbjct  20   PIFACDVSADPALKTLAFCDSSLDVKTRVDDLVNRLTLPEKLGWLANSAKGVSRLGIPDY  79

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSE LHG+SYTGPGV FT +VP ATSFPQ +LT+ASFNE+LF   GK
Sbjct  80   EWWSEVLHGVSYTGPGVRFTSLVPGATSFPQVILTSASFNESLFRAIGK  128



>ref|XP_002513707.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF48654.1| Beta-glucosidase, putative [Ricinus communis]
Length=777

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD   NP L S  FCN  L +  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVKSNPSLASFGFCNVSLGISDRVTDLVNRLTLQEKIGFLVNSAGSVSR  92

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN +LF   GK
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSNIVPGATSFPQVILTAASFNASLFEAIGK  147



>ref|XP_010243340.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=771

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            S  +PV+ACD  KNPGL +  FCN  LD+  RV DLV+RLTL EKITFLV+ AG V+RLG
Sbjct  30   SGQSPVFACDVGKNPGLAAFGFCNTSLDIAARVNDLVERLTLQEKITFLVSKAGAVNRLG  89

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            IP+YEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF   GK
Sbjct  90   IPSYEWWSEALHGVSYVGPGTHFSSAVPGATSFPQVILTAASFNTSLFEDIGK  142



>gb|KDP30704.1| hypothetical protein JCGZ_16402 [Jatropha curcas]
Length=770

 Score =   162 bits (409),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q +PV+ACD  KNP + S  FCN  L +  RV DLV+RLTL EKI+FLVN+AG+VSR
Sbjct  27   VVAQPSPVFACDVSKNPSVASFGFCNVSLGINERVVDLVERLTLQEKISFLVNSAGSVSR  86

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN +LF   GK
Sbjct  87   LGIPKYEWWSEALHGVSYVGPGTHFSSLVPGATSFPQVILTAASFNTSLFEAIGK  141



>ref|XP_008339210.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF   G+
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGR  144



>ref|XP_009354080.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF   G+
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFQAIGR  144



>ref|XP_009347830.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF   G+
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGR  144



>emb|CBI40687.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGK  145



>ref|XP_002264183.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Vitis vinifera]
Length=774

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGK  145



>ref|XP_009379698.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Pyrus x bretschneideri]
Length=773

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  Q++PV+ACD   N  L S  FC+  L V  RV DLVKRLTLPEKI FLVN AG+VSR
Sbjct  30   VLGQSSPVFACDVASNATLSSFAFCDTSLGVDARVVDLVKRLTLPEKIGFLVNNAGSVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF   G+
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGR  144



>ref|NP_001233910.1| beta-D-xylosidase 1 precursor [Solanum lycopersicum]
 dbj|BAC98298.1| LEXYL1 [Solanum lycopersicum]
Length=770

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            ++  V +Q +PV+ACD   NP L +L FC+  L V+ RV DLV RLTL EKI FLV+ AG
Sbjct  23   LLKQVLAQNSPVFACDVTSNPALGNLTFCDASLAVENRVNDLVNRLTLGEKIGFLVSGAG  82

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             VSRLGIP YEWWSEALHG++YTGPGV+FT +VP ATSFPQ +LTAASFN TLF   GK
Sbjct  83   GVSRLGIPKYEWWSEALHGVAYTGPGVHFTSLVPGATSFPQVILTAASFNVTLFQTIGK  141



>ref|XP_002268626.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Vitis 
vinifera]
 emb|CBI39114.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLGQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG +F  +VP ATSFPQ +LTAASFN +LF   GK
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSIVPGATSFPQVILTAASFNASLFEAIGK  145



>ref|XP_006341844.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=806

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV +Q +PV+ACD   NP L +L FC+  L V+ RV DLVKRLTL EKI FLV+ A  VS
Sbjct  62   PVLAQNSPVFACDITSNPALGNLTFCDASLTVENRVNDLVKRLTLGEKIGFLVSGASGVS  121

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIP YEWWSEALHG++YTGPGV+F+ +VP ATSFPQ +LTAASFN +LF   GK
Sbjct  122  RLGIPKYEWWSEALHGVAYTGPGVHFSSLVPGATSFPQVILTAASFNVSLFQTIGK  177



>emb|CDY18705.1| BnaA09g06900D [Brassica napus]
Length=776

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  33   NAQTKPVFACDVDTNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF   GK
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGK  146



>ref|XP_009112141.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=776

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  33   NAQTKPVFACDVDTNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF   GK
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGK  146



>ref|XP_010520456.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 4 [Tarenaya 
hassleriana]
Length=750

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            ++ P  +Q+ PV+ACD   NP L    FCN  L ++ RVADLV RLTLPEKI FLV+ A 
Sbjct  20   VLPPSNAQSTPVFACDVAGNPSLAGFGFCNTSLGIEARVADLVGRLTLPEKIGFLVSGAK  79

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             VSRLGIP YEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  80   AVSRLGIPAYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGK  138



>ref|XP_007148433.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
 gb|ESW20427.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
Length=775

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT+ V+ACD  KNP L    FC++ L V+ RVADLVKRLTL EKI  LVN+A NVSR
Sbjct  32   VSGQTSAVFACDVAKNPALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGNLVNSAVNVSR  91

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+S  GPG +F+ VVP ATSFP P+LTAASFN +LF   G+
Sbjct  92   LGIPKYEWWSEALHGVSNIGPGTHFSSVVPGATSFPMPILTAASFNSSLFEAIGR  146



>ref|XP_010065531.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63059.1| hypothetical protein EUGRSUZ_G00651 [Eucalyptus grandis]
Length=789

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  VQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            V  QT+ PV+ACD   +P L    FCN  L V+ RVADLV+RLTL EK+ FLVN AGNV 
Sbjct  32   VAGQTSKPVFACDVDSDPSLAGFGFCNASLGVEVRVADLVQRLTLQEKVGFLVNNAGNVD  91

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF   GK
Sbjct  92   RLGIPKYEWWSEALHGVSYLGPGTKFSSLVPGATSFPQVILTAASFNATLFETIGK  147



>gb|EYU35409.1| hypothetical protein MIMGU_mgv1a001738mg [Erythranthe guttata]
Length=767

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +1

Query  133  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
             GPV SQ  PV+ACD   NPGLK+  FC+  LDVK RV DLV RLTL EKI +LV+ A  
Sbjct  20   FGPVCSQAQPVFACDVSSNPGLKNFSFCDPSLDVKARVDDLVARLTLQEKIGWLVHAAKG  79

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            VSRLGIP+Y WWSEALHG+S  G G  FTG VPAATSFPQ +LT A+FNE+LF   GK
Sbjct  80   VSRLGIPSYGWWSEALHGVSDVGGGSRFTGPVPAATSFPQVILTGATFNESLFQAIGK  137



>ref|XP_010103839.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
 gb|EXB97280.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
Length=778

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = +1

Query  136  GPVQSQ-TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
            G V+ Q T+P +ACD   NP L    FCN  L +++RV DLVKRLTL EKI FLVN+AG 
Sbjct  30   GGVRGQSTSPPFACDVGANPSLAGFGFCNASLGIESRVGDLVKRLTLQEKIGFLVNSAGA  89

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            VSRLGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  90   VSRLGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQVILTAASFNASLFEVIGK  147



>sp|A5JTQ3.1|XYL2_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 2; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
2; Short=MsXyl2; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor 
[Medicago sativa subsp. x varia]
 gb|ABQ45228.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G V SQT+ V+ACD  KNP L +  FCN++L V  RV DLV+RLTL EK+  LVN+A +V
Sbjct  29   GRVSSQTSAVFACDVAKNPALANYGFCNKKLSVDARVKDLVRRLTLQEKVGNLVNSAVDV  88

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            SRLGIP YEWWSEALHG+S  GPG +F+ V+P ATSFP P+L AASFN +LF   GK
Sbjct  89   SRLGIPKYEWWSEALHGVSNIGPGTHFSNVIPGATSFPMPILIAASFNASLFQTIGK  145



>ref|XP_007043027.1| Beta-D-xylosidase 4 [Theobroma cacao]
 gb|EOX98858.1| Beta-D-xylosidase 4 [Theobroma cacao]
Length=787

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT+PV+ACD  KNP + S  FCN  L +++RVADLV+RLTL EKI F+V+ AG+VSR
Sbjct  44   VFGQTSPVFACDATKNPEVTSYDFCNASLGIESRVADLVQRLTLQEKILFIVSGAGSVSR  103

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+S  GPG  F+ +VP ATSFPQ +LTAASFN TLF   G+
Sbjct  104  LGIPKYEWWSEALHGVSNVGPGTKFSSLVPGATSFPQVILTAASFNTTLFEAIGR  158



>gb|KFK28148.1| hypothetical protein AALP_AA8G478800 [Arabis alpina]
Length=779

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +QT+PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLG
Sbjct  33   AQTSPVFACDVTGNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLG  92

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  93   IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGK  145



>ref|XP_010261102.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=773

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  336
            +PV+ACD  KN GL +  FCN    +  RV DLVKRLTL EKI FLVN AG V+RLGIP+
Sbjct  35   SPVFACDVGKNSGLAAFGFCNSSWGIAARVDDLVKRLTLQEKIIFLVNKAGAVTRLGIPS  94

Query  337  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  95   YEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFQAIGK  144



>emb|CDY46812.1| BnaC02g43200D [Brassica napus]
Length=778

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+ PV+ACD   N  L S  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  33   AQSTPVFACDVAGNSSLSSYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKASGVTRLG  92

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  93   IPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGK  145



>gb|KEH31243.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=774

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G V SQT+ V+ACD  KNP L +  FCN++L V  RV DLV+RLTL EK+  LVN+A +V
Sbjct  29   GRVSSQTSAVFACDVAKNPALANYGFCNKKLSVDARVKDLVRRLTLQEKVGNLVNSAVDV  88

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            SRLGIP YEWWSEALHG+S  GPG +F+ V+P +TSFP P+L AASFN +LF   GK
Sbjct  89   SRLGIPKYEWWSEALHGVSNIGPGTHFSNVIPGSTSFPMPILIAASFNASLFQTIGK  145



>emb|CDX81229.1| BnaC09g06400D [Brassica napus]
Length=776

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q+ P +ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  33   NAQSKPAFACDVDTNPSLAAYGFCNTDLKMEYRVADLVARLTLQEKIGFLVNKANGVTRL  92

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF   GK
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGK  146



>ref|XP_006280038.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
 gb|EOA12936.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
Length=784

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RL
Sbjct  37   NAQSSPVFACDVAANPSLAAFGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGK  150



>gb|KHG10349.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=779

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +QT+PV+ACD  K+P + S  FC+ +L    RVADLV RLTL EKI F+VN+AG+VSR
Sbjct  36   VLAQTSPVFACDATKDPKVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSR  95

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+S  GPG  FT +VP ATSFPQ +LTAASFN +L+   GK
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILTAASFNTSLYEAIGK  150



>ref|XP_004504774.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cicer arietinum]
Length=774

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G V SQT+PV+ACD  KNP L +  FCN+ L V  RV+DLV RLTL EKI  LVN+A +V
Sbjct  29   GRVWSQTSPVFACDVGKNPALSNYRFCNKSLGVNARVSDLVSRLTLQEKIGNLVNSAVDV  88

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            SRLGIP YEWWSEALHG+S  GPG  F+ VVP +TSFP P+L AASFN +LF   GK
Sbjct  89   SRLGIPRYEWWSEALHGVSNVGPGTRFSNVVPGSTSFPMPILIAASFNASLFQTIGK  145



>gb|KJB31995.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=779

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +QT+PV+ACD  K+P + S  FC+ +L    RVADLV RLTL EKI F+VN+AG+VSR
Sbjct  36   VLAQTSPVFACDATKDPQVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSR  95

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+S  GPG  FT +VP ATSFPQ +LTAASFN +L+   GK
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILTAASFNTSLYEAIGK  150



>ref|XP_010065527.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63057.1| hypothetical protein EUGRSUZ_G00649 [Eucalyptus grandis]
Length=790

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD   NP L +  FCN  L V+ RVADLV+RLTL EK+ FLV+ AGNV RLGIP Y
Sbjct  40   PVFACDVDGNPSLAAFGFCNTSLGVEARVADLVQRLTLQEKVGFLVSGAGNVDRLGIPKY  99

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF   GK
Sbjct  100  EWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNATLFETIGK  148



>ref|XP_006394136.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
 gb|ESQ31422.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
Length=780

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q++PV+ACD   NP L +  FCN  L  + RVADLV RLTL EKI FLV+ A  VSRL
Sbjct  33   NAQSSPVFACDVAGNPSLAAYGFCNTALKSEYRVADLVARLTLQEKIGFLVSKANGVSRL  92

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  93   GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGK  146



>gb|KCW63061.1| hypothetical protein EUGRSUZ_G006532, partial [Eucalyptus grandis]
Length=147

 Score =   145 bits (367),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD   +P L    FCN  L V+ RV DLV+RLTL EK+ FLVN A NV RLGIP Y
Sbjct  39   PVFACDVDSDPSLAGFGFCNTSLGVEARVVDLVQRLTLQEKVGFLVNNASNVDRLGIPKY  98

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             WWSEALHG+S  GPG  F  +VP ATSFPQ +LTAASFN TLF   GK
Sbjct  99   SWWSEALHGVSDVGPGTTFASLVPGATSFPQVILTAASFNATLFETIGK  147



>ref|XP_010444394.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  32   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  91

