BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF048P20

Length=478
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAA65634.1|  PS60                                                   189   1e-53   Nicotiana tabacum [American tobacco]
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             189   1e-53   Nicotiana tomentosiformis
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             188   1e-53   Nicotiana sylvestris
ref|XP_008452926.1|  PREDICTED: L-ascorbate oxidase homolog             185   2e-52   Cucumis melo [Oriental melon]
ref|XP_004145593.1|  PREDICTED: L-ascorbate oxidase homolog             185   3e-52   
ref|XP_004157080.1|  PREDICTED: L-ascorbate oxidase homolog             185   3e-52   
gb|KGN55480.1|  hypothetical protein Csa_4G653410                       183   4e-52   Cucumis sativus [cucumbers]
ref|XP_010667351.1|  PREDICTED: L-ascorbate oxidase homolog             183   1e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004142986.1|  PREDICTED: L-ascorbate oxidase homolog             183   2e-51   Cucumis sativus [cucumbers]
ref|XP_010101299.1|  L-ascorbate oxidase-like protein                   183   2e-51   Morus notabilis
ref|XP_008445302.1|  PREDICTED: L-ascorbate oxidase homolog             183   2e-51   Cucumis melo [Oriental melon]
ref|XP_006435292.1|  hypothetical protein CICLE_v10000783mg             180   4e-51   
ref|XP_007160607.1|  hypothetical protein PHAVU_001G001500g             182   4e-51   Phaseolus vulgaris [French bean]
ref|XP_009334388.1|  PREDICTED: L-ascorbate oxidase homolog             181   7e-51   Pyrus x bretschneideri [bai li]
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog             181   9e-51   Malus domestica [apple tree]
ref|XP_006435293.1|  hypothetical protein CICLE_v10000783mg             181   1e-50   Citrus clementina [clementine]
ref|XP_002510630.1|  multicopper oxidase, putative                      181   1e-50   Ricinus communis
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog             181   1e-50   Glycine max [soybeans]
ref|XP_007221787.1|  hypothetical protein PRUPE_ppa003860mg             181   1e-50   Prunus persica
ref|XP_007017957.1|  SKU5 similar 5 isoform 3                           178   2e-50   
ref|XP_007136137.1|  hypothetical protein PHAVU_009G021000g             180   2e-50   Phaseolus vulgaris [French bean]
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog             180   2e-50   Glycine max [soybeans]
ref|XP_004500896.1|  PREDICTED: L-ascorbate oxidase homolog             180   3e-50   Cicer arietinum [garbanzo]
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog             180   3e-50   Tarenaya hassleriana [spider flower]
gb|KJB58003.1|  hypothetical protein B456_009G189900                    178   3e-50   Gossypium raimondii
gb|KHN33820.1|  L-ascorbate oxidase like                                179   3e-50   Glycine soja [wild soybean]
gb|KEH40258.1|  multi-copper oxidase-like protein                       179   3e-50   Medicago truncatula
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog             179   3e-50   Glycine max [soybeans]
ref|XP_007017956.1|  SKU5 similar 5 isoform 2                           178   3e-50   
emb|CAB08077.1|  pectinesterase                                         179   4e-50   Solanum lycopersicum
gb|KJB58004.1|  hypothetical protein B456_009G189900                    178   4e-50   Gossypium raimondii
ref|XP_003539859.1|  PREDICTED: L-ascorbate oxidase homolog             179   4e-50   Glycine max [soybeans]
ref|XP_006390228.1|  hypothetical protein EUTSA_v10018373mg             179   4e-50   
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             179   5e-50   Sesamum indicum [beniseed]
gb|KHN21220.1|  L-ascorbate oxidase like                                179   5e-50   Glycine soja [wild soybean]
ref|XP_008221175.1|  PREDICTED: L-ascorbate oxidase homolog             179   5e-50   Prunus mume [ume]
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         179   6e-50   Jatropha curcas
ref|XP_003596958.1|  L-ascorbate oxidase-like protein                   179   6e-50   Medicago truncatula
gb|KDP36848.1|  hypothetical protein JCGZ_08139                         179   7e-50   Jatropha curcas
ref|XP_008377105.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    179   7e-50   
ref|XP_004238406.1|  PREDICTED: L-ascorbate oxidase homolog             178   7e-50   
ref|XP_006342102.1|  PREDICTED: L-ascorbate oxidase homolog             178   7e-50   Solanum tuberosum [potatoes]
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog             178   8e-50   Glycine max [soybeans]
ref|XP_007017955.1|  SKU5 similar 5 isoform 1                           178   8e-50   
ref|XP_009794442.1|  PREDICTED: L-ascorbate oxidase homolog             178   9e-50   Nicotiana sylvestris
ref|XP_007046384.1|  SKU5 similar 5 isoform 2                           176   9e-50   
ref|XP_007041705.1|  SKU5 similar 5                                     178   9e-50   
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                178   9e-50   Erythranthe guttata [common monkey flower]
ref|XP_007132533.1|  hypothetical protein PHAVU_011G102500g             178   1e-49   Phaseolus vulgaris [French bean]
ref|XP_006390229.1|  hypothetical protein EUTSA_v10018373mg             178   1e-49   Eutrema salsugineum [saltwater cress]
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             178   1e-49   Eucalyptus grandis [rose gum]
gb|KHF99853.1|  L-ascorbate oxidase                                     178   1e-49   Gossypium arboreum [tree cotton]
gb|KJB58002.1|  hypothetical protein B456_009G189900                    178   1e-49   Gossypium raimondii
ref|XP_009596487.1|  PREDICTED: L-ascorbate oxidase homolog             177   2e-49   
gb|KFK34458.1|  hypothetical protein AALP_AA5G148000                    177   2e-49   Arabis alpina [alpine rockcress]
ref|XP_010539810.1|  PREDICTED: L-ascorbate oxidase homolog             177   2e-49   Tarenaya hassleriana [spider flower]
ref|XP_011034917.1|  PREDICTED: L-ascorbate oxidase homolog             177   2e-49   Populus euphratica
ref|XP_008455444.1|  PREDICTED: L-ascorbate oxidase homolog             177   2e-49   Cucumis melo [Oriental melon]
ref|XP_002307765.1|  multi-copper oxidase type 1 family protein         177   3e-49   Populus trichocarpa [western balsam poplar]
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog             177   3e-49   Tarenaya hassleriana [spider flower]
ref|XP_002300669.1|  multi-copper oxidase type 1 family protein         177   3e-49   Populus trichocarpa [western balsam poplar]
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog             177   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_011041276.1|  PREDICTED: L-ascorbate oxidase homolog             177   3e-49   Populus euphratica
ref|XP_010459725.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    177   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002301616.1|  hypothetical protein POPTR_0002s21400g             177   3e-49   Populus trichocarpa [western balsam poplar]
ref|XP_010459724.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    177   4e-49   Camelina sativa [gold-of-pleasure]
gb|KJB15896.1|  hypothetical protein B456_002G202300                    175   4e-49   Gossypium raimondii
ref|XP_002269614.1|  PREDICTED: L-ascorbate oxidase homolog             176   4e-49   Vitis vinifera
ref|XP_010089487.1|  L-ascorbate oxidase-like protein                   171   5e-49   
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           176   5e-49   
ref|XP_004253133.1|  PREDICTED: L-ascorbate oxidase homolog             176   5e-49   Solanum lycopersicum
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg             176   5e-49   Capsella rubella
tpg|DAA62868.1|  TPA: hypothetical protein ZEAMMB73_701617              169   5e-49   
ref|XP_003563038.1|  PREDICTED: L-ascorbate oxidase homolog             176   5e-49   Brachypodium distachyon [annual false brome]
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494             176   6e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_002524823.1|  multicopper oxidase, putative                      176   6e-49   Ricinus communis
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog             176   6e-49   Solanum lycopersicum
ref|XP_003527461.1|  PREDICTED: L-ascorbate oxidase homolog             176   7e-49   Glycine max [soybeans]
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog             176   8e-49   Vitis vinifera
ref|XP_010498473.1|  PREDICTED: L-ascorbate oxidase homolog             176   9e-49   Camelina sativa [gold-of-pleasure]
ref|XP_004291312.1|  PREDICTED: L-ascorbate oxidase homolog             176   9e-49   Fragaria vesca subsp. vesca
gb|KCW70295.1|  hypothetical protein EUGRSUZ_F03538                     174   9e-49   Eucalyptus grandis [rose gum]
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             176   9e-49   Fragaria vesca subsp. vesca
emb|CAN83942.1|  hypothetical protein VITISV_013559                     176   9e-49   Vitis vinifera
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   175   1e-48   Medicago truncatula
ref|XP_006342555.1|  PREDICTED: L-ascorbate oxidase homolog             175   1e-48   Solanum tuberosum [potatoes]
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog             175   1e-48   Camelina sativa [gold-of-pleasure]
tpg|DAA62867.1|  TPA: hypothetical protein ZEAMMB73_701617              167   1e-48   
emb|CDP07321.1|  unnamed protein product                                175   1e-48   Coffea canephora [robusta coffee]
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog             175   1e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             175   1e-48   Vitis vinifera
ref|XP_004499321.1|  PREDICTED: L-ascorbate oxidase homolog             175   2e-48   Cicer arietinum [garbanzo]
gb|AFK35121.1|  unknown                                                 175   2e-48   Medicago truncatula
gb|ACJ85585.1|  unknown                                                 175   2e-48   Medicago truncatula
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog             175   2e-48   Glycine max [soybeans]
gb|KEH36280.1|  multi-copper oxidase-like protein                       175   2e-48   Medicago truncatula
ref|XP_002306213.1|  hypothetical protein POPTR_0004s18730g             174   2e-48   
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog             174   2e-48   Populus euphratica
gb|KJB15897.1|  hypothetical protein B456_002G202300                    174   2e-48   Gossypium raimondii
gb|KHG11003.1|  L-ascorbate oxidase                                     174   2e-48   Gossypium arboreum [tree cotton]
ref|XP_006366591.1|  PREDICTED: L-ascorbate oxidase homolog             175   2e-48   
ref|XP_010063104.1|  PREDICTED: L-ascorbate oxidase homolog             174   2e-48   Eucalyptus grandis [rose gum]
ref|XP_008789824.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    172   2e-48   
ref|XP_004505676.1|  PREDICTED: L-ascorbate oxidase homolog             174   3e-48   Cicer arietinum [garbanzo]
gb|KJB47732.1|  hypothetical protein B456_008G038600                    170   3e-48   Gossypium raimondii
ref|XP_008365718.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    171   3e-48   
emb|CDX73238.1|  BnaC06g36860D                                          174   3e-48   
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             174   3e-48   
ref|XP_006657750.1|  PREDICTED: L-ascorbate oxidase homolog             174   3e-48   Oryza brachyantha
gb|KHG04142.1|  L-ascorbate oxidase                                     174   3e-48   Gossypium arboreum [tree cotton]
ref|NP_177743.1|  SKU5-like 5 protein                                   174   3e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDY68834.1|  BnaCnng60730D                                          174   3e-48   Brassica napus [oilseed rape]
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog             174   3e-48   Sesamum indicum [beniseed]
gb|ABR18324.1|  unknown                                                 174   3e-48   Picea sitchensis
ref|XP_009128157.1|  PREDICTED: L-ascorbate oxidase homolog             174   3e-48   Brassica rapa
gb|AAL09733.1|  At1g76160/T23E18_10                                     174   3e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDY55201.1|  BnaCnng28410D                                          174   3e-48   Brassica napus [oilseed rape]
gb|AAM97070.1|  pectinesterase, putative                                174   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             174   4e-48   Prunus mume [ume]
ref|XP_008382461.1|  PREDICTED: L-ascorbate oxidase homolog             174   4e-48   
ref|XP_010480557.1|  PREDICTED: L-ascorbate oxidase homolog             174   4e-48   Camelina sativa [gold-of-pleasure]
ref|XP_002518462.1|  multicopper oxidase, putative                      174   4e-48   Ricinus communis
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog             174   4e-48   Nelumbo nucifera [Indian lotus]
ref|XP_009106271.1|  PREDICTED: L-ascorbate oxidase homolog             174   4e-48   Brassica rapa
emb|CDX87633.1|  BnaA07g32400D                                          174   4e-48   
gb|KGN43515.1|  hypothetical protein Csa_7G043570                       172   4e-48   Cucumis sativus [cucumbers]
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             174   5e-48   Prunus persica
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             174   5e-48   Eucalyptus grandis [rose gum]
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog             174   5e-48   Pyrus x bretschneideri [bai li]
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog             173   5e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009794440.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    173   5e-48   Nicotiana sylvestris
dbj|BAK04971.1|  predicted protein                                      174   5e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009418785.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    173   5e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009597920.1|  PREDICTED: L-ascorbate oxidase homolog             173   5e-48   Nicotiana tomentosiformis
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         173   6e-48   Jatropha curcas
ref|XP_009418784.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    174   6e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010278638.1|  PREDICTED: L-ascorbate oxidase homolog             173   6e-48   Nelumbo nucifera [Indian lotus]
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    173   6e-48   Populus euphratica
gb|AGT57427.1|  ascorbate oxidase                                       173   7e-48   Prunus persica
gb|AGJ03718.1|  multicopper oxidase                                     173   7e-48   Citrus maxima [buntan]
gb|AFK33407.1|  unknown                                                 170   8e-48   Lotus japonicus
emb|CDP19581.1|  unnamed protein product                                173   8e-48   Coffea canephora [robusta coffee]
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             173   8e-48   
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog             173   8e-48   Cucumis sativus [cucumbers]
ref|XP_007200295.1|  hypothetical protein PRUPE_ppa004000mg             173   8e-48   Prunus persica
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                173   8e-48   Erythranthe guttata [common monkey flower]
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog             173   8e-48   
gb|KCW55614.1|  hypothetical protein EUGRSUZ_I01478                     171   8e-48   Eucalyptus grandis [rose gum]
ref|XP_004487420.1|  PREDICTED: L-ascorbate oxidase homolog             173   9e-48   Cicer arietinum [garbanzo]
gb|EMS52588.1|  L-ascorbate oxidase-like protein                        176   9e-48   Triticum urartu
ref|XP_010323833.1|  PREDICTED: L-ascorbate oxidase homolog             173   9e-48   Solanum lycopersicum
ref|XP_008236098.1|  PREDICTED: L-ascorbate oxidase homolog             172   1e-47   Prunus mume [ume]
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             172   1e-47   Citrus clementina [clementine]
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             172   1e-47   Citrus clementina [clementine]
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             172   1e-47   Citrus sinensis [apfelsine]
gb|KJB50840.1|  hypothetical protein B456_008G189200                    172   1e-47   Gossypium raimondii
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             172   1e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010667350.1|  PREDICTED: L-ascorbate oxidase homolog             172   1e-47   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT15848.1|  L-ascorbate oxidase-like protein                        172   1e-47   
gb|EEE67250.1|  hypothetical protein OsJ_24405                          172   1e-47   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82126.1|  hypothetical protein OsI_26158                          172   1e-47   Oryza sativa Indica Group [Indian rice]
dbj|BAC83966.1|  putative PS60                                          172   2e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog             172   2e-47   Solanum lycopersicum
gb|KFK44156.1|  hypothetical protein AALP_AA1G222300                    172   2e-47   Arabis alpina [alpine rockcress]
ref|XP_008789823.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    172   2e-47   Phoenix dactylifera
gb|KEH30610.1|  multi-copper oxidase-like protein                       171   2e-47   Medicago truncatula
gb|KJB47729.1|  hypothetical protein B456_008G038600                    170   2e-47   Gossypium raimondii
emb|CDY64276.1|  BnaCnng43630D                                          172   2e-47   Brassica napus [oilseed rape]
gb|KHG21048.1|  L-ascorbate oxidase                                     172   2e-47   Gossypium arboreum [tree cotton]
gb|KFK44289.1|  hypothetical protein AALP_AA1G238900                    163   2e-47   Arabis alpina [alpine rockcress]
ref|XP_008806480.1|  PREDICTED: L-ascorbate oxidase homolog             171   3e-47   Phoenix dactylifera
ref|XP_010929557.1|  PREDICTED: L-ascorbate oxidase homolog             171   3e-47   Elaeis guineensis
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g             171   3e-47   
ref|XP_007131584.1|  hypothetical protein PHAVU_011G025400g             171   3e-47   Phaseolus vulgaris [French bean]
ref|XP_010103298.1|  L-ascorbate oxidase-like protein                   172   4e-47   
emb|CDY54804.1|  BnaA06g40970D                                          172   5e-47   Brassica napus [oilseed rape]
ref|XP_010923874.1|  PREDICTED: L-ascorbate oxidase homolog             171   5e-47   Elaeis guineensis
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             171   5e-47   Eucalyptus grandis [rose gum]
ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog             171   5e-47   Solanum tuberosum [potatoes]
gb|KJB14335.1|  hypothetical protein B456_002G120000                    171   5e-47   Gossypium raimondii
emb|CDP10787.1|  unnamed protein product                                171   5e-47   Coffea canephora [robusta coffee]
gb|KHN05478.1|  L-ascorbate oxidase like                                171   5e-47   Glycine soja [wild soybean]
ref|XP_009402574.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    171   5e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN50176.1|  pectinesterase                                          171   5e-47   Annona cherimola [cherimoya]
gb|KHF99506.1|  L-ascorbate oxidase                                     171   5e-47   Gossypium arboreum [tree cotton]
ref|XP_006592035.1|  PREDICTED: L-ascorbate oxidase homolog             171   6e-47   Glycine max [soybeans]
ref|XP_009101945.1|  PREDICTED: L-ascorbate oxidase homolog             171   6e-47   Brassica rapa
gb|KJB47727.1|  hypothetical protein B456_008G038600                    171   7e-47   Gossypium raimondii
gb|KEH30611.1|  multi-copper oxidase-like protein                       171   7e-47   Medicago truncatula
gb|KJB59710.1|  hypothetical protein B456_009G268100                    170   7e-47   Gossypium raimondii
ref|XP_002528421.1|  multicopper oxidase, putative                      170   8e-47   
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog             170   8e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG21949.1|  L-ascorbate oxidase                                     170   8e-47   Gossypium arboreum [tree cotton]
ref|XP_007213899.1|  hypothetical protein PRUPE_ppa003872mg             169   8e-47   
gb|KJB47731.1|  hypothetical protein B456_008G038600                    170   9e-47   Gossypium raimondii
ref|XP_002460757.1|  hypothetical protein SORBIDRAFT_02g034420          170   1e-46   
ref|XP_006411628.1|  hypothetical protein EUTSA_v10024832mg             170   1e-46   Eutrema salsugineum [saltwater cress]
gb|ACL53812.1|  unknown                                                 170   1e-46   Zea mays [maize]
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             170   1e-46   
gb|KJB59711.1|  hypothetical protein B456_009G268100                    170   1e-46   Gossypium raimondii
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog             169   1e-46   Cicer arietinum [garbanzo]
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             170   1e-46   Fragaria vesca subsp. vesca
ref|NP_001152000.1|  L-ascorbate oxidase precursor                      170   1e-46   
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             170   1e-46   Nelumbo nucifera [Indian lotus]
gb|KDP47151.1|  hypothetical protein JCGZ_00042                         169   1e-46   Jatropha curcas
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog             169   2e-46   Solanum tuberosum [potatoes]
gb|EPS74059.1|  hypothetical protein M569_00695                         169   2e-46   Genlisea aurea
ref|XP_006855939.1|  hypothetical protein AMTR_s00037p00216460          169   2e-46   Amborella trichopoda
ref|XP_004957823.1|  PREDICTED: L-ascorbate oxidase homolog             169   2e-46   Setaria italica
ref|XP_009782819.1|  PREDICTED: L-ascorbate oxidase homolog             169   2e-46   Nicotiana sylvestris
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             169   2e-46   
ref|XP_004507683.1|  PREDICTED: L-ascorbate oxidase homolog             169   2e-46   
gb|AAF99833.1|AC008046_5  Putative pectinesterase                       169   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107631.1|  PREDICTED: L-ascorbate oxidase homolog             169   2e-46   Brassica rapa
ref|NP_564479.1|  SKU5 similar 6                                        169   2e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24296.1|  Unknown protein                                         169   3e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CDY35790.1|  BnaA08g04510D                                          169   3e-46   Brassica napus [oilseed rape]
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg             169   3e-46   Prunus persica
emb|CDY67479.1|  BnaCnng55180D                                          169   3e-46   Brassica napus [oilseed rape]
ref|XP_006342554.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    170   3e-46   
ref|XP_002888337.1|  hypothetical protein ARALYDRAFT_475543             168   4e-46   
gb|KGN43295.1|  hypothetical protein Csa_7G018770                       167   4e-46   Cucumis sativus [cucumbers]
ref|XP_009612547.1|  PREDICTED: L-ascorbate oxidase homolog             168   4e-46   Nicotiana tomentosiformis
ref|XP_009758923.1|  PREDICTED: L-ascorbate oxidase homolog             168   7e-46   Nicotiana sylvestris
ref|XP_009629876.1|  PREDICTED: L-ascorbate oxidase homolog             167   7e-46   Nicotiana tomentosiformis
ref|XP_009630902.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    167   8e-46   Nicotiana tomentosiformis
ref|XP_006307199.1|  hypothetical protein CARUB_v10008790mg             167   8e-46   Capsella rubella