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            TYEWWSEALHG+SY GPG +FTG VP ATSFPQ +LTAASFN +LF   GK
Sbjct  92   TYEWWSEALHGVSYIGPGTHFTGQVPGATSFPQVILTAASFNVSLFQAIGK  142



>ref|XP_003547598.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT+ V+ACD  KNP L    FC++ L V+ RVADLVKRLTL EKI  LVN+A +VSR
Sbjct  33   VSGQTSAVFACDVAKNPALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGSLVNSATSVSR  92

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF   G+
Sbjct  93   LGIPKYEWWSEALHGVSNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGR  147



>ref|XP_007225245.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
 gb|EMJ26444.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
Length=779

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q++PV+ACD   N  + S  FC+  L +  RVADLVKRLTL EKI FLVN+AG+VSRLG
Sbjct  38   AQSSPVFACDVGSNASVSSFGFCDTSLAIDLRVADLVKRLTLQEKIGFLVNSAGSVSRLG  97

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            IP YEWWSEALHG+S  GPG  FT VVP ATSFPQ +LTAASFN +LF   G+
Sbjct  98   IPKYEWWSEALHGVSNVGPGTKFTNVVPGATSFPQVILTAASFNASLFEAIGR  150



>ref|XP_003531557.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT+ V+ACD  KNP L    FC++ L ++ RVADLVKRLTL EKI  LVN+A +VSR
Sbjct  33   VSGQTSSVFACDVAKNPALAGYGFCDKSLSLEDRVADLVKRLTLQEKIGSLVNSATSVSR  92

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF   G+
Sbjct  93   LGIPKYEWWSEALHGVSNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGR  147



>ref|NP_201262.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
 sp|Q9FLG1.1|BXL4_ARATH RecName: Full=Beta-D-xylosidase 4; Short=AtBXL4; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11424.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AED97922.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
Length=784

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RL
Sbjct  37   NAQSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIPTYEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF   GK
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTHFSSQVPGATSFPQVILTAASFNVSLFQAIGK  150



>ref|XP_010461983.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  32   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  91

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            TYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  92   TYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGK  142



>ref|XP_002866623.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42882.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RL
Sbjct  37   NAQSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRL  96

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIPTYEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF   GK
Sbjct  97   GIPTYEWWSEALHGVSYIGPGTHFSSQVPGATSFPQVILTAASFNVSLFQAIGK  150



>emb|CDY31313.1| BnaA02g34280D [Brassica napus]
Length=778

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q+ P +ACD   N  L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  32   NAQSTPAFACDVAGNSSLSAYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKANGVTRL  91

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  92   GIPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGK  145



>ref|XP_010484241.1| PREDICTED: beta-D-xylosidase 4 [Camelina sativa]
Length=785

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGIP
Sbjct  41   SSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGIP  100

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            TYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  101  TYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGK  151



>ref|XP_009130462.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=778

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q+ P +ACD   N  L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  32   NAQSTPAFACDVAGNSSLSAYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKANGVTRL  91

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  92   GIPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGK  145



>ref|XP_009401393.1| PREDICTED: beta-D-xylosidase 4-like [Musa acuminata subsp. malaccensis]
Length=770

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT PV+ACD   NP L S  FCN     + RVADLVKRLTL EK+ FLVN A  VSR
Sbjct  28   VAGQT-PVFACDVASNPSLGSYGFCNTSYGTEQRVADLVKRLTLQEKVGFLVNKATAVSR  86

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP+YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN TLF   GK
Sbjct  87   LGIPSYEWWSEALHGVSYVGPGTHFSTLVPGATSFPQVILTAASFNTTLFQAIGK  141



>ref|XP_010065529.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63058.1| hypothetical protein EUGRSUZ_G00650 [Eucalyptus grandis]
Length=789

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD   +P L    FCN  L V+ RVADLV+RLTL EK+ FLVN AGNV RLGIP Y
Sbjct  39   PVFACDVGSDPSLAGFGFCNTSLGVEARVADLVQRLTLQEKVGFLVNNAGNVDRLGIPNY  98

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            +WWSEALHG+SY G G +F+ +VP ATSFPQ +LTAASFN TLF   GK
Sbjct  99   KWWSEALHGVSYVGGGTSFSSLVPGATSFPQVILTAASFNATLFETIGK  147



>ref|XP_011087838.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            PV ++  PV+ACD   NPGL +  FC+  LD+KTR+ DLV RLTL EK  +LV+ A  VS
Sbjct  24   PVFAERKPVFACDVTSNPGLMNFSFCDPSLDLKTRMDDLVSRLTLQEKFGWLVSGARGVS  83

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIP YEWWSEALHG+SYTGPG  F   VP ATSFPQ +LTA +FNE+LF   GK
Sbjct  84   RLGIPNYEWWSEALHGVSYTGPGTKFASPVPGATSFPQVILTAGTFNESLFELIGK  139



>ref|XP_008784548.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2-like [Phoenix dactylifera]
Length=773

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +QT P++ACDT  N  L S  FCN    ++ RV DLVKRLTL EK+ FLVN A  VSR
Sbjct  31   VLAQT-PIFACDTASNASLASFGFCNTSWGIEARVGDLVKRLTLEEKVGFLVNKAAAVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP+YEWWSEALHG+S+ GPG +F+ +VP ATSFPQ +LTAASFN TLF   GK
Sbjct  90   LGIPSYEWWSEALHGVSFVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGK  144



>ref|XP_008218886.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Prunus 
mume]
Length=779

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +Q++PV+AC+   N    S  FC+  L +  RVADLV+RLTL EKI FLVN+AG+VSR
Sbjct  36   VFAQSSPVFACNVASNASASSFGFCDTSLAIDLRVADLVQRLTLQEKIGFLVNSAGSVSR  95

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+S  GPG  FT VVP ATSFPQ +LTAASFN +LF   G+
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTNVVPGATSFPQVILTAASFNASLFEAIGR  150



>ref|XP_007159080.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
 gb|ESW31074.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
Length=773

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G V  QT+ ++ACD  KNP L    FC++ L V+ RVADLV RLTL EKI  LVN A +V
Sbjct  28   GGVWGQTSAIFACDVEKNPALGGYAFCDKSLGVEERVADLVGRLTLQEKIGNLVNAAVDV  87

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            SRLGIP YEWWSEALHG+S  GPG  F+ VVP ATSFP P+LTAASFN +LF   G+
Sbjct  88   SRLGIPKYEWWSEALHGVSNVGPGTRFSNVVPGATSFPMPILTAASFNTSLFETIGR  144



>ref|XP_011465594.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=799

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 85/115 (74%), Gaps = 2/115 (2%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V S +   +AC    N    S PFC++ L    RVADLV+RLTL EKITFLVN+AG+VSR
Sbjct  58   VSSVSGQSFACGESGNA--SSFPFCDKSLAADARVADLVQRLTLQEKITFLVNSAGSVSR  115

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQP+LTAASFN +LF   G+
Sbjct  116  LGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQPILTAASFNNSLFEAIGR  170



>ref|XP_004300692.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=799

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 85/115 (74%), Gaps = 2/115 (2%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V S +   +AC    N    S PFC++ L    RVADLV+RLTL EKITFLVN+AG+VSR
Sbjct  58   VSSVSGQSFACGESGNA--SSFPFCDKSLAADARVADLVQRLTLQEKITFLVNSAGSVSR  115

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQP+LTAASFN +LF   G+
Sbjct  116  LGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQPILTAASFNNSLFEAIGR  170



>ref|XP_011087839.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            GPV +Q  PV+ACD   NPGLK+  FC+  L +KTRV DLV RLTL EKI +LV+ +  V
Sbjct  23   GPVFAQQKPVFACDVTDNPGLKNFRFCDLSLGLKTRVDDLVSRLTLQEKIGWLVSGSEGV  82

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLF  471
            SRLGIP Y+WWSEALHG+SY GPG  F+  +PAAT FPQ +LTA++FN++LF
Sbjct  83   SRLGIPDYQWWSEALHGVSYGGPGTKFSSPIPAATIFPQVILTASTFNDSLF  134



>ref|XP_004136861.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
 gb|KGN43688.1| hypothetical protein Csa_7G058620 [Cucumis sativus]
Length=782

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  41   AQSPTAFACDAETNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  100

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  101  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGK  153



>gb|KFK25272.1| hypothetical protein AALP_AA8G090500 [Arabis alpina]
Length=772

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P+ ++++PV+ACD  K+       FCN  LDV++RV+DLV RLTL EKI FLV+ A  VS
Sbjct  27   PLNAKSSPVFACDVDKDISFSGFRFCNTELDVQSRVSDLVGRLTLEEKIGFLVSRAKGVS  86

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIP Y WWSEALHG+S  GPG  F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  87   RLGIPDYNWWSEALHGVSNVGPGSYFSGQVPGATSFPQVILTAASFNVSLFQAIGK  142



>ref|XP_008455235.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cucumis melo]
Length=791

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  50   AQSPTAFACDAGTNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  109

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  110  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGK  162



>ref|XP_004155509.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
Length=809

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  68   AQSPTAFACDAETNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  127

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF   GK
Sbjct  128  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGK  180



>ref|XP_010937054.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Elaeis guineensis]
Length=772

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V +QT P++ACD   NP L +  FCN       RV DLV+RLTL EK+ FLVN A  VSR
Sbjct  30   VLAQT-PIFACDIASNPSLANFGFCNTSWGTAARVDDLVERLTLDEKVGFLVNKATAVSR  88

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP+YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN TLF   GK
Sbjct  89   LGIPSYEWWSEALHGVSYVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGK  143



>emb|CDY51290.1| BnaA06g23560D [Brassica napus]
Length=780

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RL
Sbjct  32   NAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRL  91

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  92   GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGK  145



>ref|XP_009150540.1| PREDICTED: beta-D-xylosidase 4 [Brassica rapa]
Length=791

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RL
Sbjct  43   NAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRL  102

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  103  GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGK  156



>emb|CDY56487.1| BnaCnng30450D [Brassica napus]
Length=791

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RL
Sbjct  43   NAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRL  102

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  103  GIPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGK  156



>dbj|BAE44362.1| alpha-L-arabinofuranosidase [Raphanus sativus]
Length=780

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RL
Sbjct  32   NAQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVARL  91

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  92   GIPTYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGK  145



>ref|NP_196535.1| beta-xylosidase 3 [Arabidopsis thaliana]
 sp|Q9LXD6.1|BXL3_ARATH RecName: Full=Beta-D-xylosidase 3; Short=AtBXL3; AltName: Full=Alpha-L-arabinofuranosidase; 
Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB89357.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09531.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AAK96639.1| AT5g09730/F17I14_80 [Arabidopsis thaliana]
 gb|AED91439.1| beta-xylosidase 3 [Arabidopsis thaliana]
Length=773

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  27   NNQSSPVFACDVTGNPSLAGLRFCNAGLSIKARVTDLVGRLTLEEKIGFLTSKAIGVSRL  86

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIP+Y+WWSEALHG+S  G G  FTG VP ATSFPQ +LTAASFN +LF   GK
Sbjct  87   GIPSYKWWSEALHGVSNVGGGSRFTGQVPGATSFPQVILTAASFNVSLFQAIGK  140



>emb|CDY52884.1| BnaC06g27770D, partial [Brassica napus]
Length=318

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKATGVSRLGIP  95

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             Y WWSEALHG+S  G G +FTG+VP ATSFPQ +LTAASFN +LF   GK
Sbjct  96   DYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVILTAASFNVSLFQAIGK  146



>ref|XP_006827121.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
 gb|ERM94358.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
Length=769

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  336
            +PV+ACDT K+P + S  FCN  L +  RV DLV+RLTL EKI FLVN    VSRLGIP 
Sbjct  29   SPVFACDTSKDPSVGSYGFCNGSLGLSERVQDLVQRLTLSEKIGFLVNKGVGVSRLGIPA  88

Query  337  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            YEWWSEALHG+SY GPG +F+G+VP ATSFPQ + + ASFN +L+   GK
Sbjct  89   YEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVIHSVASFNSSLWEAIGK  138



>ref|XP_010065530.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=789

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD   +P L    FCN  L V+ RV DLV+RLTL EK+ FLVN A NV RLGIP Y
Sbjct  39   PVFACDVDSDPSLAGFGFCNTSLGVEARVVDLVQRLTLQEKVGFLVNNASNVDRLGIPKY  98

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             WWSEALHG+S  GPG  F  +VP ATSFPQ +LTAASFN TLF   GK
Sbjct  99   SWWSEALHGVSDVGPGTTFASLVPGATSFPQVILTAASFNATLFETIGK  147



>ref|XP_002873418.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49677.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q++PV+ACD   NP L  L FCN  L++K+RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTGNPSLAGLRFCNTGLNIKSRVTDLVGRLTLEEKIGFLGSNAIGVSRL  91

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIP Y+WWSEALHG+S  G G +F+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  92   GIPAYKWWSEALHGVSNVGGGSSFSGQVPGATSFPQVILTAASFNVSLFQAIGK  145



>ref|XP_009403180.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Musa acuminata subsp. malaccensis]
Length=769

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            S   P++ACD   N  L    FCN     K RV DLVKRLTL EK+ FLVN A  V RLG
Sbjct  28   SGQGPIFACDVASNRSLAGFGFCNVSWGTKQRVKDLVKRLTLQEKVGFLVNKATAVPRLG  87

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            IP+YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF   GK
Sbjct  88   IPSYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQVILTAASFNATLFKAIGK  140



>ref|XP_003593145.1| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago truncatula]
 gb|AES63396.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=775

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT+ V+ACD  KN  + S  FC++ L V+ RV+DLVKRLTL EKI  L N+A  VSR
Sbjct  32   VYGQTSTVFACDVAKNTNVSSYGFCDKSLSVEDRVSDLVKRLTLQEKIGNLGNSAVEVSR  91

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSG  483
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF   G
Sbjct  92   LGIPKYEWWSEALHGVSNIGPGTHFSSLVPGATSFPMPILTAASFNTSLFQAIG  145



>ref|XP_004485551.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cicer arietinum]
Length=775

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT+ V+ACD  KN  L    FC++ L VK RV DLVKRLTL EKI  L N+A  VSR
Sbjct  32   VYGQTSTVFACDVAKNSSLAGYGFCDKSLSVKERVLDLVKRLTLKEKIGNLGNSAVEVSR  91

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSG  483
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF   G
Sbjct  92   LGIPKYEWWSEALHGISNIGPGTHFSTLVPGATSFPMPILTAASFNTSLFQAIG  145



>ref|XP_010452969.1| PREDICTED: beta-D-xylosidase 3-like [Camelina sativa]
Length=779

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q++PV+ACD  +NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTRNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRL  91

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIP Y WWSEALHG+S  G G NF+G +  ATSFPQ +LTAASFN +LF   GK
Sbjct  92   GIPDYNWWSEALHGVSNVGSGTNFSGQIRGATSFPQVILTAASFNVSLFQAIGK  145



>ref|XP_006399455.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
 gb|ESQ40908.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
Length=779

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P  +Q++PV+ACD   NP L    FCN  L  + RV DLV RLTL EKI FL + A  VS
Sbjct  30   PSNAQSSPVFACDITGNPSLAGFGFCNTELKAEDRVTDLVGRLTLEEKIGFLGSRANGVS  89

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIP Y WWSEALHG+S  G G NF+G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  90   RLGIPPYNWWSEALHGVSDVGHGTNFSGQVPGATSFPQVILTAASFNVSLFEAIGK  145



>gb|KJB77499.1| hypothetical protein B456_012G140300 [Gossypium raimondii]
Length=776

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = +1

Query  142  VQSQTAP-VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            V  Q +P V+ACD  K+  +    FCN  L    RVADLV+RLTL EKI  +VN AGN+S
Sbjct  29   VVGQVSPAVFACDATKDRKVVHYGFCNASLGRDARVADLVRRLTLQEKILNIVNGAGNIS  88

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIP YEWWSEALHG+S  GPG NF+ +VP ATSFPQ +LTAASFN +LF   GK
Sbjct  89   RLGIPKYEWWSEALHGVSNVGPGTNFSSLVPGATSFPQVILTAASFNTSLFEAIGK  144



>ref|XP_010422951.1| PREDICTED: beta-D-xylosidase 3 isoform X2 [Camelina sativa]
Length=752

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q++PV+ACD   NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  48   AQSSPVFACDVTGNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRLG  107

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            IP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF   GK
Sbjct  108  IPAYNWWSEALHGVSYIGGGSGFSGQVHGATSFPQVILTAASFNVSLFQAIGK  160



>ref|XP_010422950.1| PREDICTED: beta-D-xylosidase 3 isoform X1 [Camelina sativa]
Length=794

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q++PV+ACD   NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  47   NAQSSPVFACDVTGNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRL  106

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF   GK
Sbjct  107  GIPAYNWWSEALHGVSYIGGGSGFSGQVHGATSFPQVILTAASFNVSLFQAIGK  160



>ref|XP_010687471.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +1

Query  157  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  336
            +P +ACDT  N  L SL FC+    V+ RVADL+ RLTL EKI +L++ A +V+RLGIP 
Sbjct  39   SPAFACDTTSNASLSSLGFCDTSKSVEARVADLIGRLTLTEKIGYLISGAASVNRLGIPK  98

Query  337  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            YEWWSEALHG+S  GPG  FT VVP ATSFPQ + TAASFN TLF   GK
Sbjct  99   YEWWSEALHGVSNVGPGTRFTSVVPGATSFPQVITTAASFNTTLFQAIGK  148



>sp|A5JTQ2.1|XYL1_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 1; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
1; Short=MsXyl1; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor, 
partial [Medicago sativa subsp. x varia]
 gb|ABQ45227.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V  QT+ V+ACD  KN  + S  FC+  L V+ RV+DLVKRLTL EKI  L N+A  VSR
Sbjct  31   VYGQTSTVFACDVAKNTNVSSYGFCDNSLSVEDRVSDLVKRLTLQEKIGNLGNSAVEVSR  90

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSG  483
            LGIP YEWWSEALHG+S  GPG +F+ +VP AT+FP P+LTAASFN +LF   G
Sbjct  91   LGIPKYEWWSEALHGVSNIGPGTHFSSLVPGATNFPMPILTAASFNTSLFQAIG  144



>gb|KHN06823.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Glycine soja]
Length=301

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+AG+VSRLGIP YEW
Sbjct  12   FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAGDVSRLGIPRYEW  71

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  G G  F+ VVP ATSFP P+LTAASFN +LF   G+
Sbjct  72   WSEALHGVSNVGLGTRFSNVVPGATSFPMPILTAASFNTSLFEVIGR  118



>gb|KHG02719.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=776

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 84/119 (71%), Gaps = 3/119 (3%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            ++G V   +  V+ACD  K+  +    FCN  L    RVADLV+RLTL EKI  +VN AG
Sbjct  29   VVGQV---SQAVFACDATKDRKVVHYGFCNASLGRDARVADLVRRLTLQEKILNIVNGAG  85

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            N+SRLGIP YEWWSEALHG+S  GPG NF+ +VP ATSFPQ +LTAASFN +LF   GK
Sbjct  86   NISRLGIPKYEWWSEALHGVSNIGPGTNFSSLVPGATSFPQVILTAASFNTSLFEAIGK  144



>ref|XP_004301992.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=774

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 85/116 (73%), Gaps = 3/116 (3%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V S +   YAC    N   +S PFC++ L V  RVADLV+RLTL EKITFLV+ AGNVSR
Sbjct  32   VSSVSGQSYACGDGFNA--RSFPFCDKSLAVDARVADLVQRLTLQEKITFLVDAAGNVSR  89

Query  322  LGIPTYEWWSEALHGLSYTGP-GVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIPTY+WWSEALHG+S  G  G  FT +VP ATSFPQP+LTAASFN +LF   G+
Sbjct  90   LGIPTYQWWSEALHGVSKVGRGGTKFTELVPGATSFPQPILTAASFNNSLFEAIGR  145



>ref|XP_010491610.1| PREDICTED: beta-D-xylosidase 3-like isoform X1 [Camelina sativa]
Length=779

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTGNPSLAVLGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSRAVGVSRL  91

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF   GK
Sbjct  92   GIPDYNWWSEALHGVSYIGGGSGFSGQVRGATSFPQVILTAASFNVSLFQAIGK  145



>ref|XP_010491611.1| PREDICTED: beta-D-xylosidase 3-like isoform X2 [Camelina sativa]
Length=765

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
             +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRL
Sbjct  32   NAQSSPVFACDVTGNPSLAVLGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSRAVGVSRL  91

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF   GK
Sbjct  92   GIPDYNWWSEALHGVSYIGGGSGFSGQVRGATSFPQVILTAASFNVSLFQAIGK  145



>emb|CDY21595.1| BnaC09g46970D [Brassica napus]
Length=942

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +1

Query  130  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  306
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLTGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  307  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
              VSRLGIP Y WWSEALHG+S  G G NFTG VP ATSFPQ +LTAASFN +LF   GK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSNFTGPVPGATSFPQVILTAASFNVSLFQAIGK  146



>ref|XP_003524073.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=613

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 83/115 (72%), Gaps = 3/115 (3%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V+ QT   +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+AG+VSR
Sbjct  25   VRGQT---FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAGDVSR  81

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGIP YEWWSEALHG+S  G G  F+ VVP ATSFP P+LTAASFN +LF   G+
Sbjct  82   LGIPRYEWWSEALHGVSNVGLGTRFSNVVPGATSFPMPILTAASFNTSLFEVIGR  136



>ref|XP_009629821.1| PREDICTED: beta-D-xylosidase 1-like isoform X2 [Nicotiana tomentosiformis]
Length=147

 Score =   132 bits (331),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = +1

Query  151  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  330
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI  LVN A  V RLG+
Sbjct  27   ESRPPFACDPA-NAGTRNLPFCKASLPIHVRVQDLIERLTLQEKIRLLVNNAAPVERLGV  85

Query  331  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK*FPPRPEA  510
              YEWWSEALHG+S TGPGV F G  P+ATSFPQ + TAASFN +L+   G+ F     A
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQTFQRIRYA  145

Query  511  C  513
            C
Sbjct  146  C  146



>emb|CDY01780.1| BnaC06g28200D [Brassica napus]
Length=776

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++P +ACD  +NP L    FCN  L  + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPEFACDITRNPSLAGYGFCNTGLKAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             Y WWSEALHG+S  G G NFTG VP ATSFPQ +LTAASFN +LF   GK
Sbjct  96   DYNWWSEALHGVSDVGGGSNFTGPVPGATSFPQVILTAASFNLSLFQAIGK  146



>emb|CDX96113.1| BnaA07g26180D [Brassica napus]
Length=1013

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ +  VSRLGIP
Sbjct  36   SSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKSTGVSRLGIP  95

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             Y WWSEALHG+S  G G +FTG+VP ATSFPQ +LTAASFN +LF   GK
Sbjct  96   DYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVILTAASFNVSLFQAIGK  146



>ref|XP_010491609.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P  +Q+ P +AC+   N  L    FCN ++ +++RVADLV RLTL EKI FL ++    S
Sbjct  28   PSNAQSLPAFACNVAGNNSLAGFGFCNTKIKIESRVADLVGRLTLQEKIKFLGSSGNGAS  87

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIPTYEWW+EALHG+S+ GP   F+ +VP+AT FPQ +LTAASFN +LF   GK
Sbjct  88   RLGIPTYEWWAEALHGVSFIGPATRFSKLVPSATCFPQVILTAASFNVSLFKAIGK  143



>ref|XP_009105246.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ +  VSRLGIP
Sbjct  36   SSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKSTGVSRLGIP  95

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             Y WWSEALHG+S  G G +FTG+VP ATSFPQ  LTAASFN +LF   GK
Sbjct  96   DYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVKLTAASFNASLFQAIGK  146



>ref|XP_010068200.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=777

 Score =   138 bits (348),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = +1

Query  163  VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  342
            V+ CD   +P L +  FCN    V+ RVADLVKRLTL EK+ FL N AG+V RLGIP Y+
Sbjct  43   VFPCD--GDPSLSTFGFCNMSWGVEARVADLVKRLTLQEKVGFLGNHAGSVDRLGIPEYQ  100

Query  343  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WWSEALHG+SY G G +F+ +VP ATSFPQ +LTAASFN TLF   GK
Sbjct  101  WWSEALHGVSYIGGGTSFSSLVPGATSFPQVILTAASFNATLFETIGK  148


 Score = 35.4 bits (80),  Expect(2) = 6e-35, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +3

Query  468  FHTIGKVISTEARSMHN  518
            F TIGKV+STEAR+MHN
Sbjct  143  FETIGKVVSTEARAMHN  159



>emb|CDX97115.1| BnaC09g45100D [Brassica napus]
Length=695

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 82/120 (68%), Gaps = 1/120 (1%)
 Frame = +1

Query  130  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  306
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ITKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  307  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146



>gb|EYU18508.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=770

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 81/110 (74%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  KNP LKS  FCN  LD+ TRVADLV +LTL EKI ++V+ +  V+RLGIP Y
Sbjct  33   PPFACDVSKNPDLKSFTFCNPSLDIDTRVADLVNKLTLKEKIGWVVSGSEGVTRLGIPGY  92

Query  340  EWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+   GPGV F    VPAATSFPQ +LTAASFN +LF   GK
Sbjct  93   EWWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILTAASFNVSLFHLIGK  142



>gb|EYU18507.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=773

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 81/110 (74%), Gaps = 1/110 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  KNP LKS  FCN  LD+ TRVADLV +LTL EKI ++V+ +  V+RLGIP Y
Sbjct  33   PPFACDVSKNPDLKSFTFCNPSLDIDTRVADLVNKLTLKEKIGWVVSGSEGVTRLGIPGY  92

Query  340  EWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+   GPGV F    VPAATSFPQ +LTAASFN +LF   GK
Sbjct  93   EWWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILTAASFNVSLFHLIGK  142



>ref|XP_003531047.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=765

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+A +VSRLGIP YEW
Sbjct  30   FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAVDVSRLGIPKYEW  89

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F+ V+P ATSFP P+LTAASFN +LF   G+
Sbjct  90   WSEALHGVSNVGPGTRFSNVIPGATSFPMPILTAASFNTSLFEVIGR  136



>ref|XP_009629820.1| PREDICTED: beta-D-xylosidase 1-like isoform X1 [Nicotiana tomentosiformis]
Length=153

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +1

Query  151  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  330
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI  LVN A  V RLG+
Sbjct  27   ESRPPFACDPA-NAGTRNLPFCKASLPIHVRVQDLIERLTLQEKIRLLVNNAAPVERLGV  85

Query  331  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
              YEWWSEALHG+S TGPGV F G  P+ATSFPQ + TAASFN +L+   G+
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQ  137



>ref|XP_009122535.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPKFACDDTKNPSLAGYRFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  96   DYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146