ref|XP_004144874.1|  PREDICTED: L-ascorbate oxidase homolog             167   9e-46   Cucumis sativus [cucumbers]
ref|XP_008224692.1|  PREDICTED: L-ascorbate oxidase homolog             167   9e-46   Prunus mume [ume]
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog             167   9e-46   Glycine max [soybeans]
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             167   1e-45   
ref|XP_009630899.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    167   1e-45   
ref|XP_008447902.1|  PREDICTED: L-ascorbate oxidase homolog             167   1e-45   Cucumis melo [Oriental melon]
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    167   1e-45   Nicotiana tomentosiformis
ref|XP_009803721.1|  PREDICTED: L-ascorbate oxidase homolog             167   1e-45   Nicotiana sylvestris
gb|KEH29685.1|  multi-copper oxidase-like protein                       167   1e-45   Medicago truncatula
gb|EYU27771.1|  hypothetical protein MIMGU_mgv1a003982mg                167   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_009758924.1|  PREDICTED: L-ascorbate oxidase homolog             166   2e-45   Nicotiana sylvestris
ref|XP_010555198.1|  PREDICTED: L-ascorbate oxidase homolog             166   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_003529638.1|  PREDICTED: L-ascorbate oxidase homolog             166   3e-45   Glycine max [soybeans]
ref|XP_003549771.1|  PREDICTED: L-ascorbate oxidase homolog             166   3e-45   Glycine max [soybeans]
gb|KHN03487.1|  L-ascorbate oxidase like                                166   3e-45   Glycine soja [wild soybean]
ref|XP_006416260.1|  hypothetical protein EUTSA_v10007292mg             166   3e-45   Eutrema salsugineum [saltwater cress]
ref|XP_010690287.1|  PREDICTED: L-ascorbate oxidase homolog             166   3e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004253203.1|  PREDICTED: L-ascorbate oxidase homolog             166   4e-45   Solanum lycopersicum
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                           166   4e-45   
ref|XP_010052867.1|  PREDICTED: L-ascorbate oxidase homolog             166   4e-45   Eucalyptus grandis [rose gum]
ref|XP_007026110.1|  SKU5 similar 4 isoform 3                           166   4e-45   
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog             165   5e-45   
emb|CDY31468.1|  BnaC05g15770D                                          166   5e-45   Brassica napus [oilseed rape]
ref|NP_173604.1|  SKU5 similar 7 protein                                165   5e-45   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34651.1|  hypothetical protein AALP_AA5G173600                    165   5e-45   Arabis alpina [alpine rockcress]
ref|XP_008791980.1|  PREDICTED: L-ascorbate oxidase homolog             165   6e-45   Phoenix dactylifera
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             165   6e-45   Citrus sinensis [apfelsine]
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             165   6e-45   Citrus clementina [clementine]
ref|XP_010500092.1|  PREDICTED: L-ascorbate oxidase homolog             165   7e-45   Camelina sativa [gold-of-pleasure]
gb|ABK95805.1|  unknown                                                 165   7e-45   Populus trichocarpa [western balsam poplar]
ref|XP_010918208.1|  PREDICTED: L-ascorbate oxidase homolog             165   7e-45   Elaeis guineensis
ref|XP_009408654.1|  PREDICTED: L-ascorbate oxidase homolog             165   9e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006416404.1|  hypothetical protein EUTSA_v10007361mg             164   9e-45   
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         165   9e-45   
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                   165   9e-45   Morus notabilis
ref|XP_010461374.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    164   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_004231076.1|  PREDICTED: L-ascorbate oxidase homolog             164   1e-44   Solanum lycopersicum
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog             164   1e-44   
ref|XP_006283464.1|  hypothetical protein CARUB_v10004509mg             164   1e-44   Capsella rubella
emb|CDP04415.1|  unnamed protein product                                164   1e-44   Coffea canephora [robusta coffee]
ref|XP_002866796.1|  hypothetical protein ARALYDRAFT_490604             164   1e-44   
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog             164   1e-44   Tarenaya hassleriana [spider flower]
gb|ABK25092.1|  unknown                                                 164   1e-44   Picea sitchensis
gb|KJB67220.1|  hypothetical protein B456_010G181000                    163   1e-44   Gossypium raimondii
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog             164   2e-44   Populus euphratica
ref|NP_195555.2|  protein SKU5 similar 9                                164   2e-44   Arabidopsis thaliana [mouse-ear cress]
emb|CAB37498.1|  putative pectinesterase                                164   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb|KJB67219.1|  hypothetical protein B456_010G181000                    163   2e-44   Gossypium raimondii
ref|XP_003610452.1|  L-ascorbate oxidase-like protein                   164   2e-44   Medicago truncatula
ref|XP_008798222.1|  PREDICTED: L-ascorbate oxidase homolog             164   2e-44   Phoenix dactylifera
gb|KHG02352.1|  L-ascorbate oxidase                                     163   2e-44   Gossypium arboreum [tree cotton]
gb|KJB67218.1|  hypothetical protein B456_010G181000                    163   3e-44   Gossypium raimondii
ref|XP_010431777.1|  PREDICTED: L-ascorbate oxidase homolog             163   3e-44   
ref|XP_007153964.1|  hypothetical protein PHAVU_003G080100g             163   4e-44   
ref|XP_006656379.1|  PREDICTED: L-ascorbate oxidase homolog             163   4e-44   
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog             163   4e-44   
emb|CDX82897.1|  BnaC01g13470D                                          162   5e-44   
ref|XP_010436936.1|  PREDICTED: L-ascorbate oxidase homolog             163   5e-44   
gb|KGN64509.1|  hypothetical protein Csa_1G062350                       160   5e-44   
ref|XP_009135529.1|  PREDICTED: L-ascorbate oxidase homolog             162   5e-44   
ref|NP_173603.1|  SKU5 similar 8 protein                                162   5e-44   
emb|CDX79120.1|  BnaA01g11870D                                          162   5e-44   
gb|EAZ38022.1|  hypothetical protein OsJ_22366                          162   6e-44   
ref|NP_001058365.1|  Os06g0678800                                       162   6e-44   
gb|EAZ02087.1|  hypothetical protein OsI_24168                          162   6e-44   
ref|NP_001058771.1|  Os07g0119400                                       162   6e-44   
gb|KFK28784.1|  hypothetical protein AALP_AA7G047600                    162   6e-44   
gb|EMS67789.1|  L-ascorbate oxidase-like protein                        163   6e-44   
ref|XP_006282576.1|  hypothetical protein CARUB_v10004445mg             162   6e-44   
ref|XP_006413696.1|  hypothetical protein EUTSA_v10024862mg             162   7e-44   
ref|XP_010539014.1|  PREDICTED: L-ascorbate oxidase homolog             162   7e-44   
ref|XP_010439384.1|  PREDICTED: L-ascorbate oxidase homolog             162   8e-44   
ref|XP_010434093.1|  PREDICTED: L-ascorbate oxidase homolog             162   8e-44   
ref|XP_010448953.1|  PREDICTED: L-ascorbate oxidase homolog             162   8e-44   
ref|NP_193932.1|  protein SKU5 similar 4                                162   1e-43   
ref|XP_002869849.1|  hypothetical protein ARALYDRAFT_914433             162   1e-43   
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             162   1e-43   
ref|XP_004145114.1|  PREDICTED: L-ascorbate oxidase homolog             162   1e-43   
ref|XP_002272880.1|  PREDICTED: L-ascorbate oxidase homolog             161   1e-43   
ref|XP_008440923.1|  PREDICTED: L-ascorbate oxidase homolog             161   1e-43   
ref|XP_003563398.1|  PREDICTED: L-ascorbate oxidase homolog             161   1e-43   
gb|KGN63948.1|  hypothetical protein Csa_1G031720                       160   2e-43   
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog             161   2e-43   
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             161   2e-43   
gb|KHN44494.1|  L-ascorbate oxidase like                                161   2e-43   
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             161   2e-43   
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             161   2e-43   
gb|ABK25324.1|  unknown                                                 161   2e-43   
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             161   2e-43   
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    161   2e-43   
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             160   2e-43   
ref|XP_002893186.1|  hypothetical protein ARALYDRAFT_313077             160   3e-43   
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog             160   3e-43   
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             160   3e-43   
dbj|BAK00459.1|  predicted protein                                      160   3e-43   
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog             160   4e-43   
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             160   4e-43   
ref|XP_009149524.1|  PREDICTED: L-ascorbate oxidase homolog             160   4e-43   
ref|XP_002459273.1|  hypothetical protein SORBIDRAFT_02g001610          155   4e-43   
ref|NP_001053555.1|  Os04g0561900                                       160   5e-43   
gb|EYU17541.1|  hypothetical protein MIMGU_mgv1a004531mg                159   5e-43   
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             160   5e-43   
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          160   5e-43   
emb|CAH67167.1|  H0211B05.4                                             160   5e-43   
dbj|BAJ91397.1|  predicted protein                                      160   5e-43   
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             159   7e-43   
ref|NP_001147597.1|  LOC100281206 precursor                             159   7e-43   
gb|EMT24760.1|  L-ascorbate oxidase-like protein                        159   9e-43   
ref|XP_002438855.1|  hypothetical protein SORBIDRAFT_10g027270          158   2e-42   
ref|XP_002522339.1|  multicopper oxidase, putative                      158   3e-42   
gb|KFK30447.1|  hypothetical protein AALP_AA7G262200                    157   3e-42   
ref|XP_009400332.1|  PREDICTED: L-ascorbate oxidase homolog             157   4e-42   
gb|EMS54595.1|  L-ascorbate oxidase-like protein                        157   5e-42   
ref|XP_010088984.1|  L-ascorbate oxidase-like protein                   157   6e-42   
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog             156   8e-42   
ref|XP_010686816.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    156   9e-42   
ref|XP_004955371.1|  PREDICTED: L-ascorbate oxidase homolog             156   1e-41   
gb|EPS65321.1|  hypothetical protein M569_09457                         149   1e-41   
ref|XP_003557661.2|  PREDICTED: L-ascorbate oxidase homolog             156   1e-41   
ref|XP_008792598.1|  PREDICTED: L-ascorbate oxidase homolog             155   2e-41   
ref|XP_010255119.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    155   2e-41   
ref|XP_004966212.1|  PREDICTED: L-ascorbate oxidase homolog             155   2e-41   
ref|XP_010255117.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    155   3e-41   
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               155   3e-41   
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             154   5e-41   
gb|KJB57755.1|  hypothetical protein B456_009G179300                    154   7e-41   
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             154   7e-41   
gb|KHG03845.1|  L-ascorbate oxidase                                     154   8e-41   
ref|XP_008663511.1|  PREDICTED: L-ascorbate oxidase homolog             154   9e-41   
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             154   9e-41   
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          154   9e-41   
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             154   9e-41   
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             154   9e-41   
emb|CBI18560.3|  unnamed protein product                                154   9e-41   
emb|CDX89588.1|  BnaC04g36070D                                          149   1e-40   
ref|XP_007163844.1|  hypothetical protein PHAVU_001G269100g             153   1e-40   
gb|KDP31875.1|  hypothetical protein JCGZ_12336                         153   2e-40   
gb|KDO79346.1|  hypothetical protein CISIN_1g009171mg                   153   2e-40   
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             153   2e-40   
emb|CDX81353.1|  BnaC09g07640D                                          153   2e-40   
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog             153   2e-40   
ref|XP_006466655.1|  PREDICTED: L-ascorbate oxidase homolog             153   2e-40   
ref|XP_006848556.1|  hypothetical protein AMTR_s00169p00049950          152   2e-40   
emb|CDY18626.1|  BnaA09g07690D                                          152   2e-40   
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             152   2e-40   
ref|XP_009347241.1|  PREDICTED: L-ascorbate oxidase homolog             152   2e-40   
ref|XP_006425822.1|  hypothetical protein CICLE_v10027285mg             152   2e-40   
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             152   2e-40   
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             152   2e-40   
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             152   2e-40   
ref|NP_569041.1|  protein SKU5 similar 17                               152   2e-40   
gb|AGE09595.1|  SKU5-like protein                                       152   2e-40   
gb|AAM61328.1|  pectinesterase-like protein                             152   2e-40   
dbj|BAB08634.1|  pectinesterase like protein                            152   2e-40   
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             152   3e-40   
ref|XP_010908384.1|  PREDICTED: L-ascorbate oxidase homolog             152   3e-40   
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     152   3e-40   
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         152   4e-40   
emb|CDY12788.1|  BnaC07g16450D                                          152   4e-40   
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             151   5e-40   
emb|CDY43557.1|  BnaC02g16540D                                          151   5e-40   
emb|CDY01453.1|  BnaA07g12260D                                          151   6e-40   
ref|XP_009115829.1|  PREDICTED: L-ascorbate oxidase homolog             151   6e-40   
ref|XP_003550084.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    151   7e-40   
ref|XP_009366415.1|  PREDICTED: L-ascorbate oxidase homolog             151   7e-40   
ref|XP_006280268.1|  hypothetical protein CARUB_v10026189mg             151   8e-40   
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    151   8e-40   
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             150   1e-39   
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         150   1e-39   
ref|XP_002866726.1|  predicted protein                                  150   1e-39   
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             150   1e-39   
ref|XP_004300548.1|  PREDICTED: L-ascorbate oxidase homolog             150   1e-39   
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             150   1e-39   
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             150   1e-39   
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             150   1e-39   
ref|XP_002522337.1|  multicopper oxidase, putative                      150   1e-39   
ref|XP_009368021.1|  PREDICTED: L-ascorbate oxidase homolog             150   1e-39   
ref|XP_009348089.1|  PREDICTED: L-ascorbate oxidase homolog             150   1e-39   
gb|KGN54013.1|  hypothetical protein Csa_4G267480                       150   1e-39   
ref|XP_006657409.1|  PREDICTED: L-ascorbate oxidase homolog             150   1e-39   
ref|XP_004511977.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    150   2e-39   
ref|XP_010686815.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    150   2e-39   
ref|XP_004301852.1|  PREDICTED: L-ascorbate oxidase homolog             150   2e-39   
gb|KDO79340.1|  hypothetical protein CISIN_1g0092422mg                  149   2e-39   
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             150   2e-39   
emb|CAN72539.1|  hypothetical protein VITISV_028750                     149   2e-39   
gb|KGN48499.1|  hypothetical protein Csa_6G490140                       149   2e-39   
ref|XP_004511976.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    150   2e-39   
ref|XP_002268020.2|  PREDICTED: L-ascorbate oxidase homolog             149   3e-39   
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             149   3e-39   
gb|KHN33019.1|  L-ascorbate oxidase like                                149   3e-39   
ref|XP_008338225.1|  PREDICTED: L-ascorbate oxidase homolog             149   3e-39   
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             149   3e-39   
ref|XP_009347247.1|  PREDICTED: L-ascorbate oxidase homolog             149   3e-39   
emb|CBI18561.3|  unnamed protein product                                149   4e-39   
ref|XP_010227225.1|  PREDICTED: L-ascorbate oxidase homolog             149   4e-39   
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             149   4e-39   
ref|XP_009140476.1|  PREDICTED: L-ascorbate oxidase homolog             149   5e-39   
ref|XP_010464737.1|  PREDICTED: L-ascorbate oxidase homolog             149   5e-39   
ref|XP_010484570.1|  PREDICTED: L-ascorbate oxidase homolog             149   6e-39   
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             148   6e-39   
ref|XP_009773470.1|  PREDICTED: L-ascorbate oxidase homolog             149   6e-39   
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             148   7e-39   
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             148   8e-39   
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             148   8e-39   
gb|KEH20500.1|  multi-copper oxidase-like protein                       147   1e-38   
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog             147   1e-38   
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             147   1e-38   
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             147   2e-38   
gb|KHN36198.1|  L-ascorbate oxidase like                                147   2e-38   
ref|XP_010680456.1|  PREDICTED: L-ascorbate oxidase homolog             147   2e-38   
gb|KEH20499.1|  multi-copper oxidase-like protein                       147   2e-38   
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             147   3e-38   
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             146   3e-38   
ref|XP_002310164.1|  multi-copper oxidase type 1 family protein         146   3e-38   
emb|CDP02461.1|  unnamed protein product                                146   3e-38   
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             146   4e-38   
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             146   5e-38   
emb|CDP02462.1|  unnamed protein product                                146   5e-38   
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             146   5e-38   
ref|XP_011013815.1|  PREDICTED: L-ascorbate oxidase homolog             146   5e-38   
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             146   6e-38   
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    145   6e-38   
sp|P29162.1|ASOL_TOBAC  RecName: Full=L-ascorbate oxidase homolog...    145   7e-38   
ref|XP_003524640.1|  PREDICTED: L-ascorbate oxidase homolog             145   8e-38   
ref|XP_009588330.1|  PREDICTED: L-ascorbate oxidase homolog             145   8e-38   
ref|XP_004229062.1|  PREDICTED: L-ascorbate oxidase homolog             145   1e-37   
ref|XP_010093150.1|  L-ascorbate oxidase-like protein                   145   1e-37   
ref|XP_006341879.1|  PREDICTED: L-ascorbate oxidase homolog             145   1e-37   
ref|XP_007155970.1|  hypothetical protein PHAVU_003G247800g             145   1e-37   
gb|KGN62015.1|  hypothetical protein Csa_2G286480                       144   1e-37   
ref|XP_008457817.1|  PREDICTED: L-ascorbate oxidase homolog             144   2e-37   
ref|XP_004148037.1|  PREDICTED: L-ascorbate oxidase homolog             144   2e-37   
ref|XP_002448327.1|  hypothetical protein SORBIDRAFT_06g025300          144   2e-37   
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog             144   3e-37   
ref|XP_011039229.1|  PREDICTED: L-ascorbate oxidase homolog             144   3e-37   
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             144   3e-37   
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             143   4e-37   
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             143   6e-37   
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             143   7e-37   
ref|XP_004233429.1|  PREDICTED: L-ascorbate oxidase homolog             142   7e-37   
ref|XP_009600428.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    142   8e-37   
gb|KHN42054.1|  L-ascorbate oxidase like                                142   8e-37   
ref|XP_011048128.1|  PREDICTED: L-ascorbate oxidase homolog             142   1e-36   
ref|XP_002299087.1|  multi-copper oxidase type 1 family protein         142   1e-36   
ref|XP_009600426.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    142   1e-36   
ref|XP_010433262.1|  PREDICTED: L-ascorbate oxidase homolog             141   2e-36   
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg                141   2e-36   
ref|XP_004509178.1|  PREDICTED: L-ascorbate oxidase homolog             141   2e-36   
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog             141   3e-36   
ref|XP_009387378.1|  PREDICTED: L-ascorbate oxidase homolog             141   3e-36   
ref|XP_009591795.1|  PREDICTED: L-ascorbate oxidase homolog             141   3e-36   
gb|AAQ90182.1|  ntp101                                                  141   3e-36   
ref|XP_010247847.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    141   3e-36   
ref|XP_010438504.1|  PREDICTED: L-ascorbate oxidase homolog             140   3e-36   
ref|XP_006367595.1|  PREDICTED: L-ascorbate oxidase homolog             141   3e-36   
gb|KJB48510.1|  hypothetical protein B456_008G073000                    140   4e-36   
ref|XP_010247849.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    140   4e-36   
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog             140   4e-36   
ref|XP_010247848.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    140   4e-36   
ref|XP_010034522.1|  PREDICTED: L-ascorbate oxidase homolog             140   4e-36   
ref|XP_006402152.1|  hypothetical protein EUTSA_v10013200mg             140   5e-36   
ref|XP_002867467.1|  hypothetical protein ARALYDRAFT_328883             140   5e-36   
dbj|BAK05994.1|  predicted protein                                      140   9e-36   
ref|XP_009766183.1|  PREDICTED: L-ascorbate oxidase homolog             139   1e-35   
ref|XP_011099220.1|  PREDICTED: L-ascorbate oxidase homolog             139   1e-35   
ref|XP_007163845.1|  hypothetical protein PHAVU_001G269200g             139   2e-35   
ref|XP_009594575.1|  PREDICTED: L-ascorbate oxidase homolog             139   2e-35   
ref|XP_008665189.1|  PREDICTED: L-ascorbate oxidase homolog             139   2e-35   
ref|XP_004228635.1|  PREDICTED: L-ascorbate oxidase homolog             139   2e-35   
ref|XP_006360232.1|  PREDICTED: L-ascorbate oxidase homolog             139   2e-35   
emb|CDP18567.1|  unnamed protein product                                139   2e-35   
gb|KCW68031.1|  hypothetical protein EUGRSUZ_F01712                     138   3e-35   