>emb|CDY35825.1| BnaC09g37570D [Brassica napus]
Length=774

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  96   DYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146



>gb|ABR17218.1| unknown [Picea sitchensis]
Length=151

 Score =   130 bits (326),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +1

Query  151  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  330
             +A  + CD   + GL S PFCN  L +  R  DLV RLTL EK+  LVN A N+SRLGI
Sbjct  24   HSAGSFPCD--PSTGLNSFPFCNVSLPIADRAKDLVGRLTLQEKVQQLVNGASNISRLGI  81

Query  331  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            P YEWWSEALHG+S  GPG  F   VP ATSFPQ +LTAASFN+TL+   G+
Sbjct  82   PMYEWWSEALHGVSDVGPGTRFGAPVPGATSFPQVILTAASFNDTLWEAIGR  133



>emb|CDX69892.1| BnaA10g22410D [Brassica napus]
Length=774

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            ++P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF   GK
Sbjct  96   DYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146



>dbj|BAJ89945.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=525

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF   G+
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGE  142



>dbj|BAJ90420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08165.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF   G+
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGE  142



>dbj|BAJ90315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   137 bits (344),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF   G+
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGE  142



>gb|EMT32951.1| Beta-D-xylosidase 4 [Aegilops tauschii]
Length=970

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++QT PV+ACD   N  L    FCN++     R  DLV RLTL EK+ FLVN    + RL
Sbjct  223  EAQT-PVFACD-ASNATLAGYGFCNRKASASARAKDLVSRLTLAEKVGFLVNKQAALGRL  280

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF   G+
Sbjct  281  GIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGE  334



>emb|CAJ86028.1| B0414F07.1 [Oryza sativa Indica Group]
Length=320

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++QT PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    + RL
Sbjct  25   RAQT-PVFACDA-SNATVSGYGFCDRTKSSAARAADLLGRLTLAEKVGFLVNKQAALPRL  82

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF   G+
Sbjct  83   GIPAYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQPILTAASFNASLFRAIGE  136



>ref|XP_010424711.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +AC+   N  L    FCN +L ++ RVADLV RLTL EK+ FL ++    SRLGIPTY
Sbjct  35   PAFACNVAGNNSLARFGFCNTKLKIERRVADLVGRLTLQEKVRFLGSSGNGASRLGIPTY  94

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWW+EALHG+S+ GP   FT +VP+AT FPQ +LTAASFN +LF   GK
Sbjct  95   EWWAEALHGVSFIGPATRFTKLVPSATCFPQVILTAASFNVSLFKAIGK  143



>gb|AAK38481.1| alpha-L-arabinofuranosidase/beta-D-xylosidase isoenzyme ARA-I 
[Hordeum vulgare]
Length=777

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    + RLGIP Y
Sbjct  37   PVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPALGRLGIPAY  95

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF   G+
Sbjct  96   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGE  144



>ref|XP_002448619.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
 gb|EES12947.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
Length=767

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 81/114 (71%), Gaps = 2/114 (2%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++QT PV+ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  28   RAQT-PVFACDA-SNATLASYGFCNRSASASARAADLVSRLTLAEKVGFLVDKQAALPRL  85

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIP YEWWSEALHG+SY GPG  F+ +VPAATSFPQP+LTAASFN TLF   G+
Sbjct  86   GIPLYEWWSEALHGVSYVGPGTRFSSLVPAATSFPQPILTAASFNATLFRAIGE  139



>ref|XP_009804071.1| PREDICTED: beta-D-xylosidase 1 isoform X2 [Nicotiana sylvestris]
Length=665

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +1

Query  151  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  330
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI  LVN A  V RLG+
Sbjct  27   ESRPAFACDPA-NAGTRNLPFCKTSLPIHVRVQDLIQRLTLQEKIRLLVNNAAPVERLGV  85

Query  331  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
              YEWWSEALHG+S TGPGV F G  P+ATSFPQ + TAASFN +L+   G+
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQ  137



>gb|EYU18509.1| hypothetical protein MIMGU_mgv1a001665mg [Erythranthe guttata]
Length=777

 Score =   130 bits (326),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +1

Query  133  IGPVQSQTAPV-YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            I PV S   P  +ACD  KNP L+S  FCN  LD++TRVADLV +LTL EKI ++++ + 
Sbjct  27   ITPVFSAGKPGPFACDVSKNPDLESFTFCNPSLDIETRVADLVNKLTLKEKIGWVISGSE  86

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFTPSGK  486
             VSRLGIP Y WWSEALHG+   GPG  F    V AATSFPQ +LTAASFN +LF   GK
Sbjct  87   GVSRLGIPGYWWWSEALHGIGSNGPGSKFEPDNVRAATSFPQVILTAASFNVSLFHLIGK  146


 Score = 35.0 bits (79),  Expect(2) = 3e-32, Method: Composition-based stats.
 Identities = 14/17 (82%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +3

Query  468  FHTIGKVISTEARSMHN  518
            FH IGK ISTEAR+MHN
Sbjct  141  FHLIGKAISTEARAMHN  157



>ref|XP_002974833.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
 gb|EFJ24353.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
Length=784

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 82/120 (68%), Gaps = 2/120 (2%)
 Frame = +1

Query  130  IIGPVQSQTAPV-YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  306
            I+   ++ TA + YACD   N  L S PFC+ +L +  RV DLV RLTL EK+  +VN A
Sbjct  23   ILSNARASTAQLRYACDVSSNASLGSFPFCDTKLGIDVRVQDLVSRLTLDEKVDEMVNAA  82

Query  307  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
              + RLG+P+Y+WW EALHG++ + PGV F G+ PAATSFP P+ TAASFN TLF   G+
Sbjct  83   QGIPRLGVPSYQWWQEALHGVA-SSPGVQFGGLAPAATSFPMPIATAASFNSTLFYSIGE  141



>ref|XP_009804070.1| PREDICTED: beta-D-xylosidase 1 isoform X1 [Nicotiana sylvestris]
Length=774

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = +1

Query  151  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  330
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI  LVN A  V RLG+
Sbjct  27   ESRPAFACDPA-NAGTRNLPFCKTSLPIHVRVQDLIQRLTLQEKIRLLVNNAAPVERLGV  85

Query  331  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
              YEWWSEALHG+S TGPGV F G  P+ATSFPQ + TAASFN +L+   G+
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQ  137



>ref|XP_008445351.1| PREDICTED: probable beta-D-xylosidase 7 [Cucumis melo]
Length=783

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNTA  + RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCRTSLPIKLRARDLVSRLTLDEKVLQLVNTAPAIPRLG  90

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            IP YEWWSEALHG++  G G+   G +PAATSFPQ +LTAASF+E L+   G+
Sbjct  91   IPAYEWWSEALHGVADVGYGIRLNGTIPAATSFPQVILTAASFDENLWYQIGQ  143



>ref|XP_002963750.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
 gb|EFJ35621.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
Length=785

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            S   P YACD   N  L S PFC+ +L V  RV DLV RLTL EK+  +VN A  + RLG
Sbjct  31   STAQPRYACDVSSNASLGSFPFCDTKLGVDVRVQDLVSRLTLDEKVDEMVNAAQGIPRLG  90

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            +P+Y+WW EALHG++ + PGV F G+ PAATSFP P+  AASFN TLF   G+
Sbjct  91   VPSYQWWQEALHGVA-SSPGVQFGGLAPAATSFPMPIAMAASFNSTLFYSIGE  142



>ref|XP_004976989.1| PREDICTED: beta-D-xylosidase 4-like isoform X2 [Setaria italica]
Length=770

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 75/109 (69%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD   N  L +  FCN+      R ADLV RL L EK+ FLV+    + RLGIP Y
Sbjct  33   PVFACDA-SNATLAAYGFCNRSATPAARAADLVSRLKLAEKVGFLVDKQAALPRLGIPAY  91

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF   G+
Sbjct  92   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNVTLFRAIGE  140



>ref|NP_001054038.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAE02971.2| OSJNBb0079B02.3 [Oryza sativa Japonica Group]
 dbj|BAF15952.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAH67823.1| OSIGBa0138H21-OSIGBa0138E01.14 [Oryza sativa Indica Group]
 gb|EEC78109.1| hypothetical protein OsI_17615 [Oryza sativa Indica Group]
Length=765

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++QT PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    + RL
Sbjct  25   RAQT-PVFACDA-SNATVSGYGFCDRTKSSAARAADLLGRLTLAEKVGFLVNKQAALPRL  82

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF   G+
Sbjct  83   GIPAYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQPILTAASFNASLFRAIGE  136



>emb|CAE03635.1| OSJNBb0003B01.27 [Oryza sativa Japonica Group]
Length=839

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++QT PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    + RL
Sbjct  25   RAQT-PVFACDA-SNATVSGYGFCDRTKSSAARAADLLGRLTLAEKVGFLVNKQAALPRL  82

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF   G+
Sbjct  83   GIPAYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQPILTAASFNASLFRAIGE  136



>ref|XP_003615011.1| Beta-D-xylosidase [Medicago truncatula]
Length=155

 Score =   123 bits (308),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = +1

Query  157  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  336
             P Y+CDT  NP  K  PFCN  L +  R  D+V RLTL EK++ LVNTA  + RL IP+
Sbjct  33   VPPYSCDT-SNPRTKLFPFCNLNLTITQRAKDIVSRLTLDEKVSQLVNTAPAIPRLDIPS  91

Query  337  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLF  471
            Y+WW+EALHG+SY G G+   G +PAATSFPQ +LTAASF+  L+
Sbjct  92   YQWWNEALHGVSYVGMGIILNGSIPAATSFPQVILTAASFDPKLW  136



>ref|XP_003615012.1| Auxin-induced beta-glucosidase, partial [Medicago truncatula]
Length=190

 Score =   124 bits (311),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P Y+CDT  NP  KSLPFCN  L +  R  D+V RLTL EKI+ LVNTA ++ RLGIP+Y
Sbjct  34   PPYSCDTT-NPLTKSLPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPSIPRLGIPSY  92

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLF  471
            +WW EALHG++  G G+   G V  ATSFPQ +LTAASF+  L+
Sbjct  93   QWWDEALHGVANAGKGIRLNGSVAGATSFPQVILTAASFDSKLW  136



>ref|XP_006855294.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
 gb|ERN16761.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
Length=768

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 79/116 (68%), Gaps = 4/116 (3%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P   +  P +ACD      + S PFC++ L +  RV+DL++RLTLPEK   LVN A  ++
Sbjct  20   PAIVEPGPSFACDGQ----MGSFPFCDRSLPINARVSDLIRRLTLPEKTRLLVNNAEGLA  75

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLG+P YEWWSEALHG+S  GPG  F G VP ATSFPQ +LTAASFN +L+   G+
Sbjct  76   RLGVPHYEWWSEALHGVSNVGPGTRFGGNVPGATSFPQVILTAASFNSSLWEEIGQ  131



>ref|XP_002515300.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF47284.1| Beta-glucosidase, putative [Ricinus communis]
Length=768

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD+ K+   K+LPFC  +L ++ RV DL+ RLTL EK+  LVN AG VSRLGI  YEW
Sbjct  28   FACDS-KDGTTKNLPFCQVKLPIQDRVKDLIGRLTLAEKVGLLVNNAGAVSRLGIKGYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+   G+
Sbjct  87   WSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNSTLWEAIGR  133



>ref|XP_004976988.1| PREDICTED: beta-D-xylosidase 4-like isoform X1 [Setaria italica]
Length=833

 Score =   131 bits (329),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 64/109 (59%), Positives = 75/109 (69%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            PV+ACD   N  L +  FCN+      R ADLV RL L EK+ FLV+    + RLGIP Y
Sbjct  33   PVFACDA-SNATLAAYGFCNRSATPAARAADLVSRLKLAEKVGFLVDKQAALPRLGIPAY  91

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF   G+
Sbjct  92   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNVTLFRAIGE  140



>gb|AFW59619.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=451

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++QT P +ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  34   RAQT-PAFACD-ASNATLASYGFCNRSAAAAARAADLVSRLTLAEKVGFLVDKQAALPRL  91

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            G+P YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF   G+
Sbjct  92   GVPLYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNATLFRAIGE  145



>gb|EYU44008.1| hypothetical protein MIMGU_mgv1a0207571mg, partial [Erythranthe 
guttata]
Length=203

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   N   K++PFC   L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  33   FACDP-SNSVSKNMPFCRVSLHIRDRVGDLIGRLTLQEKIRSLVNNAAPVDRLGIKGYEW  91

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S TGPGV F G  P ATSFPQ + TAASFN +L+   G+
Sbjct  92   WSEALHGVSNTGPGVKFGGEFPGATSFPQVITTAASFNSSLWEAIGQ  138



>emb|CDP18762.1| unnamed protein product [Coffea canephora]
Length=506

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 79/112 (71%), Gaps = 6/112 (5%)
 Frame = +1

Query  151  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  330
            +  P YAC +       +  F    LDVKTRV DL+K+L+L EKI  LV+ A  VSRL I
Sbjct  15   RITPAYACAS------GNYTFYYTSLDVKTRVDDLIKKLSLQEKIGNLVDGAAGVSRLRI  68

Query  331  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            P YEWWSE LHG+S TGPGV+FT +VP ATSFPQ +LTAASFN++LF  +GK
Sbjct  69   PIYEWWSEILHGVSNTGPGVHFTSLVPGATSFPQVILTAASFNQSLFEINGK  120