>emb|CAA65634.1| PS60 [Nicotiana tabacum]
Length=540

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   EDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQ+KDQ+G+
Sbjct  83   WNGIQNRRNSFEDGVYGTTCPIPPGRNFTYILQMKDQIGS  122



>ref|XP_009623446.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=540

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   EDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQ+KDQ+G+
Sbjct  83   WNGIQNRRNSFEDGVYGTTCPIPPGRNFTYILQMKDQIGS  122



>ref|XP_009785141.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=540

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   EDPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQ+KDQ+G+
Sbjct  83   WNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQMKDQIGS  122



>ref|XP_008452926.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
 gb|ADN34135.1| multicopper oxidase [Cucumis melo subsp. melo]
Length=541

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+FTWNV+YA IYPLGV QQGILINGQFPGP+I CVTNDNL INVFNSLD+PFL+S
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDIHCVTNDNLIINVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  84   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  123



>ref|XP_004145593.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+FTWNV+YA IYPLGV QQGILINGQFPGP++ CVTNDNL INVFNSLD+PFL+S
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  84   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  123



>ref|XP_004157080.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+FTWNV+YA IYPLGV QQGILINGQFPGP++ CVTNDNL INVFNSLD+PFL+S
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  84   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  123



>gb|KGN55480.1| hypothetical protein Csa_4G653410 [Cucumis sativus]
Length=447

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+FTWNV+YA IYPLGV QQGILINGQFPGP++ CVTNDNL INVFNSLD+PFL+S
Sbjct  24   ENPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  84   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  123



>ref|XP_010667351.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=539

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F+WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFN+LD PFLLS
Sbjct  21   EDPYRFFSWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNNLDVPFLLS  80

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNSFEDGVYGTTCPI PG NFTYMLQVKDQ+G+
Sbjct  81   WNGVQNRRNSFEDGVYGTTCPIPPGRNFTYMLQVKDQIGS  120



>ref|XP_004142986.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 gb|KGN62282.1| Multicopper oxidase [Cucumis sativus]
Length=539

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY TIYPLG+PQQGILINGQFPGP+I  VTNDN+ INVFNSLD+PFLLS
Sbjct  20   EDPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPFLLS  79

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQ+KDQ+G+
Sbjct  80   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGS  119



>ref|XP_010101299.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB88234.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=541

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  22   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  82   WNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGS  121



>ref|XP_008445302.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=538

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY TIYPLG+PQQGILINGQFPGP+I  VTNDN+ INVFNSLD+PFLLS
Sbjct  19   EDPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPFLLS  78

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQ+KDQ+G+
Sbjct  79   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGS  118



>ref|XP_006435292.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 gb|ESR48532.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
Length=446

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILIN QFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  25   EDPYRFFNWNVTYGDIYPLGVRQRGILINWQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGS  124



>ref|XP_007160607.1| hypothetical protein PHAVU_001G001500g [Phaseolus vulgaris]
 gb|ESW32601.1| hypothetical protein PHAVU_001G001500g [Phaseolus vulgaris]
Length=539

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLDQPFLLS
Sbjct  21   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLS  80

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNSFEDGV+GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  81   WNGVQQRRNSFEDGVWGTTCPIPPGGNFTYILQVKDQIGS  120



>ref|XP_009334388.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=544

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGS  125



>ref|XP_008387887.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=544

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGS  125



>ref|XP_006435293.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 ref|XP_006473746.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR48533.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 gb|KDO85016.1| hypothetical protein CISIN_1g009149mg [Citrus sinensis]
Length=542

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILIN QFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  25   EDPYRFFNWNVTYGDIYPLGVRQRGILINWQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQNRRNSFEDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGS  124



>ref|XP_002510630.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF52817.1| multicopper oxidase, putative [Ricinus communis]
Length=546

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLG+ QQGILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  28   EDPYRFFNWNVTYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  87

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  88   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  127



>ref|XP_006596528.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLDQPFLLS
Sbjct  29   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNSFEDGV GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  89   WNGVQQRRNSFEDGVLGTTCPIPPGGNFTYILQVKDQIGS  128



>ref|XP_007221787.1| hypothetical protein PRUPE_ppa003860mg [Prunus persica]
 gb|EMJ22986.1| hypothetical protein PRUPE_ppa003860mg [Prunus persica]
Length=544

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGRNFTYILQVKDQIGS  125



>ref|XP_007017957.1| SKU5 similar 5 isoform 3 [Theobroma cacao]
 gb|EOY15182.1| SKU5 similar 5 isoform 3 [Theobroma cacao]
Length=445

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   DDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  122



>ref|XP_007136137.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
 gb|ESW08131.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
Length=548

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  I+PLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  30   EDPYRFFNWNVTYGDIFPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSFEDGV+GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  90   WNGIQQRRNSFEDGVFGTTCPIAPGKNFTYILQVKDQIGS  129



>ref|XP_003550444.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN48525.1| L-ascorbate oxidase like [Glycine soja]
Length=541

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLDQPFLLS
Sbjct  23   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNSFEDGV GTTCPI  G NFTY+LQVKDQ+G+
Sbjct  83   WNGVQQRRNSFEDGVLGTTCPIPAGGNFTYILQVKDQIGS  122



>ref|XP_004500896.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=548

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  30   EDPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSFEDGV+GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  90   WNGIQQRRNSFEDGVFGTTCPIPPGRNFTYILQVKDQIGS  129



>ref|XP_010536445.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  24   EDPYRFFDWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSF+DGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  84   WNGIQQRRNSFQDGVYGTTCPIPPGKNFTYILQVKDQIGS  123



>gb|KJB58003.1| hypothetical protein B456_009G189900 [Gossypium raimondii]
Length=445

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  I+PLGV Q GILINGQFPGP+I  VTNDNL INVFNSL++PFLLS
Sbjct  23   EDPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  122



>gb|KHN33820.1| L-ascorbate oxidase like [Glycine soja]
Length=540

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  22   EDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSFEDGV+GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  82   WNGIQQRRNSFEDGVFGTTCPIPPGKNFTYILQVKDQIGS  121



>gb|KEH40258.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  25   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGV+GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGVQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGS  124



>ref|XP_003523207.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  29   EDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSFEDGV+GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  89   WNGIQQRRNSFEDGVFGTTCPIPPGKNFTYILQVKDQIGS  128



>ref|XP_007017956.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
 gb|EOY15181.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
Length=475

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   DDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  122



>emb|CAB08077.1| pectinesterase [Solanum lycopersicum]
Length=504

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL IN+ NSLD+PFLLS
Sbjct  1    EDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVINIHNSLDEPFLLS  60

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQNRRNSF DGVYGTTCPI PG N T+ LQVKDQ+G+
Sbjct  61   WNGIQNRRNSFVDGVYGTTCPIPPGRNNTFNLQVKDQIGS  100



>gb|KJB58004.1| hypothetical protein B456_009G189900 [Gossypium raimondii]
Length=474

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  I+PLGV Q GILINGQFPGP+I  VTNDNL INVFNSL++PFLLS
Sbjct  23   EDPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  122



>ref|XP_003539859.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=537

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INV+NSLD+PFLLS
Sbjct  23   EDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVTNDNLIINVYNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+  RRNS++DGVYGT CPILPGHNFTY+LQVKDQ+G+
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPILPGHNFTYVLQVKDQIGS  122



>ref|XP_006390228.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
 gb|ESQ27514.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
Length=515

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQVKDQ+G+
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGS  123



>ref|XP_011099705.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++TWNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDN+ +NVFNSLD+PFL+ 
Sbjct  20   ESPYRFYTWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNIIVNVFNSLDEPFLIH  79

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+G+QNRRNS+EDGVYGTTCPI PG NFTY+LQ+KDQ+G+
Sbjct  80   WSGVQNRRNSYEDGVYGTTCPIPPGQNFTYILQMKDQIGS  119



>gb|KHN21220.1| L-ascorbate oxidase like [Glycine soja]
Length=537

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INV+NSLD+PFLLS
Sbjct  23   EDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVTNDNLIINVYNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+  RRNS++DGVYGT CPILPGHNFTY+LQVKDQ+G+
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPILPGHNFTYVLQVKDQIGS  122



>ref|XP_008221175.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=544

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY++F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  26   EDPYKFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGRNFTYILQVKDQIGS  125



>gb|KDP22727.1| hypothetical protein JCGZ_01829 [Jatropha curcas]
Length=541

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+++WNVTY  IYPLGV QQGILINGQFPGP+IE VTN+NL IN+FNSLD+PFLLS
Sbjct  23   EDPYRFYSWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLIINIFNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTYMLQVKDQ+G+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYMLQVKDQIGS  122



>ref|XP_003596958.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|ABN08527.1| Multicopper oxidase, type 1 [Medicago truncatula]
 gb|AES67209.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=539

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQGILINGQFPGP+IE VTNDNL ++VFNSLDQPFL+S
Sbjct  26   EDPYRFYTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIVSVFNSLDQPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  86   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGS  125



>gb|KDP36848.1| hypothetical protein JCGZ_08139 [Jatropha curcas]
Length=542

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  25   EDPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS+EDGV+GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGS  124



>ref|XP_008377105.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=544

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  26   EDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSF DGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  86   WNGIQQRRNSFVDGVYGTTCPIPPGRNFTYILQVKDQIGS  125



>ref|XP_004238406.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=540

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL IN+ NSLD+PFLLS
Sbjct  23   EDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVINIHNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNSF DGVYGTTCPI PG N T+ LQVKDQ+G+
Sbjct  83   WNGVQNRRNSFVDGVYGTTCPIPPGRNNTFNLQVKDQIGS  122



>ref|XP_006342102.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=540

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF WNVTY TIYPLGVPQQGILINGQFPGP+I  VTNDNL IN+ NSLD+PFLLS
Sbjct  23   EDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVINIHNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNSF DGVYGTTCPI PG N T+ LQVKDQ+G+
Sbjct  83   WNGVQNRRNSFVDGVYGTTCPIPPGRNNTFNLQVKDQIGS  122



>ref|XP_003527501.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN41233.1| L-ascorbate oxidase like [Glycine soja]
Length=537

 Score =   178 bits (452),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INV+NSLD+PFLLS
Sbjct  23   EDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVTNDNLIINVYNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+  RRNS++DGVYGT CPILPGHNFTY+LQVKDQ+G+
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPILPGHNFTYVLQVKDQIGS  122



>ref|XP_007017955.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
 gb|EOY15180.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
Length=541

 Score =   178 bits (452),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+F WNVTY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  23   DDPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  122



>ref|XP_009794442.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=541

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWN+TY  +YPLGV QQGILINGQFPGP IECVTNDNL INVFN+LD+PFL+S
Sbjct  24   EDPYRFYTWNITYGDVYPLGVKQQGILINGQFPGPTIECVTNDNLIINVFNNLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG++ RRNS++DGVYGT CPI PG+NFTY+LQVKDQ+G+
Sbjct  84   WNGVEQRRNSWQDGVYGTNCPIPPGNNFTYVLQVKDQIGS  123



>ref|XP_007046384.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
 gb|EOY02216.1| SKU5 similar 5 isoform 2 [Theobroma cacao]
Length=447

 Score =   176 bits (447),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            ED YR+FTWNVTY  IYPLGV QQGILINGQFPGP+IE VTN+NL INVFNSLDQPFL+S
Sbjct  25   EDAYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLIINVFNSLDQPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY LQVKDQ+G+
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGS  124



>ref|XP_007041705.1| SKU5 similar 5 [Theobroma cacao]
 gb|EOX97536.1| SKU5 similar 5 [Theobroma cacao]
Length=547

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGPE+  VTNDNL INV+N+LD+PFLLS
Sbjct  29   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPELYSVTNDNLIINVYNNLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  89   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  128



>gb|EYU36818.1| hypothetical protein MIMGU_mgv1a004264mg [Erythranthe guttata]
Length=536

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY TIYPLG+ QQGILINGQFPGPEI  VTNDN+ +NVFNSLDQPFL+ 
Sbjct  18   EDPYRFFNWNITYGTIYPLGIAQQGILINGQFPGPEIYSVTNDNIIVNVFNSLDQPFLIH  77

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQNRRNS+EDGVYGTTCPI  G NFTY+LQ+KDQ+G+
Sbjct  78   WNGIQNRRNSYEDGVYGTTCPIPAGGNFTYILQMKDQIGS  117



>ref|XP_007132533.1| hypothetical protein PHAVU_011G102500g [Phaseolus vulgaris]
 gb|ESW04527.1| hypothetical protein PHAVU_011G102500g [Phaseolus vulgaris]
Length=538

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFNSLD+PFLLS
Sbjct  24   EDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVTNDNLIINVFNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+  RRNS++DGVYGT CPI PGHNFTY+LQVKDQ+G+
Sbjct  84   WNGVLQRRNSWQDGVYGTNCPISPGHNFTYVLQVKDQIGS  123



>ref|XP_006390229.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
 gb|ESQ27515.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
Length=541

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQVKDQ+G+
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGS  123



>ref|XP_010061137.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW68030.1| hypothetical protein EUGRSUZ_F01712 [Eucalyptus grandis]
Length=543

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL++PFLLS
Sbjct  26   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVINSLNEPFLLS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSFEDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  86   WNGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGS  125



>gb|KHF99853.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  I+PLGV Q GILINGQFPGP+I  VTNDNL INVFNSL++PFLLS
Sbjct  23   EDPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  122



>gb|KJB58002.1| hypothetical protein B456_009G189900 [Gossypium raimondii]
Length=541

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  I+PLGV Q GILINGQFPGP+I  VTNDNL INVFNSL++PFLLS
Sbjct  23   EDPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  122



>ref|XP_009596487.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=544

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLG+ QQGILINGQFPGP IECVTNDNL INVFN+LD+PFL+S
Sbjct  27   EDPYRFYTWNVTYGDIYPLGLKQQGILINGQFPGPPIECVTNDNLIINVFNNLDEPFLIS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG++ RRNS++DGVYGT CPI PG+NFTY+LQVKDQ+G+
Sbjct  87   WNGVEQRRNSWQDGVYGTNCPIPPGNNFTYVLQVKDQIGS  126



>gb|KFK34458.1| hypothetical protein AALP_AA5G148000 [Arabis alpina]
Length=541

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQVKDQ+G+
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGS  123



>ref|XP_010539810.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=542

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP++  VTNDNL INVFNSLD+PFL+S
Sbjct  24   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDVRSVTNDNLIINVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQ RRNSF DGVYGTTCPI PG N+TY LQVKDQ+G+
Sbjct  84   WSGIQQRRNSFVDGVYGTTCPIPPGKNYTYALQVKDQIGS  123



>ref|XP_011034917.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=547

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  29   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  89   WNGIQQRRNSFEDGVIGTTCPIPPGKNFTYILQVKDQIGS  128



>ref|XP_008455444.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=543

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTN+NL INVFNSLD+PFL+S
Sbjct  25   EDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGS  124



>ref|XP_002307765.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE94761.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=548

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  29   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS+EDGV+GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  89   WNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGS  128



>ref|XP_010530339.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=540

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLD+PFL+S
Sbjct  23   ESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNS+ DGVYGTTCPI PG N+TY+LQVKDQ+G+
Sbjct  83   WNGVQNRRNSYVDGVYGTTCPIPPGRNYTYILQVKDQIGS  122



>ref|XP_002300669.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE79942.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=547

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  29   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  89   WNGIQQRRNSFEDGVIGTTCPIPPGKNFTYILQVKDQIGS  128



>ref|XP_010428667.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INVFNSLD+PFLLS
Sbjct  25   EDPYRFYEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNSF DGVYGTTCPI PG N+TYMLQ+KDQ+G+
Sbjct  85   WNGVQQRRNSFVDGVYGTTCPIPPGQNYTYMLQMKDQIGS  124



>ref|XP_011041276.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=548

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  29   EDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS+EDGV+GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  89   WNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGS  128



>ref|XP_010459725.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=537

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W++TY  IYP+GV QQGILIN  FPGPEI CVTNDNL INVFN LD+PFL+S
Sbjct  24   EDPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIINVFNHLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W GIQNR+NSF+DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  84   WAGIQNRKNSFQDGVYGTTCPIPPGKNFTYALQVKDQIGS  123



>ref|XP_002301616.1| hypothetical protein POPTR_0002s21400g [Populus trichocarpa]
 gb|EEE80889.1| hypothetical protein POPTR_0002s21400g [Populus trichocarpa]
Length=545

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQGILING+FPGP+IE VTNDNL I+VFNSLD+PFLLS
Sbjct  27   EDPYRFYTWNVTYGDIYPLGVKQQGILINGKFPGPQIESVTNDNLIISVFNSLDEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  87   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGS  126



>ref|XP_010459724.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
Length=548

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W++TY  IYP+GV QQGILIN  FPGPEI CVTNDNL INVFN LD+PFL+S
Sbjct  35   EDPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIINVFNHLDEPFLIS  94

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W GIQNR+NSF+DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  95   WAGIQNRKNSFQDGVYGTTCPIPPGKNFTYALQVKDQIGS  134



>gb|KJB15896.1| hypothetical protein B456_002G202300 [Gossypium raimondii]
Length=449

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP++  VTNDNL INV+N+LD+PFLLS
Sbjct  27   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDLYSVTNDNLIINVYNNLDEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQ KDQ+G
Sbjct  87   WNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIG  125