>gb|EYU23815.1| hypothetical protein MIMGU_mgv1a0042532mg, partial [Erythranthe 
guttata]
Length=321

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 72/104 (69%), Gaps = 1/104 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P ++CD   NP   SLPFCN RL + TR +DLV RLTL EK+  LVNTA  V RL I  Y
Sbjct  31   PPFSCD-ASNPSTSSLPFCNTRLPITTRASDLVSRLTLDEKVQQLVNTAAAVPRLNISAY  89

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLF  471
            EWWSEALHG+S  G GV F G V +AT FPQ +LTAASF+  L+
Sbjct  90   EWWSEALHGVSRHGRGVRFNGTVTSATMFPQIILTAASFDSHLW  133



>ref|XP_008661822.1| PREDICTED: uncharacterized protein LOC100279996 isoform X1 [Zea 
mays]
 gb|AFW59620.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=773

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 79/114 (69%), Gaps = 2/114 (2%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++QT P +ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  34   RAQT-PAFACDA-SNATLASYGFCNRSAAAAARAADLVSRLTLAEKVGFLVDKQAALPRL  91

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            G+P YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF   G+
Sbjct  92   GVPLYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNATLFRAIGE  145



>gb|KHG24361.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=244

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  30   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  88

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+   G+
Sbjct  89   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQ  137



>ref|XP_006653810.1| PREDICTED: beta-D-xylosidase 4-like [Oryza brachyantha]
Length=776

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 77/117 (66%), Gaps = 1/117 (1%)
 Frame = +1

Query  136  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  315
            G V     PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    +
Sbjct  25   GNVARAQTPVFACDA-SNATVAGYGFCDRSKSAAARAADLLGRLTLAEKVGFLVNKQAAL  83

Query  316  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF   G+
Sbjct  84   PRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGE  140



>gb|KDP28242.1| hypothetical protein JCGZ_14013 [Jatropha curcas]
Length=772

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K    ++LPFC  +L ++ RV DL+ RLTL EK+  LVN A +VSRLGI  YEW
Sbjct  30   FACDP-KEETTRNLPFCQVKLPIQDRVKDLIGRLTLQEKVVLLVNNAASVSRLGIKGYEW  88

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+   G+
Sbjct  89   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNATLWEAIGR  135



>ref|XP_003625957.1| Beta-xylosidase [Medicago truncatula]
 gb|AES82175.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=771

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K+   K+LPFCN +L +  RV DL+ RLT+ EK+  LVN A  V R+G+ +YEW
Sbjct  28   FACDA-KDAATKNLPFCNVKLAIPERVKDLIGRLTMQEKVNLLVNNAPAVPRVGMKSYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F GV PAATSFPQ + TAASFN +L+   G+
Sbjct  87   WSEALHGVSNVGPGTRFGGVFPAATSFPQVITTAASFNASLWEAIGR  133



>ref|XP_008234021.1| PREDICTED: probable beta-D-xylosidase 7 [Prunus mume]
Length=781

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            T P YACD+ + P   S PFC   L +  RV DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  29   TQPPYACDSSQ-PSTSSYPFCKTALPINQRVQDLVSRLTLDEKISQLVNSAPPIPRLGIP  87

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            +YEWWSEALHG++  G G+N  G +  ATSFPQ +LTAASFNE L+   G+
Sbjct  88   SYEWWSEALHGVADVGKGINLYGTISNATSFPQVILTAASFNEHLWYRIGQ  138



>ref|XP_004163321.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-D-xylosidase 7-like 
[Cucumis sativus]
Length=783

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNT   + RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCKTYLPIKLRARDLVSRLTLDEKVLQLVNTVPPIPRLG  90

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            IP YEWWSEALHG++  G G+   G + AATSFPQ +LTAASF+E L+   G+
Sbjct  91   IPAYEWWSEALHGVANVGYGIRLNGTITAATSFPQVILTAASFDENLWYQIGQ  143



>ref|XP_003580652.1| PREDICTED: beta-D-xylosidase 4-like [Brachypodium distachyon]
Length=774

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 80/114 (70%), Gaps = 2/114 (2%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            ++QT PV+ACD   N  +    FC++      R ADLV RLTL +K+ FLVN    ++RL
Sbjct  32   RAQT-PVFACDAA-NSTVAGYAFCDRAKSASARAADLVSRLTLADKVGFLVNKQPALARL  89

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF   G+
Sbjct  90   GIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGE  143



>ref|XP_004150696.1| PREDICTED: probable beta-D-xylosidase 7-like [Cucumis sativus]
 gb|KGN62174.1| Periplasmic beta-glucosidase [Cucumis sativus]
Length=783

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 77/113 (68%), Gaps = 1/113 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            S + P YACD+  NP  K+LPFC   L +K R  DLV RLTL EK+  LVNT   + RLG
Sbjct  32   SSSQPPYACDS-SNPLTKTLPFCKTYLPIKLRARDLVSRLTLDEKVLQLVNTVPPIPRLG  90

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            IP YEWWSEALHG++  G G+   G + AATSFPQ +LTAASF+E L+   G+
Sbjct  91   IPAYEWWSEALHGVANVGYGIRLNGTITAATSFPQVILTAASFDENLWYQIGQ  143



>ref|XP_010657638.1| PREDICTED: beta-D-xylosidase 4-like [Vitis vinifera]
Length=242

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +1

Query  244  VADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATS  423
            VADLVKRLTL EKI FLVN+A  VSRLGIP YEWWS+ALHG+SY GPG +F  VVP ATS
Sbjct  71   VADLVKRLTLEEKIGFLVNSAARVSRLGIPKYEWWSQALHGVSYVGPGTHFNSVVPGATS  130

Query  424  FPQPLLTAASFNETLFTPSGK  486
            FPQ +L AASF  +LF   GK
Sbjct  131  FPQVILPAASFYASLFEAIGK  151



>ref|XP_002285805.1| PREDICTED: probable beta-D-xylosidase 7 [Vitis vinifera]
Length=774

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            I+  V+S  +P ++CD+  NP  KS  FC   L +  RV DLV RLTL EKI+ LVN+A 
Sbjct  17   ILVGVESTQSPPFSCDS-SNPSTKSYHFCKTTLPIPDRVRDLVSRLTLDEKISQLVNSAP  75

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             + RLGIP YEWWSEALHG++  GPG+ F G + +ATSFPQ +LTAASF+  L+   G+
Sbjct  76   AIPRLGIPAYEWWSEALHGVADAGPGIRFNGTIRSATSFPQVILTAASFDVHLWYRIGR  134



>gb|KDP44489.1| hypothetical protein JCGZ_16322 [Jatropha curcas]
Length=796

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            YACD  KNP      FCN  L  + R  DL+ RLTL EK+  LVN A  +SRLGIP YEW
Sbjct  27   YACDQ-KNPETSQYAFCNTTLPYQDRAKDLISRLTLQEKVQQLVNHAAGISRLGIPAYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  G GV+F   VP ATSFP  +L+AASFNETL+   G+
Sbjct  86   WSEALHGVSNVGYGVHFNETVPGATSFPAVILSAASFNETLWLKMGQ  132



>ref|XP_004170761.1| PREDICTED: beta-D-xylosidase 1-like [Cucumis sativus]
Length=241

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = +1

Query  172  CDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEWWS  351
            CD  +N G +++ FC + L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEWWS
Sbjct  34   CDK-RNVGTRNMGFCQESLGIEERVKDLIGRLTLGEKIRLLVNNAIAVPRLGIRGYEWWS  92

Query  352  EALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+   G+
Sbjct  93   EALHGVSNVGPGTKFGGTFPGATSFPQVITTAASFNQSLWLLIGR  137



>gb|KJB38536.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=589

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  89

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+   G+
Sbjct  90   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQ  138



>gb|KHN30647.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=582

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+   G+
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGR  132



>ref|XP_003615003.1| Xylan 1 4-beta-xylosidase [Medicago truncatula]
 gb|AES97961.1| glycoside hydrolase family 3 amino-terminal domain protein [Medicago 
truncatula]
Length=780

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P Y+CDT  NP  KS PFCN  L +  R  D+V RLTL EKI+ LVNTA  + RLGIP+Y
Sbjct  32   PPYSCDT-SNPLTKSFPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPAIPRLGIPSY  90

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLF  471
            +WW+EALHG+SY G G+   G + AATSFPQ +L AASF+  L+
Sbjct  91   QWWNEALHGVSYVGKGIRLNGSITAATSFPQIILIAASFDPKLW  134



>emb|CBI19138.3| unnamed protein product [Vitis vinifera]
Length=1411

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            I+  V+S  +P ++CD+  NP  KS  FC   L +  RV DLV RLTL EKI+ LVN+A 
Sbjct  17   ILVGVESTQSPPFSCDS-SNPSTKSYHFCKTTLPIPDRVRDLVSRLTLDEKISQLVNSAP  75

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             + RLGIP YEWWSEALHG++  GPG+ F G + +ATSFPQ +LTAASF+  L+   G+
Sbjct  76   AIPRLGIPAYEWWSEALHGVADAGPGIRFNGTIRSATSFPQVILTAASFDVHLWYRIGR  134


 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            Q  ++P +ACD+  +P  KS  FCN  L +  R +DL+ RLTL EKI+ L+++A ++ RL
Sbjct  691  QLSSSPPFACDS-SDPLTKSYAFCNTTLRISQRASDLISRLTLDEKISQLISSAASIPRL  749

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GIP YEWWSEALHG+     G+ F G + +ATSFPQ +LTAASF+  L+   G+
Sbjct  750  GIPAYEWWSEALHGIR-DRHGIRFNGTIRSATSFPQVILTAASFDAHLWYRIGQ  802



>gb|KJB77632.1| hypothetical protein B456_012G147500 [Gossypium raimondii]
Length=788

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 76/119 (64%), Gaps = 2/119 (2%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            ++ P  +Q  P +ACD   +P     PFC+  L  + R  DLV RLTL EK+  LVNTA 
Sbjct  18   VLVPYNTQAQP-FACDK-NDPNTSKFPFCDTTLSYQDRTKDLVSRLTLQEKVQQLVNTAS  75

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             + RLG+P Y+WWSEALHG+S  GPG  F   VP ATSFP  +L+AASFNE L+   G+
Sbjct  76   GIPRLGVPAYQWWSEALHGVSDLGPGTRFNATVPGATSFPAVILSAASFNEMLWLEMGR  134



>ref|XP_011015623.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K+   ++LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+   G+
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQ  132



>ref|XP_003519750.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=772

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  28   FACDP-KNTATKNLPFCKASLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+   G+
Sbjct  87   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGR  133



>ref|XP_011041424.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K+   ++LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+   G+
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQ  132



>ref|XP_002980053.1| hypothetical protein SELMODRAFT_112087 [Selaginella moellendorffii]
 gb|EFJ18923.1| hypothetical protein SELMODRAFT_112087 [Selaginella moellendorffii]
Length=772

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 74/107 (69%), Gaps = 2/107 (2%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            YACD   N  L + PFCN  L +  RV D V RLTL EKI+ L+NTA  + RLG+P Y+W
Sbjct  30   YACDQ-SNATLAAFPFCNTSLAITDRVEDYVARLTLEEKISQLINTATGIPRLGVPKYQW  88

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            W EALHG++ + PGV F G VPAATSFP P+ TAASFN +LF   G+
Sbjct  89   WQEALHGVA-SSPGVQFGGSVPAATSFPMPITTAASFNTSLFYGIGQ  134



>gb|AES97966.2| glycoside hydrolase family 3 protein [Medicago truncatula]
Length=782

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P Y+CDT  NP  KSLPFCN  L +  R  D+V RLTL EKI+ LVNTA ++ RLGIP+Y
Sbjct  34   PPYSCDTT-NPLTKSLPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPSIPRLGIPSY  92

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLF  471
            +WW EALHG++  G G+   G V  ATSFPQ +LTAASF+  L+
Sbjct  93   QWWDEALHGVANAGKGIRLNGSVAGATSFPQVILTAASFDSKLW  136



>ref|XP_011011483.1| PREDICTED: probable beta-D-xylosidase 7 [Populus euphratica]
Length=773

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            T P ++CD+  NP  K+ PFC   L +  R  DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  24   TQPPFSCDS-SNPTTKTFPFCKTTLPISQRATDLVSRLTLDEKISQLVNSAQPIPRLGIP  82

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFN  459
             Y+WWSEALHG++Y GPG+ F G +  ATSFPQ +L+AASF+
Sbjct  83   GYQWWSEALHGIAYAGPGIRFNGTIKRATSFPQVILSAASFD  124



>ref|XP_003615008.1| Xylan 1 4-beta-xylosidase [Medicago truncatula]
Length=798

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P Y+CDT  NP  KSLPFCN  L +  R  D+V RLTL EKI+ LVNTA ++ RLGIP+Y
Sbjct  34   PPYSCDTT-NPLTKSLPFCNLNLTITQRAKDIVSRLTLDEKISQLVNTAPSIPRLGIPSY  92

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLF  471
            +WW EALHG++  G G+   G V  ATSFPQ +LTAASF+  L+
Sbjct  93   QWWDEALHGVANAGKGIRLNGSVAGATSFPQVILTAASFDSKLW  136



>ref|XP_007035744.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
 gb|EOY06670.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
Length=776

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 79/119 (66%), Gaps = 3/119 (3%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            +I  V+S+  P +ACD  +N   +SL FC   L +  RV DL+ RLTL EKI  LVN A 
Sbjct  26   VISLVESR--PPFACDP-RNGLTRSLRFCRVNLPLHVRVRDLLGRLTLQEKIRLLVNNAA  82