>ref|XP_002269614.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI28811.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL ++V+NSLD+PFLLS
Sbjct  23   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPPIESVTNDNLIVSVYNSLDEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGS  122



>ref|XP_010089487.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB37880.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=300

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++ WNVTY  IYPLGV Q+GILINGQFPGP+IE VTNDNL I+VFNSLD+PFL+S
Sbjct  23   ESPYRFYDWNVTYGDIYPLGVKQRGILINGQFPGPQIESVTNDNLIISVFNSLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGS  122



>ref|XP_007046383.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
 gb|EOY02215.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
Length=540

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            ED YR+FTWNVTY  IYPLGV QQGILINGQFPGP+IE VTN+NL INVFNSLDQPFL+S
Sbjct  25   EDAYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLIINVFNSLDQPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY LQVKDQ+G+
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGS  124



>ref|XP_004253133.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=544

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY TI+PLG+PQ+GILINGQFPGP+I  VTNDN+ INVFN+LD+ FL+S
Sbjct  22   ESPYRFFEWNVTYGTIWPLGLPQKGILINGQFPGPDIHSVTNDNVIINVFNNLDEEFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQNRRNSFEDGV+GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  82   WNGIQNRRNSFEDGVWGTTCPIPPGKNFTYILQVKDQIGS  121



>ref|XP_006302110.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
 gb|EOA35008.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
Length=541

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNSF DGVYGTTCPI PG N+TYMLQ+KDQ+G+
Sbjct  84   WNGVQQRRNSFVDGVYGTTCPIPPGKNYTYMLQMKDQIGS  123



>tpg|DAA62868.1| TPA: hypothetical protein ZEAMMB73_701617, partial [Zea mays]
Length=237

 Score =   169 bits (428),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFN L++PFLLS
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            W+G+Q RRNSFEDGV GTTCPI PG NFTY++Q KDQ+G
Sbjct  90   WSGLQQRRNSFEDGVAGTTCPIPPGSNFTYIMQAKDQIG  128



>ref|XP_003563038.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=543

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  I+PLGV QQGILINGQFPGP+I+ VTNDNL +NV+N+L++PFLLS
Sbjct  25   EDPYRFFTWNVTYGDIFPLGVKQQGILINGQFPGPQIDAVTNDNLVVNVYNNLNEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            WNG+Q RRNSFEDGV GTTCPI PG NFTY+LQVKDQ+G
Sbjct  85   WNGVQQRRNSFEDGVAGTTCPIPPGRNFTYILQVKDQIG  123



>ref|XP_002889063.1| hypothetical protein ARALYDRAFT_895494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65322.1| hypothetical protein ARALYDRAFT_895494 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQ+KDQ+G+
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGS  123



>ref|XP_002524823.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF37543.1| multicopper oxidase, putative [Ricinus communis]
Length=538

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+++WN++Y  IYPLGV QQGILINGQFPGP+IE VTNDNL INVFNSLD+PFL+S
Sbjct  25   EDPYRFYSWNISYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGS  124



>ref|XP_004243477.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=537

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLGV QQGILINGQFPGP I+CVTNDNL INVFN+LD+PFL+S
Sbjct  27   EDPYRFYAWNVTYGDIYPLGVKQQGILINGQFPGPPIQCVTNDNLIINVFNNLDEPFLIS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG++ RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  87   WNGVEQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGS  126



>ref|XP_003527461.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV Q GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  29   EDPYRFFNWNITYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            WNGIQ RRNSFEDGV+GTTCPI  G NFTY+LQVKDQ+G
Sbjct  89   WNGIQQRRNSFEDGVFGTTCPIPAGKNFTYILQVKDQIG  127



>ref|XP_002285913.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18890.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   176 bits (445),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVT+  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSL +PFLLS
Sbjct  23   EDPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLTEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+G+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  83   WSGVQQRRNSYEDGVYGTTCPIPPGRNFTYILQVKDQIGS  122



>ref|XP_010498473.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=538

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W++TY  IYP+GV QQGILIN  FPGPEI CVTNDNL INVFN LD+PFL+S
Sbjct  25   EDPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIINVFNHLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W GIQNR+NSF+DGVYGTTCPI PG N+TY LQVKDQ+G+
Sbjct  85   WAGIQNRKNSFQDGVYGTTCPIPPGKNYTYALQVKDQIGS  124



>ref|XP_004291312.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=545

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSLD+PFLLS
Sbjct  27   EDPYRFFQWNVTYGDIYPLGVRQRGILINGQFPGPDINSVTNDNLIINVFNSLDEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ R NSF+DGVYGTTCPI PG N TY+LQVKDQ+G+
Sbjct  87   WNGIQQRHNSFQDGVYGTTCPIPPGRNLTYILQVKDQIGS  126



>gb|KCW70295.1| hypothetical protein EUGRSUZ_F03538 [Eucalyptus grandis]
Length=487

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLD PFL+S
Sbjct  22   ENPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDVPFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQ RRNS+EDGVYGTTCPI PG NFTY+ QVKDQ+G+
Sbjct  82   WSGIQQRRNSYEDGVYGTTCPIPPGRNFTYIFQVKDQIGS  121



>ref|XP_004287955.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=542

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLGV QQGILINGQFPGP+I+CVTNDNL I+VFNSLD+PFL+S
Sbjct  24   EDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQ+G+
Sbjct  84   WNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGS  123



>emb|CAN83942.1| hypothetical protein VITISV_013559 [Vitis vinifera]
Length=541

 Score =   176 bits (445),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVT+  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSL +PFLLS
Sbjct  23   EDPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLTEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+G+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  83   WSGVQQRRNSYEDGVYGTTCPIPPGRNFTYILQVKDQIGS  122



>ref|XP_003605947.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES88144.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=538

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLGV QQGILINGQFPGP+IE VTNDNL INVFNSLD+PFL+S
Sbjct  23   EDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNSLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+  RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPISPGQNFTYILQVKDQIGS  122



>ref|XP_006342555.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=544

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY TI+PLG+PQ+GILINGQFPGP+I  VTNDN+ INVFN+LD+ FL+S
Sbjct  22   ESPYRFFEWNVTYGTIWPLGLPQKGILINGQFPGPDIHSVTNDNVIINVFNNLDEDFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQNRRNSFEDGV+GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  82   WNGIQNRRNSFEDGVWGTTCPIPPGKNFTYILQVKDQIGS  121



>ref|XP_010471765.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INV+NSLD+PFLLS
Sbjct  25   EDPYRFYEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNSF DGVYGTTCPI PG N+TYMLQ+KDQ+G+
Sbjct  85   WNGVQQRRNSFVDGVYGTTCPIPPGQNYTYMLQMKDQIGS  124



>tpg|DAA62867.1| TPA: hypothetical protein ZEAMMB73_701617 [Zea mays]
Length=217

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFN L++PFLLS
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            W+G+Q RRNSFEDGV GTTCPI PG NFTY++Q KDQ+G
Sbjct  90   WSGLQQRRNSFEDGVAGTTCPIPPGSNFTYIMQAKDQIG  128



>emb|CDP07321.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY +F WNVTY TIYPLGVPQQGILINGQFPGP+I  VTN+NL INVFNSL +PFLLS
Sbjct  25   EDPYLFFNWNVTYGTIYPLGVPQQGILINGQFPGPDIHSVTNNNLVINVFNSLTEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQNRRNS+ DGVYGTTCPI PG N+TY+LQVKDQ+G+
Sbjct  85   WSGIQNRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGS  124



>ref|XP_010676489.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=549

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++TWNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL ++VFNSLD+PFLLS
Sbjct  25   ESPYRFYTWNVTYGDIYPLGVKQQGILINGQFPGPPIEAVTNDNLIVSVFNSLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGS  124



>ref|XP_002282214.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI37764.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  24   EDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNSFEDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  84   WNGVQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGS  123



>ref|XP_004499321.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=544

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLG+ QQGILINGQFPGP+I  VTNDNL INVFNSLD PFL+S
Sbjct  26   EDPYRFFDWNITYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDVPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGV GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  86   WNGVQQRRNSYEDGVSGTTCPIPPGKNFTYILQVKDQIGS  125



>gb|AFK35121.1| unknown [Medicago truncatula]
Length=544

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY++F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSL++PFL+S
Sbjct  26   EDPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  86   WNGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGS  125



>gb|ACJ85585.1| unknown [Medicago truncatula]
Length=544

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY++F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSL++PFL+S
Sbjct  26   EDPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  86   WNGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGS  125



>ref|XP_003540295.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=536

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLG+ QQGILINGQFPGP+IE VTNDNL ++VFNSLD+PFL+S
Sbjct  23   EDPYRFYTWNVTYGDIYPLGMKQQGILINGQFPGPQIESVTNDNLILHVFNSLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGS  122



>gb|KEH36280.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=544

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY++F WNVTY  IYPLGV Q+GILINGQFPGP+I  VTNDNL INVFNSL++PFL+S
Sbjct  26   EDPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  86   WNGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGS  125



>ref|XP_002306213.1| hypothetical protein POPTR_0004s18730g [Populus trichocarpa]
 gb|EEE86724.1| hypothetical protein POPTR_0004s18730g [Populus trichocarpa]
Length=543

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTN+NL INV+NSL +PFL+S
Sbjct  26   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVYNSLPEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  86   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  125



>ref|XP_011046313.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=544

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTN+NL INV+NSL +PFL+S
Sbjct  26   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVYNSLPEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  86   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  125



>gb|KJB15897.1| hypothetical protein B456_002G202300 [Gossypium raimondii]
Length=545

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP++  VTNDNL INV+N+LD+PFLLS
Sbjct  27   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDLYSVTNDNLIINVYNNLDEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQ KDQ+G
Sbjct  87   WNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIG  125



>gb|KHG11003.1| L-ascorbate oxidase [Gossypium arboreum]
Length=545

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP++  VTNDNL INV+N+LD+PFLLS
Sbjct  27   EDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDLYSVTNDNLIINVYNNLDEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQ KDQ+G
Sbjct  87   WNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIG  125



>ref|XP_006366591.1| PREDICTED: L-ascorbate oxidase homolog, partial [Solanum tuberosum]
Length=568

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++ WN+TY  IYPLGV QQGILINGQFPGP+I+ VTNDNL INVFNSLD+PFLLS
Sbjct  50   ESPYRWYNWNITYGDIYPLGVKQQGILINGQFPGPQIDSVTNDNLIINVFNSLDEPFLLS  109

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  110  WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGS  149



>ref|XP_010063104.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW70294.1| hypothetical protein EUGRSUZ_F03538 [Eucalyptus grandis]
Length=540

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INVFNSLD PFL+S
Sbjct  22   ENPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDVPFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQ RRNS+EDGVYGTTCPI PG NFTY+ QVKDQ+G+
Sbjct  82   WSGIQQRRNSYEDGVYGTTCPIPPGRNFTYIFQVKDQIGS  121



>ref|XP_008789824.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Phoenix dactylifera]
Length=427

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  31   DDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  90

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPI P  NFTY+LQVKDQ+G+
Sbjct  91   WNGIQQRRNSWQDGVYGTNCPIPPRRNFTYVLQVKDQIGS  130



>ref|XP_004505676.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=533

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  21   EDPYRFFDWNITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  80

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS+EDGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  81   WNGIQQRRNSYEDGVYGTTCPIPPGKNFTYTLQVKDQIGS  120



>gb|KJB47732.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=325

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  124



>ref|XP_008365718.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=373

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPEIFSVTNDNLIINVHNSLPEPFLIS  78

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGTTC I PG NFTY LQVKDQ+G+
Sbjct  79   WNGVQQRRNSYQDGVYGTTCAIPPGQNFTYTLQVKDQIGS  118



>emb|CDX73238.1| BnaC06g36860D [Brassica napus]
Length=541

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   ESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+ DGVYGTTCPI PG N+TY+LQVKDQ+G+
Sbjct  84   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGS  123



>ref|XP_008362259.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=542

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL INVFNSLD+PFL+S
Sbjct  24   EDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIDSVTNDNLIINVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGV+GT CPI PG NFTY LQVKDQ+G+
Sbjct  84   WNGVQQRRNSWQDGVFGTNCPIPPGQNFTYALQVKDQIGS  123



>ref|XP_006657750.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=551

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  I PLGV QQGILINGQFPGP+IE VTNDNL INVFN+L +PFLLS
Sbjct  31   DDPYRFFTWTVTYGDIAPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNNLTEPFLLS  90

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQ+G
Sbjct  91   WNGIQQRRNSFEDGVAGTTCPIPPGGNFTYILQVKDQIG  129



>gb|KHG04142.1| L-ascorbate oxidase [Gossypium arboreum]
Length=550

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQ ILINGQFPGP+IE VTN+NL INVFNSLDQPFL+S
Sbjct  30   EDPYRFYTWNVTYGDIYPLGVKQQVILINGQFPGPQIETVTNENLIINVFNSLDQPFLIS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY LQVKDQ+G+
Sbjct  90   WNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGS  129



>ref|NP_177743.1| SKU5-like 5 protein [Arabidopsis thaliana]
 gb|AAF17645.1|AC009978_21 T23E18.10 [Arabidopsis thaliana]
 dbj|BAH19558.1| AT1G76160 [Arabidopsis thaliana]
 gb|AEE35804.1| SKU5-like 5 protein [Arabidopsis thaliana]
Length=541

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILING FPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQ+KDQ+G+
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGS  123



>emb|CDY68834.1| BnaCnng60730D, partial [Brassica napus]
Length=549

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILI+G+FPGP+I  VTNDNL IN+FN+LD+PFLLS
Sbjct  32   EDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEPFLLS  91

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+ DGVYGTTCPI PG N+TYMLQVKDQ+G+
Sbjct  92   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGS  131



>ref|XP_011088669.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWN+TYA IYPLGV QQGILINGQFPGP+I  VTNDN+ +NV+N+L +PFLLS
Sbjct  22   EDPYRFFTWNITYADIYPLGVRQQGILINGQFPGPDIYAVTNDNIIVNVYNNLPEPFLLS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++Q+KDQ+G+
Sbjct  82   WNGVQQRKNSFEDGVYGTTCPIPPGKNFTYVMQMKDQIGS  121



>gb|ABR18324.1| unknown [Picea sitchensis]
Length=542

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY++FTWNVT+ TI+PLG+PQQGILINGQFPGP I+ VTNDN+ +NVFNSLDQPFL+S
Sbjct  24   EDPYKFFTWNVTWGTIWPLGIPQQGILINGQFPGPRIDSVTNDNIIVNVFNSLDQPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQ RRNS++DGV+GT CPI PG NFTY  QVKDQ+G+
Sbjct  84   WSGIQQRRNSWQDGVFGTNCPIPPGQNFTYKFQVKDQIGS  123