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             V RLGI  YEWWSEALHG+S  GPG  F G VP ATSFPQ + TAASFNE+L+   G+
Sbjct  83   AVPRLGIQGYEWWSEALHGVSNVGPGAKFGGAVPGATSFPQVITTAASFNESLWEQIGR  141



>gb|KJB38535.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=774

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  89

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+   G+
Sbjct  90   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQ  138



>ref|XP_010914548.1| PREDICTED: probable beta-D-xylosidase 2 [Elaeis guineensis]
Length=772

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 75/116 (65%), Gaps = 3/116 (3%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P    T P +AC     P   +LPFC   L ++ RVADL+ RLTL EKI  LVN A  V 
Sbjct  20   PRGGATRPAFACG--GGPA-AALPFCRVALPIRARVADLIGRLTLDEKIRLLVNNAAGVP  76

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGI  YEWWSEALHG+S  GPGV+F G  P ATSFPQ + +AASFN TL+   GK
Sbjct  77   RLGIAGYEWWSEALHGVSDVGPGVHFGGAYPGATSFPQVISSAASFNATLWELIGK  132



>ref|XP_002306583.2| hypothetical protein POPTR_0005s16660g [Populus trichocarpa]
 gb|EEE93579.2| hypothetical protein POPTR_0005s16660g [Populus trichocarpa]
Length=773

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            T P ++CD+  NP  K+ PFC   L +  R  DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  24   TQPPFSCDS-SNPSTKTFPFCKTTLPISQRANDLVSRLTLEEKISQLVNSAQPIPRLGIP  82

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFN  459
             Y+WWSEALHG++Y GPG+ F G +  ATSFPQ +L+AASF+
Sbjct  83   GYQWWSEALHGVAYAGPGIRFNGTIKRATSFPQVILSAASFD  124



>gb|KEH28065.1| glycoside hydrolase family 3 amino-terminal domain protein [Medicago 
truncatula]
Length=601

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P Y+CDT  NP  K  PFCN  L +  R  D+V RLTL EK++ LVNTA  + RL IP+Y
Sbjct  34   PPYSCDT-SNPRTKLFPFCNLNLTITQRAKDIVSRLTLDEKVSQLVNTAPAIPRLDIPSY  92

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLF  471
            +WW+EALHG+SY G G+   G +PAATSFPQ +LTAASF+  L+
Sbjct  93   QWWNEALHGVSYVGMGIILNGSIPAATSFPQVILTAASFDPKLW  136



>ref|XP_011074159.1| PREDICTED: probable beta-D-xylosidase 7 [Sesamum indicum]
Length=792

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            +S  +P ++CD   NP  KSLPFCN +L + +R  DLV RLTL EK+  LVNTA  V RL
Sbjct  38   ESDHSPPFSCDP-SNPSTKSLPFCNTQLPISSRAKDLVSRLTLDEKVQQLVNTADAVPRL  96

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLF  471
             I  YEWWSEALHG+S  G GV F G V AAT FPQ +L AASF+  L+
Sbjct  97   NISAYEWWSEALHGVSRHGKGVTFNGTVTAATMFPQVILAAASFDSQLW  145



>gb|KJB16241.1| hypothetical protein B456_002G219100 [Gossypium raimondii]
Length=769

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            V S T P ++CD+  +P  K+ PFC   L V  R  DLV RLTL EKI+ LVN+A  + R
Sbjct  17   VASTTTPPFSCDS-SDPTTKNYPFCQSTLPVTQRARDLVSRLTLDEKISQLVNSAPAIPR  75

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFN  459
            LGIP YEWWSEALHG+S  GPG+ F G + AATSFPQ +L AASF+
Sbjct  76   LGIPAYEWWSEALHGVSNVGPGIKFDGTIKAATSFPQVILAAASFD  121



>ref|XP_002987446.1| hypothetical protein SELMODRAFT_426206 [Selaginella moellendorffii]
 gb|EFJ11533.1| hypothetical protein SELMODRAFT_426206 [Selaginella moellendorffii]
Length=772

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 74/107 (69%), Gaps = 2/107 (2%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            YACD   N  L + PFCN  L +  RV D V RLTL EKI+ L+NTA  + RLG+P Y+W
Sbjct  30   YACDQ-SNATLAAFPFCNTSLPITDRVEDYVARLTLEEKISQLINTATGIPRLGVPKYQW  88

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            W EALHG++ + PGV F G VPAATSFP P+ TAASFN +LF   G+
Sbjct  89   WQEALHGVA-SSPGVQFGGSVPAATSFPMPITTAASFNTSLFYGIGQ  134



>ref|XP_007225247.1| hypothetical protein PRUPE_ppa001675mg [Prunus persica]
 gb|EMJ26446.1| hypothetical protein PRUPE_ppa001675mg [Prunus persica]
Length=781

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 76/111 (68%), Gaps = 1/111 (1%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            T P YACD+ + P   S PFC   L +  RV DLV RLTL EKI+ LVN+A  + RL IP
Sbjct  29   TQPPYACDSSQ-PSTSSYPFCKTTLPINQRVQDLVSRLTLDEKISQLVNSAPPIPRLSIP  87

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            +YEWWSEALHG++  G G+N  G +  ATSFPQ +LTAASFNE L+   G+
Sbjct  88   SYEWWSEALHGVADVGKGINLYGTISNATSFPQVILTAASFNEHLWYRIGQ  138



>ref|NP_001266104.1| SlArf/Xyl1 protein precursor [Solanum lycopersicum]
 dbj|BAL44716.1| SlArf/Xyl1 [Solanum lycopersicum]
Length=771

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   N G+++L FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  25   FACDPA-NAGIRNLRFCKTSLPIHVRVQDLIARLTLQEKIRLLVNNAAPVQRLGISGYEW  83

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S TG GV F G  P ATSFPQ + TAASFN +L+   G+
Sbjct  84   WSEALHGVSNTGYGVKFGGAFPGATSFPQVITTAASFNASLWEEIGR  130



>ref|XP_002527511.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF34909.1| Beta-glucosidase, putative [Ricinus communis]
Length=810

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            +I P+ SQ    +ACD   +P      FCN  L  + R  DL+ RLTL EK+  +VN A 
Sbjct  16   VIFPIASQN---FACDK-NSPQTNDYSFCNTSLSYQDRAKDLISRLTLQEKVQQVVNHAA  71

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             + RLGIP YEWWSEALHG+S  G GV F G VP ATSFP  +L+AASFNETL+   G+
Sbjct  72   GIPRLGIPAYEWWSEALHGVSNVGFGVRFNGTVPGATSFPAMILSAASFNETLWLKMGQ  130



>gb|KJB59941.1| hypothetical protein B456_009G282000 [Gossypium raimondii]
Length=590

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            T P +ACD+  NP  K+  FC   L +  R  DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  21   TQPPFACDS-SNPETKNYLFCQTELPITQRARDLVSRLTLDEKISQLVNSAPAIPRLGIP  79

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFN  459
             YEWWSEALHG+S  GPGV F G + AATSFPQ +LTAASF+
Sbjct  80   AYEWWSEALHGVSNVGPGVKFDGTIKAATSFPQVILTAASFD  121



>ref|XP_003592512.1| Xylosidase [Medicago truncatula]
 gb|AES62763.1| beta-D-xylosidase-like protein [Medicago truncatula]
Length=781

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 77/119 (65%), Gaps = 4/119 (3%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
             I P+ SQ    +ACD   +P   + PFCN  L  +TR  DLV RLTL EK   LVN + 
Sbjct  15   FILPITSQK---HACDK-GSPKTSNFPFCNTSLSYETRAKDLVSRLTLQEKAQQLVNPST  70

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             +SRLG+P YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AASFNETL+   G+
Sbjct  71   GISRLGVPAYEWWSEALHGVSNVGPGTRFDSRVPGATSFPAVILSAASFNETLWYTMGQ  129



>ref|XP_007145157.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
 gb|ESW17151.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
Length=767

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN    SLPFC   L +  RV DL+ RLT+ EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNAATSSLPFCKASLAIAERVKDLIGRLTMEEKVGLLVNNAAAVPRLGIKGYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+   G+
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGR  132



>ref|XP_009757165.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana sylvestris]
Length=770

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 74/115 (64%), Gaps = 1/115 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            +  Q  P +ACD  ++   K+ PFC   L +  RV DL+ RLTL EK+  L NTA  VSR
Sbjct  22   ISVQARPPFACDP-RDRATKNFPFCQTNLAIGDRVRDLIGRLTLQEKVKLLGNTAAAVSR  80

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+   G+
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVISTAASFNASLWEEIGR  135



>ref|XP_010676938.1| PREDICTED: probable beta-D-xylosidase 7 [Beta vulgaris subsp. 
vulgaris]
Length=778

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 1/111 (1%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            T P +ACD+  NP  K   FC   L ++ R  DL+ RLTL EK++ LVNTA ++ RLGIP
Sbjct  27   TEPPFACDS-SNPNTKHYTFCRADLPIRKRAKDLIARLTLDEKVSQLVNTAPSIPRLGIP  85

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             YEWWSEALHG++  GPGV+  G + AATSFPQ +LTAASF+  L+   G+
Sbjct  86   AYEWWSEALHGVADAGPGVSLYGTIRAATSFPQVILTAASFDVRLWYRIGQ  136



>gb|KHN08645.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=749

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  28   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+   G+
Sbjct  87   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGR  133



>ref|XP_011100796.1| PREDICTED: beta-D-xylosidase 1 [Sesamum indicum]
Length=770

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   N    +LPFC+  L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDPT-NHITTTLPFCSVSLHIRDRVKDLIGRLTLQEKIRLLVNNAAPVDRLGIRGYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S TGPGV F G  P ATSFPQ + TAASFN +L+   G+
Sbjct  87   WSEALHGVSNTGPGVKFGGQFPGATSFPQVITTAASFNSSLWEAIGQ  133



>ref|XP_003535953.1| PREDICTED: probable beta-D-xylosidase 2 [Glycine max]
Length=771

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+   G+
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGR  132



>ref|NP_001266114.1| SlArf/Xyl4 protein precursor [Solanum lycopersicum]
 dbj|BAL44719.1| SlArf/Xyl4 [Solanum lycopersicum]
Length=775

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 81/119 (68%), Gaps = 2/119 (2%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
            ++  VQS T P ++CD+  NP  KSL FC   L +  RV DLV RLTL EKI+ LVN+A 
Sbjct  18   LVSIVQS-TQPPFSCDS-SNPQTKSLKFCQTGLPISVRVLDLVSRLTLDEKISQLVNSAP  75

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             + RLGIP YEWWSE+LHG+   G G+ F G +  ATSFPQ +LTAA+F+E L+   G+
Sbjct  76   AIPRLGIPAYEWWSESLHGVGSAGKGIFFNGSIAGATSFPQVILTAATFDENLWYRIGQ  134



>gb|KHG14371.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=772

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +++ P +ACD  +N   +SL FC   L +  R  DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   AESRPPFACDP-RNGLTRSLKFCRANLPIHVRARDLIGRLTLAEKIRLLVNNAAAVPRLG  83

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+   G+
Sbjct  84   IQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWEQIGR  136



>ref|XP_010457247.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACDT K+    +L FC   + ++ RV DL+ RLTLPEK++ L NTA  + RLGI  YEW
Sbjct  31   FACDT-KDAATATLRFCQLSVPIQERVKDLIGRLTLPEKVSLLGNTAAAIPRLGIKGYEW  89

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+   G+
Sbjct  90   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGR  136



>emb|CDY00033.1| BnaC09g02680D [Brassica napus]
Length=788

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P++ACD+  N   ++L FC   + V+ RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDSA-NELTRTLRFCQVNIPVRMRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+   G+
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGR  156



>gb|ACD93208.1| beta xylosidase [Camellia sinensis]
Length=767

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 74/113 (65%), Gaps = 4/113 (4%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            S++ P +ACD       ++LPFC   L ++ RV DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   SESRPAFACDGAT----RNLPFCRVSLPIQDRVRDLIGRLTLQEKIRLLVNNAAAVPRLG  80

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            I  YEWWSEALHG+S   PGV F G  P ATSFPQ + TAASFN +L+   G+
Sbjct  81   IKGYEWWSEALHGVSNADPGVKFGGAFPGATSFPQVISTAASFNASLWEHIGR  133



>ref|XP_006301942.1| hypothetical protein CARUB_v10022420mg [Capsella rubella]
 gb|EOA34840.1| hypothetical protein CARUB_v10022420mg [Capsella rubella]
Length=767

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD   NP  K   FC   L +  R  DLV RLT+ EKI+ LVNTA  + RLG+P Y
Sbjct  22   PPHACDP-SNPATKLYQFCRTDLQISNRAHDLVSRLTVDEKISQLVNTAPGIPRLGVPAY  80

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFN  459
            EWWSEALHG++YTGPG  F G V AATSFPQ +LTAASF+
Sbjct  81   EWWSEALHGIAYTGPGTWFNGTVKAATSFPQVILTAASFD  120



>gb|AFU54452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 78/126 (62%), Gaps = 3/126 (2%)
 Frame = +1

Query  133  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK*F  492
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+   G+  
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  493  PPRPEA  510
            P    A
Sbjct  140  PDEARA  145



>gb|AFU54451.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 78/126 (62%), Gaps = 3/126 (2%)
 Frame = +1

Query  133  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK*F  492
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+   G+  
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRGV  139