>ref|XP_009128157.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=542

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILI+G+FPGP+I  VTNDNL IN+FN+LD+PFLLS
Sbjct  24   EDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+ DGVYGTTCPI PG N+TYMLQVKDQ+G+
Sbjct  84   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGS  123



>gb|AAL09733.1| At1g76160/T23E18_10 [Arabidopsis thaliana]
Length=541

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILING FPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQ+KDQ+G+
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGS  123



>emb|CDY55201.1| BnaCnng28410D, partial [Brassica napus]
Length=549

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILI+G+FPGP+I  VTNDNL IN+FN+LD+PFLLS
Sbjct  32   EDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEPFLLS  91

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+ DGVYGTTCPI PG N+TYMLQVKDQ+G+
Sbjct  92   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGS  131



>gb|AAM97070.1| pectinesterase, putative [Arabidopsis thaliana]
 gb|AAN15546.1| pectinesterase, putative [Arabidopsis thaliana]
Length=541

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILING FPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   EDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNSF DGVYGTTCPI PG N+TY+LQ+KDQ+G+
Sbjct  84   WNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGS  123



>ref|XP_008229964.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=542

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLG+ Q+GILINGQFPGP+IE VTNDNL INVFNSLD+PFLLS
Sbjct  24   EDPYRFYNWNVTYGDIYPLGLKQRGILINGQFPGPQIESVTNDNLIINVFNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQ+G+
Sbjct  84   WNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGS  123



>ref|XP_008382461.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=535

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF WNVTY  IYPLG  QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRYFDWNVTYGDIYPLGARQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  78

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  79   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGS  118



>ref|XP_010480557.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=537

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYRYF W++TY  IYP+GV QQGILIN  FPGPEI CVTNDNL INVFN LD+PFL+S
Sbjct  24   ENPYRYFQWHITYGDIYPMGVKQQGILINKMFPGPEIRCVTNDNLIINVFNHLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W GIQNR+NSF+DGVYGTTCPI PG N+TY LQVKDQ+G+
Sbjct  84   WAGIQNRKNSFQDGVYGTTCPIPPGKNYTYALQVKDQIGS  123



>ref|XP_002518462.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF43849.1| multicopper oxidase, putative [Ricinus communis]
Length=541

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+FTW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL INVFN L +PFL+S
Sbjct  23   ENPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDVVTNDNLIINVFNYLREPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPILPG NFTY+LQVKDQ+G+
Sbjct  83   WNGIQQRRNSWQDGVYGTNCPILPGRNFTYILQVKDQIGS  122



>ref|XP_010266098.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=547

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSL +PFLLS
Sbjct  29   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLPEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  89   WNGIQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGS  128



>ref|XP_009106271.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   ESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+ DGVYGTTCPI PG N+TY+LQVKDQ+G+
Sbjct  84   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGS  123



>emb|CDX87633.1| BnaA07g32400D [Brassica napus]
Length=541

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSLD+PFLLS
Sbjct  24   ESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+ DGVYGTTCPI PG N+TY+LQVKDQ+G+
Sbjct  84   WNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGS  123



>gb|KGN43515.1| hypothetical protein Csa_7G043570 [Cucumis sativus]
Length=453

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+  WN+TY  I+PLGV QQGILINGQFPGP+IE VTN+NL INVFNSLD+PFL+S
Sbjct  25   EDPYRFLNWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGS  124



>ref|XP_007215641.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
 gb|EMJ16840.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
Length=542

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLG+ Q+GILINGQFPGP+IE VTNDNL INVFNSLD+PFLLS
Sbjct  24   EDPYRFYNWNVTYGDIYPLGLKQRGILINGQFPGPQIESVTNDNLIINVFNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQ+G+
Sbjct  84   WNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGS  123



>ref|XP_010046372.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW88773.1| hypothetical protein EUGRSUZ_A01118 [Eucalyptus grandis]
Length=542

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY ++ WNVTY  IYPLGV QQGILINGQFPGP+IE VTNDNL INVFN+LD+PFLLS
Sbjct  27   EDPYSFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNALDEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q +RNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  87   WNGVQQKRNSWQDGVYGTNCPIPPGQNFTYILQVKDQIGS  126



>ref|XP_009353293.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=542

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLG+ QQGILINGQFPGP+IE VTNDNL I+VFNSLD+PFL+S
Sbjct  24   EDPYRFYNWNVTYGDIYPLGIKQQGILINGQFPGPQIESVTNDNLIISVFNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQ+G+
Sbjct  84   WNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGS  123



>ref|XP_010416527.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INV+NSLD+PFLLS
Sbjct  24   EDPYRFYEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNSF DGVYGTTCPI PG N+TY+LQ+KDQ+G+
Sbjct  84   WNGVQQRRNSFVDGVYGTTCPIPPGQNYTYVLQMKDQIGS  123



>ref|XP_009794440.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
sylvestris]
Length=541

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++TWN+TY  IYPLGV QQGILINGQFPGP IECVTNDNL ++VFN+LD+PFL+S
Sbjct  23   ESPYRFYTWNITYGDIYPLGVKQQGILINGQFPGPPIECVTNDNLIVSVFNNLDEPFLMS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  83   WDGIQQRRNSWQDGVYGTNCPIPPGQNFTYILQVKDQIGS  122



>dbj|BAK04971.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNV+Y  IYPLGV QQGILINGQFPGP+I+ VTNDNL +NVFN L++PFLLS
Sbjct  33   EDPYRFFTWNVSYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVVNVFNKLNEPFLLS  92

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            W+G+Q RRNSFEDGV GTTCPI  G NFTY+LQVKDQ+G
Sbjct  93   WSGVQQRRNSFEDGVAGTTCPIPAGANFTYILQVKDQIG  131



>ref|XP_009418785.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTWNVTY  I+P+GV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  25   DDPYRFFTWNVTYGDIWPMGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY++QVKDQ+G+
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGGNFTYVMQVKDQIGS  124



>ref|XP_009597920.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=541

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++TWN+TY  IYPLGV QQGILINGQFPGP IECVTNDNL ++VFN+LD+PFL+S
Sbjct  23   ESPYRFYTWNITYGDIYPLGVKQQGILINGQFPGPPIECVTNDNLIVSVFNNLDEPFLMS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  83   WDGIQQRRNSWQDGVYGTNCPIPPGQNFTYILQVKDQIGS  122



>gb|KDP20733.1| hypothetical protein JCGZ_21204 [Jatropha curcas]
Length=541

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR+FTW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL INVFN L +PFL+S
Sbjct  23   ENPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVFNYLREPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPILPG NFTY+LQVKDQ+G+
Sbjct  83   WNGIQQRRNSWQDGVYGTNCPILPGRNFTYILQVKDQIGS  122



>ref|XP_009418784.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=566

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTWNVTY  I+P+GV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  25   DDPYRFFTWNVTYGDIWPMGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY++QVKDQ+G+
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGGNFTYVMQVKDQIGS  124



>ref|XP_010278638.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=541

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTW VTY  IYPLGV Q+GILINGQFPGP+I+CVTNDNL ++V+N LD+PFL+S
Sbjct  23   EDPYRFFTWKVTYGDIYPLGVKQRGILINGQFPGPQIDCVTNDNLIVSVYNYLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGIQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGS  122



>ref|XP_011047251.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
 ref|XP_011047252.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=547

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+ TWNVTY  IYPLGV QQGILING FPGP+IE VTNDNL I+VFNSLD+PFL+S
Sbjct  29   EDPYRFHTWNVTYGDIYPLGVKQQGILINGLFPGPQIESVTNDNLIISVFNSLDEPFLIS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  89   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGS  128



>gb|AGT57427.1| ascorbate oxidase [Prunus persica]
Length=536

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  78

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q+RRNS++DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  79   WNGVQHRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGS  118



>gb|AGJ03718.1| multicopper oxidase [Citrus maxima]
Length=538

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL I+VFN+LD+PFL+S
Sbjct  23   ESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPGPSIEAVTNDNLIISVFNALDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPISPGKNFTYVLQVKDQIGS  122



>gb|AFK33407.1| unknown [Lotus japonicus]
Length=385

 Score =   170 bits (431),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N L +PFLLS
Sbjct  31   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLVINVHNHLPEPFLLS  90

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  91   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYNLQVKDQIGS  130



>emb|CDP19581.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL INVFN+LD+PFL+S
Sbjct  26   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPAIESVTNDNLIINVFNNLDEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG++ RRNS++DGV+GT CPI PG N+TY LQVKDQ+G+
Sbjct  86   WNGLEQRRNSWQDGVWGTNCPIPPGKNYTYALQVKDQIGS  125



>ref|XP_004166771.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=543

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+  WN+TY  I+PLGV QQGILINGQFPGP+IE VTN+NL INVFNSLD+PFL+S
Sbjct  25   EDPYRFLNWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGS  124



>ref|XP_004144498.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=543

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+  WN+TY  I+PLGV QQGILINGQFPGP+IE VTN+NL INVFNSLD+PFL+S
Sbjct  25   EDPYRFLNWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGS  124



>ref|XP_007200295.1| hypothetical protein PRUPE_ppa004000mg [Prunus persica]
 gb|EMJ01494.1| hypothetical protein PRUPE_ppa004000mg [Prunus persica]
Length=536

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  78

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q+RRNS++DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  79   WNGVQHRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGS  118



>gb|EYU38005.1| hypothetical protein MIMGU_mgv1a004001mg [Erythranthe guttata]
Length=550

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWN+TY  I PLGVPQQGILINGQFPGP+I  VTNDN+ INVFN+L +PFLLS
Sbjct  23   EDPYRFFTWNITYGDISPLGVPQQGILINGQFPGPDIYSVTNDNIIINVFNNLPEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ R+NSFEDGV+GTTCPI PG NFTY +Q+KDQ+G+
Sbjct  83   WNGIQQRKNSFEDGVFGTTCPIPPGKNFTYKMQMKDQIGS  122



>ref|XP_009347125.1| PREDICTED: L-ascorbate oxidase homolog, partial [Pyrus x bretschneideri]
Length=544

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLG+ QQGILINGQFPGP IE VTNDNL I+VFNSLD+PFL+S
Sbjct  26   EDPYRFYNWNVTYGDIYPLGIKQQGILINGQFPGPHIESVTNDNLIISVFNSLDEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQ+G+
Sbjct  86   WNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGS  125



>gb|KCW55614.1| hypothetical protein EUGRSUZ_I01478 [Eucalyptus grandis]
Length=449

 Score =   171 bits (434),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFLL+
Sbjct  27   EDPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLLT  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGV GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  87   WNGVQQRRNSYEDGVQGTTCPIPPGKNFTYILQVKDQIGS  126



>ref|XP_004487420.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   173 bits (438),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLG+ QQGILINGQFPGP+IE VTNDNL I+VFNSL++PFL+S
Sbjct  23   EDPYRFYTWNVTYGDIYPLGIKQQGILINGQFPGPQIESVTNDNLIISVFNSLNEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI  G NFTY+LQVKDQ+G+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPAGKNFTYVLQVKDQIGS  122



>gb|EMS52588.1| L-ascorbate oxidase-like protein [Triticum urartu]
Length=890

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNV+Y  IYPLGV QQGILINGQFPGP+IE VTNDNL +NVFN L++PFLLS
Sbjct  27   EDPYRFFTWNVSYGDIYPLGVKQQGILINGQFPGPQIEAVTNDNLVVNVFNKLNEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            W+GIQ RRNSFEDGV GTTCPI PG NFTY+LQ KDQ+G
Sbjct  87   WSGIQQRRNSFEDGVAGTTCPIPPGANFTYILQAKDQIG  125



>ref|XP_010323833.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=543

 Score =   173 bits (438),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++ WN+TY  IYPLGV QQGILINGQFPGP I+ VTNDNL INVFNSLD+PFLLS
Sbjct  25   ESPYRWYNWNITYGDIYPLGVKQQGILINGQFPGPPIDSVTNDNLIINVFNSLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGS  124



>ref|XP_008236098.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=536

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV NSL +PFL+S
Sbjct  19   EDPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIS  78

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  79   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGS  118



>ref|XP_006447580.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 ref|XP_006469673.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Citrus sinensis]
 gb|ESR60820.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 gb|KDO54689.1| hypothetical protein CISIN_1g009283mg [Citrus sinensis]
Length=538

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP IE VTNDNL I+VFN+LD+PFL+S
Sbjct  23   ESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPGPSIEAVTNDNLIISVFNALDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGS  122



>ref|XP_006422489.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
 gb|ESR35729.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
Length=545

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  27   ESPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLIS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  87   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  126



>ref|XP_006486657.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|KDO68240.1| hypothetical protein CISIN_1g009054mg [Citrus sinensis]
Length=545

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  27   ESPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLIS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  87   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  126



>gb|KJB50840.1| hypothetical protein B456_008G189200 [Gossypium raimondii]
Length=550

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYPLGV QQ ILIN QFPGP+IE VTN+NL INVFNSLDQPFL+S
Sbjct  30   EDPYRFYTWNVTYGDIYPLGVKQQVILINSQFPGPQIETVTNENLIINVFNSLDQPFLIS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY LQVKDQ+G+
Sbjct  90   WNGVQQRRNSWQDGVYGTNCPIPPGRNFTYTLQVKDQIGS  129



>ref|XP_010244491.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=543

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP I+ V+NDNL I+V+NSLD+PFL+S
Sbjct  25   EDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPLIDSVSNDNLIISVYNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGS  124



>ref|XP_010667350.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=539

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF WN+TY  IYPLGV QQGILINGQFPGP+I  VTNDN+ INVFN+L+ PFLLS
Sbjct  21   EDPYRYFNWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVFNNLNVPFLLS  80

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+G+QNRRNS++DGVYGTTCPI PG NFTY LQ KDQ+G+
Sbjct  81   WSGVQNRRNSYQDGVYGTTCPIPPGRNFTYKLQFKDQIGS  120



>gb|EMT15848.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=545

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNV+Y  IYPLG  QQGILINGQFPGP+IE VTNDNL +NVFN L++PFLLS
Sbjct  27   EDPYRFFTWNVSYGDIYPLGGKQQGILINGQFPGPQIEAVTNDNLVVNVFNKLNEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            W+G+Q RRNSFEDGV GTTCPI PG NFTY+LQ KDQ+G
Sbjct  87   WSGLQQRRNSFEDGVAGTTCPIPPGANFTYILQAKDQIG  125



>gb|EEE67250.1| hypothetical protein OsJ_24405 [Oryza sativa Japonica Group]
Length=546

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  I PLGV QQGILINGQFPGP IE VTNDNL INVFN L+ PFL+S
Sbjct  25   DDPYRFFTWTVTYGDITPLGVKQQGILINGQFPGPTIEAVTNDNLIINVFNKLNDPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQ+G
Sbjct  85   WNGIQQRRNSFEDGVAGTTCPIPPGGNFTYILQVKDQIG  123



>gb|EEC82126.1| hypothetical protein OsI_26158 [Oryza sativa Indica Group]
Length=546

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  I PLGV QQGILINGQFPGP IE VTNDNL INVFN L+ PFL+S
Sbjct  25   DDPYRFFTWTVTYGDITPLGVKQQGILINGQFPGPTIEAVTNDNLIINVFNKLNDPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQ+G
Sbjct  85   WNGIQQRRNSFEDGVAGTTCPIPPGGNFTYILQVKDQIG  123



>dbj|BAC83966.1| putative PS60 [Oryza sativa Japonica Group]
Length=563

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  I PLGV QQGILINGQFPGP IE VTNDNL INVFN L+ PFL+S
Sbjct  25   DDPYRFFTWTVTYGDITPLGVKQQGILINGQFPGPTIEAVTNDNLIINVFNKLNDPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            WNGIQ RRNSFEDGV GTTCPI PG NFTY+LQVKDQ+G
Sbjct  85   WNGIQQRRNSFEDGVAGTTCPIPPGGNFTYILQVKDQIG  123



>ref|XP_004232701.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=548

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            ++PYRY+TW +TY  IYPLGV QQGILINGQFPGP+I+CVTNDNL I+V+N L +PFL+S
Sbjct  30   DNPYRYYTWKITYGDIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVYNYLSEPFLIS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGTTCPILPG NFTY LQ KDQ+G+
Sbjct  90   WNGIQQRRNSWQDGVYGTTCPILPGKNFTYTLQAKDQIGS  129



>gb|KFK44156.1| hypothetical protein AALP_AA1G222300 [Arabis alpina]
Length=538

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR F W+VTY  IYP+GV QQGILIN QFPGPEI  VTNDNL INVFN LD+PFL+S
Sbjct  24   EDPYRNFEWHVTYGDIYPMGVKQQGILINNQFPGPEIRSVTNDNLIINVFNELDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W GIQNR+NSF+DGVYGTTCPI PG N+TY LQVKDQ+G+
Sbjct  84   WAGIQNRKNSFQDGVYGTTCPIPPGKNYTYALQVKDQIGS  123



>ref|XP_008789823.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Phoenix dactylifera]
Length=549

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  31   DDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  90

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPI P  NFTY+LQVKDQ+G+
Sbjct  91   WNGIQQRRNSWQDGVYGTNCPIPPRRNFTYVLQVKDQIGS  130



>gb|KEH30610.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=447

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  26   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLPEPFLLS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  86   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGS  125



>gb|KJB47729.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
 gb|KJB47730.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=447

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  124



>emb|CDY64276.1| BnaCnng43630D [Brassica napus]
Length=614

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W VTY+ IYPLG+PQ+GILINGQFPGPEI  VTNDNL INV N LD+PFLLS
Sbjct  87   EDPYRFFDWRVTYSNIYPLGIPQRGILINGQFPGPEIYSVTNDNLIINVHNDLDEPFLLS  146

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQ+G+
Sbjct  147  WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGS  186



>gb|KHG21048.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+++WNVTY  IYPLGV Q G+LINGQFPGP+I  VTNDNL INV+N+L++ FLLS
Sbjct  23   EDPYRFYSWNVTYGDIYPLGVRQTGLLINGQFPGPDIHSVTNDNLIINVYNNLNESFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGVYGTTCPI PG NFTYMLQVKDQ+G+
Sbjct  83   WNGVQQRRNSYEDGVYGTTCPIPPGKNFTYMLQVKDQIGS  122



>gb|KFK44289.1| hypothetical protein AALP_AA1G238900 [Arabis alpina]
Length=176

 Score =   163 bits (412),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY++F W+VTY  I PLGV QQGILING+FPGP+I  VTNDNL INVFN LD+PFL+S
Sbjct  23   EDPYKFFEWHVTYGNISPLGVQQQGILINGKFPGPDIYSVTNDNLIINVFNHLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQN RNS++DGVYGTTCPI PG N+TY LQVKDQ+G+
Sbjct  83   WSGIQNWRNSYQDGVYGTTCPIPPGKNYTYALQVKDQIGS  122



>ref|XP_008806480.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=542

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+ TWNVTY  I+PLGV QQGILINGQFPGP+IE VTNDNL INVFNSL +PFLLS
Sbjct  24   EDPYRFLTWNVTYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+  RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  84   WNGVLQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGS  123



>ref|XP_010929557.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=541

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTNDN+ INVFNSL +PFLLS
Sbjct  23   DDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNIIINVFNSLPEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPI P  NFTY+LQVKDQ+G+
Sbjct  83   WNGIQQRRNSWQDGVYGTNCPIPPRRNFTYVLQVKDQIGS  122



>ref|XP_002320467.1| hypothetical protein POPTR_0014s15260g [Populus trichocarpa]
 gb|EEE98782.1| hypothetical protein POPTR_0014s15260g [Populus trichocarpa]
Length=532

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            ED YR+ TWNVTY  IYPLGV QQGILINGQFPGP+IE VTNDNL I+VFNSLD+PFL+S
Sbjct  19   EDAYRFHTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIISVFNSLDEPFLIS  78

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT C I PG NFTY+LQVKDQ+G+
Sbjct  79   WNGVQQRRNSWQDGVYGTNCAIPPGQNFTYVLQVKDQIGS  118



>ref|XP_007131584.1| hypothetical protein PHAVU_011G025400g [Phaseolus vulgaris]
 gb|ESW03578.1| hypothetical protein PHAVU_011G025400g [Phaseolus vulgaris]
Length=545

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W VTY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  30   EDPYRFFDWTVTYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVRNNLTEPFLLS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  90   WNGVQQRRNSYQDGVYGTTCPIPPGQNFTYTLQVKDQIGS  129



>ref|XP_010103298.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB95365.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=632

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WN+TY  IYPLGV Q+GILINGQFPGPEI  VTNDNL INVFNSL +PFL+S
Sbjct  205  EDPYRFFNWNITYGDIYPLGVRQRGILINGQFPGPEIYSVTNDNLIINVFNSLPEPFLIS  264

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNR+NS++DGVYGTTCPI PG NFTY LQ+KDQ+G+
Sbjct  265  WNGVQNRKNSYQDGVYGTTCPIPPGKNFTYKLQMKDQIGS  304


 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+  WNVTY  IYPLGV Q+GILINGQFPGP I  VTNDNL +NV N+L +PFL+S
Sbjct  28   EDPYRFMEWNVTYGNIYPLGVRQRGILINGQFPGPGIYAVTNDNLIVNVHNNLPEPFLIS  87

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+G+QNR+NSFEDGVYGTTCPI PG NFTY LQ KDQ+G+
Sbjct  88   WSGLQNRKNSFEDGVYGTTCPIPPGKNFTYRLQAKDQIGS  127



>emb|CDY54804.1| BnaA06g40970D [Brassica napus]
Length=639

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W VTY  IYPLG+PQ+GILINGQFPGPEI  VTNDNL INV N LD+PFLLS
Sbjct  114  EDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNDNLIINVHNDLDEPFLLS  173

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQ+G+
Sbjct  174  WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGS  213



>ref|XP_010923874.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=542

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWN+TY  I+PLGV QQGILINGQFPGP+IE VTNDNL INV+NSL +PFLLS
Sbjct  24   EDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIESVTNDNLIINVYNSLPEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+  RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  84   WNGVLQRRNSWQDGVYGTNCPIPPGGNFTYVLQVKDQIGS  123



>ref|XP_010028797.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW55613.1| hypothetical protein EUGRSUZ_I01478 [Eucalyptus grandis]
Length=545

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFLL+
Sbjct  27   EDPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLLT  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGV GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  87   WNGVQQRRNSYEDGVQGTTCPIPPGKNFTYILQVKDQIGS  126



>ref|XP_006348131.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=548

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  177  DPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLSW  356
            +PYRY+TW +TY  IYPLGV QQGILINGQFPGP+I+CVTNDNL I+V+N L +PFL+SW
Sbjct  31   NPYRYYTWKITYGNIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVYNYLSEPFLISW  90

Query  357  NGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            NGIQ RRNS++DGVYG+TCPILPG NFTY LQ KDQ+G+
Sbjct  91   NGIQQRRNSWQDGVYGSTCPILPGKNFTYTLQAKDQIGS  129



>gb|KJB14335.1| hypothetical protein B456_002G120000 [Gossypium raimondii]
Length=541

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVT+  IYPLGV Q GILINGQFPGP+I  VTNDNL INV NSL++PFL+S
Sbjct  23   EDPYRFFDWNVTFGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVHNSLNEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  83   WSGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  122



>emb|CDP10787.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY++FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTN+NL ++VFNSL++PFLLS
Sbjct  23   EDPYQFFTWNVTYGDIYPLGVKQQGILINGQFPGPQITSVTNENLIVSVFNSLNEPFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGS  122



>gb|KHN05478.1| L-ascorbate oxidase like [Glycine soja]
Length=544

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  29   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLTEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  89   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGS  128



>ref|XP_009402574.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=541

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW+V Y  IYPLGV QQGILI+GQFPGP+IE VTNDNL +NVFN+L +PFL+S
Sbjct  23   DDPYRFFTWSVIYGDIYPLGVKQQGILIDGQFPGPQIEAVTNDNLIVNVFNNLTEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ R+NS+EDGVYGT CPILPG N+TY++QVKDQ+G+
Sbjct  83   WNGIQQRKNSWEDGVYGTNCPILPGQNYTYVMQVKDQIGS  122



>gb|ACN50176.1| pectinesterase [Annona cherimola]
Length=540

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSL +PFL+S
Sbjct  22   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIFSVTNDNLIINVHNSLPEPFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  82   WNGVQQRRNSWQDGVYGTNCPIPPGKNFTYILQVKDQIGS  121



>gb|KHF99506.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVT+  IYPLGV Q GILINGQFPGP+I  VTNDNL INV NSL++PFL+S
Sbjct  23   EDPYRFFDWNVTFGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVHNSLNEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQ RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  83   WSGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  122



>ref|XP_006592035.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=544

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  29   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLTEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  89   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGS  128



>ref|XP_009101945.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=549

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W VTY  IYPLG+PQ+GILINGQFPGPEI  VTNDNL INV N LD+PFLLS
Sbjct  24   EDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNDNLIINVHNDLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQ+G+
Sbjct  84   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGS  123



>gb|KJB47727.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=543

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  124



>gb|KEH30611.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W +TY  IYPLGV QQGILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  26   EDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLPEPFLLS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  86   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGS  125



>gb|KJB59710.1| hypothetical protein B456_009G268100 [Gossypium raimondii]
Length=491

 Score =   170 bits (430),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+++WNVTY  IYPLGV Q G+LINGQFPGP+I  VTNDNL INV+N+L++ FLLS
Sbjct  23   EDPYRFYSWNVTYGDIYPLGVRQTGLLINGQFPGPDIHSVTNDNLIINVYNNLNESFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            WNG+Q RRNS+EDGV+GTTCPI PG NFTYMLQVKDQ+G
Sbjct  83   WNGVQQRRNSYEDGVFGTTCPIPPGKNFTYMLQVKDQIG  121



>ref|XP_002528421.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF33963.1| multicopper oxidase, putative [Ricinus communis]
Length=544

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTN+NL INV NSL +PFL+S
Sbjct  26   EDPYRFFDWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVHNSLPEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  86   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGS  125



>ref|XP_009397777.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=541

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTWN+TY  I+P+GV QQGILINGQFPGP+IE VTNDN+ INVFNSL +PFL+S
Sbjct  23   DDPYRFFTWNITYGDIWPMGVKQQGILINGQFPGPQIEAVTNDNVIINVFNSLPEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPI PG NFTY++Q KDQ+G+
Sbjct  83   WNGIQQRRNSWQDGVYGTNCPIPPGRNFTYVMQFKDQIGS  122



>gb|KHG21949.1| L-ascorbate oxidase [Gossypium arboreum]
Length=543

 Score =   170 bits (431),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  124



>ref|XP_007213899.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
 gb|EMJ15098.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
Length=447

 Score =   169 bits (427),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTW +TY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+VFN L +PFL+S
Sbjct  24   EDPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLREPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQ RRNS++DGVYGT CPILPG NFTY +QVKDQ+G+
Sbjct  84   WDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGS  123



>gb|KJB47731.1| hypothetical protein B456_008G038600 [Gossypium raimondii]
Length=522

 Score =   170 bits (430),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  I+PLGV QQGILINGQFPGP+I  VTNDNL INV N+LD+PFLLS
Sbjct  25   ESPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+EDGVYGTTCPI PG NFTY+LQVKDQ+G+
Sbjct  85   WNGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGS  124



>ref|XP_002460757.1| hypothetical protein SORBIDRAFT_02g034420 [Sorghum bicolor]
 gb|EER97278.1| hypothetical protein SORBIDRAFT_02g034420 [Sorghum bicolor]
Length=548

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFN L++PFLLS
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            W+G+Q RRNSFEDGV GTTCPI PG NFTY++Q KDQ+G
Sbjct  90   WSGLQQRRNSFEDGVAGTTCPIPPGANFTYIMQAKDQIG  128



>ref|XP_006411628.1| hypothetical protein EUTSA_v10024832mg [Eutrema salsugineum]
 gb|ESQ53081.1| hypothetical protein EUTSA_v10024832mg [Eutrema salsugineum]
Length=551

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W VTY  IYPLG+PQ+GILINGQFPGPEI  VTN+NL INV N LD+PFLLS
Sbjct  24   EDPYRFFDWRVTYGNIYPLGIPQRGILINGQFPGPEIYSVTNNNLIINVHNDLDEPFLLS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NS++DGVYGTTCPI PG N+TY +QVKDQ+G+
Sbjct  84   WNGVQLRKNSYQDGVYGTTCPIPPGKNYTYAIQVKDQIGS  123



>gb|ACL53812.1| unknown [Zea mays]
 tpg|DAA62866.1| TPA: L-ascorbate oxidase [Zea mays]
Length=550

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFN L++PFLLS
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            W+G+Q RRNSFEDGV GTTCPI PG NFTY++Q KDQ+G
Sbjct  90   WSGLQQRRNSFEDGVAGTTCPIPPGSNFTYIMQAKDQIG  128



>ref|XP_004506275.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYP G+ QQGILINGQFPGP+IE VTNDN+ INVFNSLD+PFL+S
Sbjct  23   EDPYRFYTWNVTYGDIYPFGIQQQGILINGQFPGPQIESVTNDNVIINVFNSLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+  RRNS++DGVYGT CPI PG NFTY LQVK+Q+G+
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPIPPGQNFTYALQVKNQIGS  122



>gb|KJB59711.1| hypothetical protein B456_009G268100 [Gossypium raimondii]
Length=541