Query  493  PPRPEA  510
            P    A
Sbjct  140  PDEARA  145



>ref|XP_004513829.1| PREDICTED: probable beta-D-xylosidase 7-like [Cicer arietinum]
Length=781

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            +S T P Y+CD + NP  KS  FCN +L +  R  D+V RLTL EK+  LVNTA ++ RL
Sbjct  26   ESPTQPPYSCD-ISNPLTKSYAFCNLKLPIIERAKDIVSRLTLDEKLAQLVNTAPSIPRL  84

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLF  471
            GIP+Y+WWSEALHG++  G G+   G + AATSFPQ +LTAASF+  L+
Sbjct  85   GIPSYQWWSEALHGVANAGKGIRLNGTIKAATSFPQVILTAASFDSKLW  133



>ref|XP_010259348.1| PREDICTED: putative beta-D-xylosidase [Nelumbo nucifera]
Length=775

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 74/119 (62%), Gaps = 1/119 (1%)
 Frame = +1

Query  130  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  309
             + P      P +ACD  +N   ++LPFC   L +  RV DL+ RLTL EKI  LVN A 
Sbjct  21   FVSPRTGDARPAFACDP-RNGLTRNLPFCRPSLPIPNRVRDLIGRLTLQEKIRLLVNNAA  79

Query  310  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+   G+
Sbjct  80   PVPRLGIRGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNASLWEQIGR  138



>gb|AES97964.2| glycoside hydrolase family 3 amino-terminal domain protein [Medicago 
truncatula]
Length=791

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P Y+CDT  NP  K  PFCN  L +  R  D+V RLTL EK++ LVNTA  + RL IP+Y
Sbjct  34   PPYSCDT-SNPRTKLFPFCNLNLTITQRAKDIVSRLTLDEKVSQLVNTAPAIPRLDIPSY  92

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLF  471
            +WW+EALHG+SY G G+   G +PAATSFPQ +LTAASF+  L+
Sbjct  93   QWWNEALHGVSYVGMGIILNGSIPAATSFPQVILTAASFDPKLW  136



>ref|XP_009111875.1| PREDICTED: beta-D-xylosidase 1-like [Brassica rapa]
Length=787

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P++ACD   N   ++L FC   L V+ RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDPA-NELTRTLRFCQVNLPVRVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+   G+
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGR  156



>gb|AAS17751.2| beta xylosidase [Fragaria x ananassa]
Length=772

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  +NP  +   FC  R+ V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  30   PPFACDP-RNPLTRGFKFCRTRVPVHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQGY  88

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+   G+
Sbjct  89   EWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNQSLWQEIGQ  137



>emb|CDY15255.1| BnaC05g01340D [Brassica napus]
Length=762

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  16   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  74

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+   G+
Sbjct  75   LGIKGYEWWSEALHGVSNVGPGTKFGGTFPAATSFPQVITTAASFNASLWESIGR  129



>ref|XP_006826952.1| hypothetical protein AMTR_s00010p00188970 [Amborella trichopoda]
 gb|ERM94189.1| hypothetical protein AMTR_s00010p00188970 [Amborella trichopoda]
Length=778

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +1

Query  157  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  336
            +P +ACD   NP   S  FC   L +  RV DL+  LTL EK++ LVNTA  +SRLGIP+
Sbjct  26   SPPFACDQ-SNPSTSSFKFCTTSLSINERVWDLISHLTLEEKVSQLVNTAPAISRLGIPS  84

Query  337  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            Y+WWSE+LHG+S  GPG+ F G + +ATSFPQ +LTA+SFN  ++   G+
Sbjct  85   YQWWSESLHGVSNIGPGIRFNGTIRSATSFPQVILTASSFNREIWYQIGQ  134



>gb|KHG13360.1| putative beta-D-xylosidase 7 -like protein [Gossypium arboreum]
Length=769

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            T P +ACD+  NP  K+  FC   L +  R  DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  21   TQPPFACDS-SNPETKNYLFCQTELPITQRARDLVSRLTLDEKISQLVNSAPAIPRLGIP  79

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFN  459
             YEWWSEALHG+S  GPGV F G + AATSFPQ +LTAASF+
Sbjct  80   AYEWWSEALHGVSNVGPGVRFDGTIKAATSFPQVILTAASFD  121



>ref|XP_002519194.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF43058.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=782

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  +N   ++L FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  42   FACDP-RNGVTRNLKFCRANLPIHVRVRDLISRLTLQEKIRLLVNNAAAVPRLGIQGYEW  100

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPGV F G  P ATSFPQ + TAASFN++L+   G+
Sbjct  101  WSEALHGVSNVGPGVKFGGAFPGATSFPQVITTAASFNQSLWEQIGR  147



>gb|KCW68842.1| hypothetical protein EUGRSUZ_F02442 [Eucalyptus grandis]
Length=729

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P  S   P ++CD    P   S PFCN  L +  R  DLV RLTL EKI+ LV++A  + 
Sbjct  25   PATSAQPPPFSCDP-SGPSTTSFPFCNASLPISQRAQDLVYRLTLDEKISQLVSSAPTIP  83

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIP YEWWSE+LHG+S +GPG+ F G + +ATSFPQ +LTAASF+  L+   G+
Sbjct  84   RLGIPAYEWWSESLHGVSESGPGIRFNGTIRSATSFPQVILTAASFDANLWYRIGQ  139



>ref|XP_004295104.1| PREDICTED: putative beta-D-xylosidase [Fragaria vesca subsp. 
vesca]
Length=772

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  +NP  +   FC  R+ V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  30   PPFACDP-RNPLTRGFKFCRTRVPVHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQGY  88

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+   G+
Sbjct  89   EWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNQSLWQEIGQ  137



>emb|CDP17081.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  ++   K   FC   L +  RV+DL+ RLTL EK+  LVN A  V+RLGI  Y
Sbjct  96   PAFACD-ARDARTKGWGFCGTNLGIAERVSDLIGRLTLQEKVRLLVNNAAEVARLGIKGY  154

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+S  GPG  F G  PAATSFPQ + TAA+FN +L+   G+
Sbjct  155  EWWSEALHGVSNVGPGTKFGGEFPAATSFPQVITTAAAFNASLWEEIGR  203



>ref|XP_002885319.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61578.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
Length=865

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   +P      FCN  L  + R  DLV RL+L EK+  LVN A  VSRLG+P YEW
Sbjct  27   FACDR-NDPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNKATGVSRLGVPPYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+   G+
Sbjct  86   WSEALHGVSDVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGE  132



>gb|KJB59940.1| hypothetical protein B456_009G282000 [Gossypium raimondii]
Length=769

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            T P +ACD+  NP  K+  FC   L +  R  DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  21   TQPPFACDS-SNPETKNYLFCQTELPITQRARDLVSRLTLDEKISQLVNSAPAIPRLGIP  79

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFN  459
             YEWWSEALHG+S  GPGV F G + AATSFPQ +LTAASF+
Sbjct  80   AYEWWSEALHGVSNVGPGVKFDGTIKAATSFPQVILTAASFD  121



>ref|XP_006354009.1| PREDICTED: probable beta-D-xylosidase 7-like [Solanum tuberosum]
Length=775

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%), Gaps = 1/111 (1%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            T P ++CD+  NP  KSL FC   L +  RV DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  25   TQPPFSCDS-SNPQTKSLKFCQTGLPISVRVQDLVSRLTLDEKISQLVNSAPAIPRLGIP  83

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
             YEWWSE+LHG+   G G+ F G +  ATSFPQ +LTAA+F+E L+   G+
Sbjct  84   AYEWWSESLHGVGSAGKGIFFNGSIAGATSFPQVILTAATFDENLWYRIGQ  134



>gb|KDO87029.1| hypothetical protein CISIN_1g0041902mg, partial [Citrus sinensis]
Length=133

 Score =   114 bits (286),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K+   ++LPFC   L +  RV DL+ RL+L EK+  L++ A  V RLGI  YEW
Sbjct  28   FACDP-KDATTRTLPFCQVSLPIPQRVNDLIGRLSLQEKVKLLISGAAAVPRLGIKGYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G  P ATSFPQ + TA+SFN TL+   G+
Sbjct  87   WSEALHGVSNVGPGTKFGGDFPGATSFPQVITTASSFNATLWEAIGR  133



>ref|XP_002320310.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
 gb|EEE98625.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
Length=765

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  K+   + LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTTRDLPFCQVKLPIQTRVNDLIGRMTLQEKVGLLVNNAAAVPRLGIKGYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FN TL+   G+
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAAAFNATLWEAIGQ  132



>ref|XP_004300463.1| PREDICTED: probable beta-D-xylosidase 2 [Fragaria vesca subsp. 
vesca]
Length=790

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            QS T+  +AC+   +   K LPFC  +L +  RV DL+ RLTL EK+  LVN+A  V RL
Sbjct  28   QSPTSSSFACNP-NDASTKDLPFCRVKLPIHVRVRDLIGRLTLQEKVKLLVNSAKAVPRL  86

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            GI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+   G+
Sbjct  87   GIKDYEWWSEALHGVSNVGPGTKFGGEFPGATSFPQVITTAASFNASLWEAIGQ  140



>gb|KHN43468.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=867

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  113  FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  171

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+   G+
Sbjct  172  WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGQ  218


 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN G K + FC   L +  RV DL+ RLTL EK+  LVN A  V RLG+  YEW
Sbjct  27   FACDP-KNGGTKKMAFCKVSLAIAERVKDLIGRLTLEEKVRLLVNNAAAVPRLGMKGYEW  85

Query  346  WSEALHGLSYTGPGV  390
            WSEALHG+S  GP +
Sbjct  86   WSEALHGVSNLGPAL  100



>ref|XP_010064766.1| PREDICTED: probable beta-D-xylosidase 7 [Eucalyptus grandis]
Length=781

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 77/116 (66%), Gaps = 1/116 (1%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P  S   P ++CD    P   S PFCN  L +  R  DLV RLTL EKI+ LV++A  + 
Sbjct  25   PATSAQPPPFSCDP-SGPSTTSFPFCNASLPISQRAQDLVYRLTLDEKISQLVSSAPTIP  83

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGIP YEWWSE+LHG+S +GPG+ F G + +ATSFPQ +LTAASF+  L+   G+
Sbjct  84   RLGIPAYEWWSESLHGVSESGPGIRFNGTIRSATSFPQVILTAASFDANLWYRIGQ  139



>ref|XP_009369955.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  +NP  ++L FC  R  +  RV DL+ RLTL EKI  LVN A +V RLGI  YEW
Sbjct  33   FACDP-RNPITRTLKFCRVRASIHVRVQDLIGRLTLQEKIRLLVNNAIDVPRLGIQGYEW  91

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+   G+
Sbjct  92   WSEALHGVSNVGPGTKFGGAFLGATSFPQVITTAASFNESLWEEIGR  138



>ref|XP_010113184.1| putative beta-D-xylosidase 5 [Morus notabilis]
 gb|EXC72717.1| putative beta-D-xylosidase 5 [Morus notabilis]
Length=293

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 74/118 (63%), Gaps = 3/118 (3%)
 Frame = +1

Query  133  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
            I P+ +Q    +ACD    P     PFC+  L    R  D++ RLTL EK+  LV+ +  
Sbjct  20   ILPIATQK---HACDVTSFPQASQFPFCDTSLSYDIRAKDIISRLTLQEKVQQLVSGSAG  76

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            +SRLG+P+YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AA+FN +L+   G+
Sbjct  77   ISRLGVPSYEWWSEALHGVSNVGPGTTFNATVPGATSFPAVILSAAAFNASLWYKMGQ  134



>ref|XP_011082425.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=791

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 73/116 (63%), Gaps = 1/116 (1%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P  S TA  +ACD   +   K+L FC   L VK RV DL+ RL L EK+  LVN A  V 
Sbjct  35   PAISATAQPFACDPADST-TKTLSFCRTDLSVKDRVKDLMGRLRLQEKVKLLVNNAAGVP  93

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+   GK
Sbjct  94   RLGIRGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTAASFNASLWEEIGK  149



>gb|KJB72795.1| hypothetical protein B456_011G198200 [Gossypium raimondii]
Length=772

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +++ P +ACD  +N   +SL FC   L +  R  DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   AESRPPFACDP-RNGLTRSLKFCRANLPIHVRARDLIGRLTLAEKIRLLVNNAAAVPRLG  83

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + +AASFNE+L+   G+
Sbjct  84   IQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITSAASFNESLWEQIGR  136



>ref|XP_008386729.1| PREDICTED: probable beta-D-xylosidase 2 [Malus domestica]
Length=788

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 75/116 (65%), Gaps = 1/116 (1%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P   +    +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V 
Sbjct  28   PKTCEGGESFACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVP  86

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGI  YEWWSEALHG+S  GPG  F GV P ATSFPQ + TAASFN +L+   G+
Sbjct  87   RLGIKGYEWWSEALHGVSNVGPGTKFGGVFPGATSFPQVITTAASFNASLWEAIGR  142



>gb|KFK42187.1| hypothetical protein AALP_AA2G222800 [Arabis alpina]
Length=777

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 72/103 (70%), Gaps = 1/103 (1%)
 Frame = +1

Query  151  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  330
             +AP +ACD+  NP  K   FC   + +  R  DLV RLT+ EKI+ LVNTA  + RLGI
Sbjct  20   DSAPPHACDS-SNPTTKLFLFCRTDISINRRAKDLVSRLTVDEKISQLVNTAPGIPRLGI  78

Query  331  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFN  459
            P YEWWSEALHG++  GPG+ F G V AATSFPQ +LTAASF+
Sbjct  79   PAYEWWSEALHGVAGVGPGIRFNGTVHAATSFPQVILTAASFD  121



>ref|XP_008223305.1| PREDICTED: putative beta-D-xylosidase [Prunus mume]
Length=775

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 76/118 (64%), Gaps = 3/118 (3%)
 Frame = +1

Query  133  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+   G+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGR  137



>ref|XP_008341125.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  +NP  + L FC  R+ +  RV DL+ RLTL EKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNPITRXLKFCRVRVPIXDRVHDLIGRLTLQEKIRLLVNNAIDVPRLGIQGY  89

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+   G+
Sbjct  90   EWWSEALHGVSNVGPGTKFGGTFLGATSFPQVITTAASFNESLWEEIGR  138



>ref|XP_007225668.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
 gb|EMJ26867.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
Length=775

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 76/118 (64%), Gaps = 3/118 (3%)
 Frame = +1

Query  133  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  312
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  313  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+   G+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGR  137



>ref|XP_008390557.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 73/109 (67%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  +NP  + L FC  R+ +  RV DL+ RLTL EKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNPITRXLKFCRVRVPIXDRVHDLIGRLTLQEKIRLLVNNAIDVPRLGIQGY  89

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+   G+
Sbjct  90   EWWSEALHGVSNVGPGTKFGGTFLGATSFPQVITTAASFNESLWEEIGR  138



>ref|XP_009339788.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=788

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V RLGI  YEW
Sbjct  37   FACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVPRLGIKGYEW  95

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F GV P ATSFPQ + TAASFN +L+   G+
Sbjct  96   WSEALHGVSNVGPGTKFGGVFPGATSFPQVITTAASFNASLWEAIGR  142



>emb|CDX89954.1| BnaA10g01280D [Brassica napus]
Length=767

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  21   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  79

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+   G+
Sbjct  80   LGIKGYEWWSEALHGVSNVGPGTKFAGPFPAATSFPQVITTAASFNASLWESIGR  134



>ref|XP_007042636.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOX98467.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=852

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD   +P     PFC+  L  + R  DLV  LTL EK+  LVNTA  +SRLG+P YEW
Sbjct  85   FACDK-NDPNTSQFPFCDYALSYEDRAKDLVSHLTLQEKVQQLVNTASGISRLGVPAYEW  143

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F   VP ATSFP  +L+AASFN TL+   G+
Sbjct  144  WSEALHGVSDLGPGTRFNATVPGATSFPAVILSAASFNATLWFKMGQ  190



>ref|XP_009593976.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana tomentosiformis]
Length=773

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            +  Q  P +ACD  ++   K+ PFC   L +  RV DLV RLTL EK+  L NTA  V R
Sbjct  22   ISVQARPPFACDP-RDRATKNFPFCQTNLAIGDRVRDLVGRLTLQEKVKLLGNTAAAVPR  80

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+   G+
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTAASFNASLWEEIGR  135



>ref|XP_010269208.1| PREDICTED: probable beta-D-xylosidase 7 [Nelumbo nucifera]
Length=823

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 74/106 (70%), Gaps = 1/106 (1%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            T P +ACD+ KNP   S  FCN  L +  RV DLV RLTL EKI+ LVN A  + RLGIP
Sbjct  67   TQPPFACDS-KNPATASYTFCNPSLPIPQRVKDLVSRLTLDEKISQLVNNAPAIPRLGIP  125

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLF  471
            +YEWWSEALHG++  G G+   G++  ATSFPQ +L+AASF+  L+
Sbjct  126  SYEWWSEALHGVTSAGRGIQLNGIIKGATSFPQVILSAASFDAHLW  171



>ref|XP_009119616.1| PREDICTED: probable beta-D-xylosidase 2 [Brassica rapa]
Length=767

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 75/115 (65%), Gaps = 1/115 (1%)
 Frame = +1

Query  142  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  321
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  21   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  79

Query  322  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+   G+
Sbjct  80   LGIKGYEWWSEALHGVSNVGPGTKFAGPFPAATSFPQVITTAASFNASLWESIGR  134



>ref|XP_011042236.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            S+    +ACD  ++   ++ PFC  +L +++RV DL+ R+TL EK+  LVN A  V RLG
Sbjct  21   SEALDAFACDP-EDGTSRNFPFCQVKLPIQSRVGDLIGRMTLQEKVGLLVNDAAAVPRLG  79

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            I  YEWWSEALHG+S  GPG  F GV P ATSFPQ + T+ASFN TL+   G+
Sbjct  80   IKGYEWWSEALHGVSNVGPGTQFGGVFPGATSFPQVITTSASFNATLWEAIGQ  132



>ref|XP_008808663.1| PREDICTED: beta-D-xylosidase 1-like [Phoenix dactylifera]
Length=772

 Score =   122 bits (305),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 64/116 (55%), Positives = 74/116 (64%), Gaps = 3/116 (3%)
 Frame = +1

Query  139  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  318
            P  +   P +AC      GL   PFC   L ++ RVADL+ RLTL EKI  LVN A  V 
Sbjct  20   PGGAAARPAFACGGGPAVGL---PFCRAALPIRARVADLIGRLTLDEKIRLLVNNAAGVP  76

Query  319  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            RLGI  YEWWSEALHG+S  GPGV+F G  P ATSFPQ + +AASFN TL+   GK
Sbjct  77   RLGIGGYEWWSEALHGVSNVGPGVHFGGAYPGATSFPQVISSAASFNATLWELIGK  132



>ref|XP_011020382.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=768

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDA-KNGLTRSLKFCRVNVPLHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  86

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F+G  P ATSFPQ + TAASFN++L+   G+
Sbjct  87   WSEALHGVSNVGPGTKFSGAFPGATSFPQVITTAASFNKSLWEEIGR  133



>ref|XP_006352077.1| PREDICTED: beta-D-xylosidase 1-like [Solanum tuberosum]
Length=773

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 75/114 (66%), Gaps = 2/114 (2%)
 Frame = +1

Query  145  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  324
            +S+  P +ACD   N G ++L FC   L +  RV DL+ RLTL EKI  LVN A  V RL
Sbjct  19   ESRRQP-FACDPA-NAGTRNLRFCKTSLPIHVRVQDLIGRLTLQEKIRLLVNNAAPVERL  76

Query  325  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            G+  YEWWSEALHG+S TG GV F G  P ATSFPQ + TAASFN +L+   G+
Sbjct  77   GVSGYEWWSEALHGVSNTGYGVKFGGAFPGATSFPQVITTAASFNASLWEEIGR  130



>dbj|BAF00595.1| xylosidase [Arabidopsis thaliana]
Length=303

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 72/109 (66%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P++ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRANVPIHVRVQDLLGRLTLQEKIRNLVNNAAAVPRLGIGGY  91

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+   G+
Sbjct  92   EWWSEALHGISDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGR  140



>gb|AAF17692.1|AC009243_19 F28K19.27 [Arabidopsis thaliana]
Length=696

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P ++CD   NP  K   FC   L +  R  DLV RLT+ EKI+ LVNTA  + RLG+P Y
Sbjct  22   PPHSCDP-SNPTTKLYQFCRTDLPIGKRARDLVSRLTIDEKISQLVNTAPGIPRLGVPAY  80

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFN  459
            EWWSEALHG++Y GPG+ F G V AATSFPQ +LTAASF+
Sbjct  81   EWWSEALHGVAYAGPGIRFNGTVKAATSFPQVILTAASFD  120



>ref|XP_010534139.1| PREDICTED: probable beta-D-xylosidase 7 [Tarenaya hassleriana]
Length=140

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 69/104 (66%), Gaps = 1/104 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +AC    +P  K+  FC   + +  R  DLV RLTL EKI+ LVN+A  + RLGIP Y
Sbjct  26   PPHACHP-SDPSTKTFQFCRTDIPISRRAGDLVSRLTLDEKISQLVNSAEAIPRLGIPAY  84

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLF  471
            EWWSEALHG++  G G+   G V AATSFPQ +LTAASF+  L+
Sbjct  85   EWWSEALHGVADAGKGIRLNGTVSAATSFPQVILTAASFDSYLW  128



>ref|XP_010481135.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACDT K+    +L FC   + ++ RV DL+ RLTL EK++ L NTA  + RLGI  YEW
Sbjct  31   FACDT-KDAATATLRFCQLSVAIQERVKDLIGRLTLAEKVSLLGNTAAAIPRLGIKGYEW  89

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+   G+
Sbjct  90   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGR  136



>ref|XP_002302285.1| glycosyl hydrolase family 3 family protein [Populus trichocarpa]
 gb|EEE81558.1| glycosyl hydrolase family 3 family protein [Populus trichocarpa]
Length=773

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 72/102 (71%), Gaps = 1/102 (1%)
 Frame = +1

Query  154  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  333
            T P ++CD+  NP  K+ PFC   L +  R  DLV RLTL EKI+ LVN+A  + RLGIP
Sbjct  24   TQPPFSCDS-SNPSTKAFPFCETTLPISQRARDLVSRLTLDEKISQLVNSAPPIPRLGIP  82

Query  334  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFN  459
             YEWWSEALHG+S  GPG++F   +  ATSFPQ +LTAASF+
Sbjct  83   GYEWWSEALHGVSNAGPGIHFNDNIKGATSFPQVILTAASFD  124



>ref|XP_008384517.1| PREDICTED: probable beta-D-xylosidase 5 [Malus domestica]
Length=802

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  +       PFCN  L  +TR  DLV RLTL EK+  LV+ +  ++RLG+P YEW
Sbjct  32   FACDN-RASATSQFPFCNTSLPYETRAKDLVSRLTLQEKVIQLVDKSTGIARLGVPAYEW  90

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG +F G VP ATSFP  +L+AASFN++L+   G+
Sbjct  91   WSEALHGVSNVGPGTSFNGTVPGATSFPAVILSAASFNQSLWLKMGQ  137



>ref|XP_002302758.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
 gb|EEE82031.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
Length=770

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  ++   ++ PFC  +L +++RV+DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-EDGTSRNFPFCQVKLPIQSRVSDLIGRMTLQEKVGLLVNDAAAVPRLGIKGYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+   G+
Sbjct  86   WSEALHGVSNVGPGTQFGGAFPGATSFPQVITTAASFNATLWEAIGR  132



>gb|KHG05051.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=776

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q    +ACD+ K+    SLPFC   + +  RV DL+ RLT+ EK+  LVN A  V RLG
Sbjct  28   AQARDPFACDS-KDAKTSSLPFCKVSMPIPNRVTDLLGRLTMQEKVRLLVNNAAAVPRLG  86

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+   G+
Sbjct  87   IKGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVISTAASFNATLWEAIGR  139



>ref|NP_177929.1| putative beta-D-xylosidase 7 [Arabidopsis thaliana]
 sp|Q9SGZ5.2|BXL7_ARATH RecName: Full=Probable beta-D-xylosidase 7; Short=AtBXL7; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL57631.1| At1g78060/F28K19_32 [Arabidopsis thaliana]
 gb|AEE36063.1| putative beta-D-xylosidase 7 [Arabidopsis thaliana]
Length=767

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P ++CD   NP  K   FC   L +  R  DLV RLT+ EKI+ LVNTA  + RLG+P Y
Sbjct  22   PPHSCDP-SNPTTKLYQFCRTDLPIGKRARDLVSRLTIDEKISQLVNTAPGIPRLGVPAY  80

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFN  459
            EWWSEALHG++Y GPG+ F G V AATSFPQ +LTAASF+
Sbjct  81   EWWSEALHGVAYAGPGIRFNGTVKAATSFPQVILTAASFD  120



>ref|XP_003594795.1| Beta xylosidase [Medicago truncatula]
 gb|AES65046.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=762

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +1

Query  166  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  345
            +ACD  KN   +S  FCN R+ +  RV DL+ RL LPEKI  +VN A  V RLGI  YEW
Sbjct  27   FACDP-KNGLTRSYKFCNTRVPIHARVQDLIGRLALPEKIRLVVNNAIAVPRLGIQGYEW  85

Query  346  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            WSEALHG+S  GPG  F G   AATSFPQ + TAASFN++L+   G+
Sbjct  86   WSEALHGVSNVGPGTKFGGAFSAATSFPQVITTAASFNQSLWLEIGR  132



>gb|KJB09457.1| hypothetical protein B456_001G143600 [Gossypium raimondii]
Length=797

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = +1

Query  148  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  327
            +Q    +ACD+ K+    SLPFC   + +  RV DL+ RLT+ EK+  LVN A  V RLG
Sbjct  49   AQARDPFACDS-KDAKTSSLPFCKVSMPIPNRVTDLLGRLTMQEKVRLLVNNAAAVPRLG  107

Query  328  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+   G+
Sbjct  108  IKGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNATLWEAIGR  160



>ref|NP_001266107.1| SlArf/Xyl2 protein precursor [Solanum lycopersicum]
 dbj|BAL44717.1| SlArf/Xyl2 [Solanum lycopersicum]
Length=774

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = +1

Query  160  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  339
            P +ACD  KN   ++ PFC   L +  RV DL+ RLTL EK+  L N A  V RLGI  Y
Sbjct  29   PPFACDQ-KNRAFRNFPFCQTNLPIGDRVRDLIGRLTLQEKVKLLGNNAAAVPRLGIKGY  87

Query  340  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFTPSGK  486
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+   G+
Sbjct  88   EWWSEALHGVSNVGPGTKFGGEFPGATSFPQVITTAASFNASLWEEIGR  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000