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+++WNVTY  IYPLGV Q G+LINGQFPGP+I  VTNDNL INV+N+L++ FLLS
Sbjct  23   EDPYRFYSWNVTYGDIYPLGVRQTGLLINGQFPGPDIHSVTNDNLIINVYNNLNESFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            WNG+Q RRNS+EDGV+GTTCPI PG NFTYMLQVKDQ+G
Sbjct  83   WNGVQQRRNSYEDGVFGTTCPIPPGKNFTYMLQVKDQIG  121



>ref|XP_004506310.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++TWNVTY  IYP G+ QQGILINGQFPGP+IE VTNDN+ INVFNSLD+PFL+S
Sbjct  23   EDPYRFYTWNVTYGDIYPFGIQQQGILINGQFPGPQIESVTNDNVIINVFNSLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+  RRNS++DGVYGT CPI PG NFTY LQVK+Q+G+
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPIPPGQNFTYALQVKNQIGS  122



>ref|XP_004290036.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLG+ Q+GILINGQFPGPEI  VTNDNL INV NSL +PFL++
Sbjct  23   EDPYRFFEWNVTYGDIYPLGIKQRGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLIT  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  83   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGS  122



>ref|NP_001152000.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG45329.1| L-ascorbate oxidase precursor [Zea mays]
Length=550

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFN L++PFLLS
Sbjct  30   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            W+G+Q RRNSFEDGV GTTCPI PG NFTY++Q KDQ+G
Sbjct  90   WSGLQQRRNSFEDGVAGTTCPIPPGSNFTYIMQAKDQIG  128



>ref|XP_010266952.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=546

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV+NSL +PFL+S
Sbjct  28   EDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLPEPFLIS  87

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+  RRNS++DGVYGT CPI PG NFTY+LQVKDQ+G+
Sbjct  88   WNGVLQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGS  127



>gb|KDP47151.1| hypothetical protein JCGZ_00042 [Jatropha curcas]
Length=540

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTN+NL INV NSL +PFL+S
Sbjct  22   EDPYRFFDWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVHNSLPEPFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  82   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGS  121



>ref|XP_006364519.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=541

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W +TY  IYPLG+ QQGILINGQFPGP+I  VTNDNL INV N L  PFLL+
Sbjct  29   EDPYRYFDWRITYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVHNDLHDPFLLT  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQ+G+
Sbjct  89   WNGLQQRKNSFEDGVYGTTCPIPPGQNFTYIMQVKDQIGS  128



>gb|EPS74059.1| hypothetical protein M569_00695 [Genlisea aurea]
Length=541

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            ++PYR+F WNV+Y  IYPLGV QQGILINGQFPGP I CVTNDNL INVFNSL++PFL+S
Sbjct  23   DNPYRFFYWNVSYGDIYPLGVKQQGILINGQFPGPSISCVTNDNLIINVFNSLNEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            WNG+Q RRNS++DGV+GTTCPI PG NFTY LQ KDQ+G
Sbjct  83   WNGLQQRRNSWQDGVFGTTCPIPPGKNFTYALQAKDQIG  121



>ref|XP_006855939.1| hypothetical protein AMTR_s00037p00216460 [Amborella trichopoda]
 gb|ERN17406.1| hypothetical protein AMTR_s00037p00216460 [Amborella trichopoda]
Length=545

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VT+  IYPLGV QQGILINGQFPGP+IE VTNDNL INVFN+L +PFLLS
Sbjct  27   DDPYRFFTWQVTWGDIYPLGVKQQGILINGQFPGPQIEAVTNDNLVINVFNNLTEPFLLS  86

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPI PG NFTY LQ KDQ+G+
Sbjct  87   WNGIQQRRNSWQDGVYGTNCPIPPGGNFTYNLQAKDQIGS  126



>ref|XP_004957823.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=550

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            +DPYR+FTW VTY  IYPLGV QQGILIN QFPGP+IE VTNDNL INVFN L++PFLLS
Sbjct  32   DDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLS  91

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            W+G+Q RRNSFEDGV GTTCPI PG NFTY++Q KDQ+G
Sbjct  92   WSGLQQRRNSFEDGVAGTTCPIPPGGNFTYIMQAKDQIG  130



>ref|XP_009782819.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=544

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            ++PYRY+TW +TY  IYPLGV QQGILINGQFPGP+I+CVTNDNL I+V+N L++PFL+S
Sbjct  26   DNPYRYYTWKITYGDIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVYNYLNEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQ KDQ+G+
Sbjct  86   WNGLQQRRNSWQDGVYGTTCPIPPGKNFTYTLQAKDQIGS  125



>ref|XP_009413373.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
 ref|XP_009413374.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=543

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            + PYR+FTWNVTY  IYPLGV QQGILINGQFPGP+IE VTNDNL +NVFNSL +PFL S
Sbjct  24   DSPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIEAVTNDNLIVNVFNSLPEPFLFS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RR+S++DGVYGT CPI PG NFTY +QVKDQ+G+
Sbjct  84   WNGIQQRRSSWQDGVYGTNCPIPPGGNFTYTMQVKDQIGS  123



>ref|XP_004507683.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=547

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTW VTY  IYPLGV QQGILINGQFPGP+I+ VTN+NL I+V+N L +PFL+S
Sbjct  30   EDPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNENLIISVYNYLTEPFLIS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ+RRNS++DGV GTTCPILPG NFTY LQVKDQ+G+
Sbjct  90   WNGIQHRRNSWQDGVSGTTCPILPGKNFTYTLQVKDQIGS  129



>gb|AAF99833.1|AC008046_5 Putative pectinesterase [Arabidopsis thaliana]
Length=541

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  24   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQ+G+
Sbjct  84   WNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGS  123



>ref|XP_009107631.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=542

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQ+G+
Sbjct  85   WNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGS  124



>ref|NP_564479.1| SKU5 similar 6 [Arabidopsis thaliana]
 gb|AEE31910.1| SKU5 similar 6 [Arabidopsis thaliana]
Length=542

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQ+G+
Sbjct  85   WNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGS  124



>gb|AAL24296.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91125.1| unknown protein [Arabidopsis thaliana]
Length=542

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQ+G+
Sbjct  85   WNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGS  124



>emb|CDY35790.1| BnaA08g04510D [Brassica napus]
Length=542

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  25   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQ+G+
Sbjct  85   WNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGS  124



>ref|XP_007213900.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
 gb|EMJ15099.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
Length=543

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTW +TY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+VFN L +PFL+S
Sbjct  24   EDPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLREPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQ RRNS++DGVYGT CPILPG NFTY +QVKDQ+G+
Sbjct  84   WDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGS  123



>emb|CDY67479.1| BnaCnng55180D [Brassica napus]
Length=541

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  24   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQ+G+
Sbjct  84   WNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGS  123



>ref|XP_006342554.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Solanum tuberosum]
Length=706

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR++ WNVTY TI PLGVPQQGILINGQFPGP+I  VTNDN+ INVFN+LD  FL+S
Sbjct  186  ENPYRFYEWNVTYGTISPLGVPQQGILINGQFPGPDIISVTNDNIIINVFNNLDDDFLIS  245

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+G+QNRRNSF+DGV+GTTCPI PG NFTY LQ+KDQ+G+
Sbjct  246  WHGVQNRRNSFQDGVWGTTCPIPPGKNFTYRLQMKDQIGS  285



>ref|XP_002888337.1| hypothetical protein ARALYDRAFT_475543 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64596.1| hypothetical protein ARALYDRAFT_475543 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILING+FPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  26   ESPYRFFDWNVTYGDIYPLGVRQQGILINGKFPGPDIHSVTNDNLIINVHNSLDEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQNRRNS+ DG+YGTTCPI P  N+TY+LQVKDQ+G+
Sbjct  86   WNGIQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGS  125



>gb|KGN43295.1| hypothetical protein Csa_7G018770 [Cucumis sativus]
Length=444

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            + PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDN++INV NSL +PFLLS
Sbjct  29   DSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYINVHNSLPEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NS++DGVYGTTCPI PG NFTY +QVKDQ+G+
Sbjct  89   WNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGS  128



>ref|XP_009612547.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=539

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++ +NVTY TI PLGV Q+GILINGQFPGP+I  VTNDN+ INVFN LD+PFL+S
Sbjct  22   ESPYRFYEFNVTYGTISPLGVKQKGILINGQFPGPDIYSVTNDNVIINVFNYLDEPFLIS  81

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQNRRNSFEDGV+GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  82   WNGIQNRRNSFEDGVWGTTCPIPPGKNFTYILQVKDQIGS  121



>ref|XP_009758923.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=549

 Score =   168 bits (425),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL INV N L +PFLL+
Sbjct  32   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIISVTNDNLIINVHNDLPEPFLLT  91

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQ+G+
Sbjct  92   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGS  131



>ref|XP_009629876.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=544

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            ++PYRY+TW +TY  IYPLGV QQGILINGQFPGP+I+CVTNDNL I+V+N L++PFL+S
Sbjct  26   DNPYRYYTWKITYGDIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVYNYLNEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS+++GVYGTTCPI PG NFTY LQ KDQ+G+
Sbjct  86   WNGLQQRRNSWQNGVYGTTCPIPPGKNFTYTLQAKDQIGS  125



>ref|XP_009630902.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Nicotiana 
tomentosiformis]
Length=543

 Score =   167 bits (424),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL INV N L  PFLL+
Sbjct  25   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPFLLT  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQ+G+
Sbjct  85   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGS  124



>ref|XP_006307199.1| hypothetical protein CARUB_v10008790mg [Capsella rubella]
 gb|EOA40097.1| hypothetical protein CARUB_v10008790mg [Capsella rubella]
Length=541

 Score =   167 bits (424),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDNL INV NSLD+PFL+S
Sbjct  24   ESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLVINVHNSLDEPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+QNRRNSF DG+ GTTCPI P  N+TY+LQVKDQ+G+
Sbjct  84   WNGVQNRRNSFVDGMSGTTCPIPPRSNYTYILQVKDQIGS  123



>ref|XP_004144874.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004152953.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   167 bits (424),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            + PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDN++INV NSL +PFLLS
Sbjct  29   DSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYINVHNSLPEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NS++DGVYGTTCPI PG NFTY +QVKDQ+G+
Sbjct  89   WNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGS  128



>ref|XP_008224692.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=543

 Score =   167 bits (424),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR FTW +TY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+VFN L +PFL+S
Sbjct  24   EDPYRLFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLREPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQ RRNS++DGVYGT CPILPG NFTY +QVKDQ+G+
Sbjct  84   WDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGS  123



>ref|XP_003537754.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   167 bits (424),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W +TY  IYPLGV QQ ILINGQFPGPEI  VTNDNL INV N+L +PFLLS
Sbjct  32   EDPYRFFDWTITYGDIYPLGVKQQVILINGQFPGPEIYSVTNDNLIINVHNNLTEPFLLS  91

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  92   WNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGS  131



>ref|XP_008384084.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=543

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+VFN L +PFL+S
Sbjct  24   EDPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLREPFLIS  83

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQ RRNS++DGV+GTTCPI PG NFTY +QVKDQ+G+
Sbjct  84   WDGIQQRRNSWQDGVFGTTCPIPPGRNFTYNIQVKDQIGS  123



>ref|XP_009630899.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=547

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL INV N L  PFLL+
Sbjct  29   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPFLLT  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQ+G+
Sbjct  89   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGS  128



>ref|XP_008447902.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=546

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            + PYR+F WNVTY  IYPLGV QQGILINGQFPGP+I  VTNDN++INV NSL +PFLLS
Sbjct  29   DSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYINVHNSLPEPFLLS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NS++DGVYGTTCPI PG NFTY +QVKDQ+G+
Sbjct  89   WNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGS  128



>ref|XP_009630901.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=546

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL IN+ N L +PFLL+
Sbjct  29   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIISVTNDNLIINIHNDLPEPFLLT  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQ+G+
Sbjct  89   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGS  128



>ref|XP_009803721.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=558

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E PYR++ +NVTY TI PLGV Q+GILINGQFPGP+I  VTNDN+ INVFN LD+PFL+S
Sbjct  41   ESPYRFYEFNVTYGTISPLGVKQKGILINGQFPGPDIYSVTNDNVIINVFNYLDEPFLIS  100

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQNRRNSF+DGV+GTTCPI PG NFTY+LQVKDQ+G+
Sbjct  101  WNGIQNRRNSFQDGVWGTTCPIPPGKNFTYVLQVKDQIGS  140



>gb|KEH29685.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=537

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 88/100 (88%), Gaps = 1/100 (1%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR++ WNVTY  IYPLGV QQGILING+FPGP+IE VTNDNL INVFNSLD+PFL+S
Sbjct  23   EDPYRFYNWNVTYGDIYPLGVKQQGILINGKFPGPQIESVTNDNLIINVFNSLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+  RRNS++DGVYGT CPI PG N TY+LQVKDQ+G+
Sbjct  83   WNGVLQRRNSWQDGVYGTNCPISPGKN-TYILQVKDQIGS  121



>gb|EYU27771.1| hypothetical protein MIMGU_mgv1a003982mg [Erythranthe guttata]
Length=551

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            ++PYRY+TW +TY  IYPLGV QQGILINGQFPGP I+CVTNDNL I+V+N L++PFLLS
Sbjct  33   DNPYRYYTWRITYGDIYPLGVKQQGILINGQFPGPTIDCVTNDNLIISVYNYLNEPFLLS  92

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLG  470
            WNGIQ RRNS++DGVYGT CPI PG NFTY +Q KDQ+G
Sbjct  93   WNGIQQRRNSWQDGVYGTNCPIPPGKNFTYAIQAKDQIG  131



>ref|XP_009758924.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=548

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRYF W ++Y  IYPLGV QQGILINGQFPGP+I  VTNDNL INV N L  PFLL+
Sbjct  30   EDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPFLLT  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NSFEDGVYGTTCPI PG NFTY++QVKDQ+G+
Sbjct  90   WNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGS  129



>ref|XP_010555198.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=553

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W V+Y  IYPLG PQ+GILINGQFPGP I  VTNDNL INV N LD+PFLLS
Sbjct  28   EDPYRFFDWTVSYGLIYPLGFPQRGILINGQFPGPNIYSVTNDNLIINVHNDLDEPFLLS  87

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q R+NS++DGVYGTTCPI PG NFTY+ QVKDQ+G+
Sbjct  88   WNGVQMRKNSYQDGVYGTTCPIPPGKNFTYVFQVKDQIGS  127



>ref|XP_003529638.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN35730.1| L-ascorbate oxidase like [Glycine soja]
Length=547

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRY TW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL INV+N L +PFL+S
Sbjct  28   EDPYRYLTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVYNYLREPFLIS  87

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q+RRNS++DGVYGT CPI PG N TY +QVKDQ+G+
Sbjct  88   WNGLQHRRNSWQDGVYGTNCPIPPGRNLTYAIQVKDQIGS  127



>ref|XP_003549771.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=549

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRY TW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL INV+N L +PFL+S
Sbjct  30   EDPYRYLTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVYNYLREPFLIS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q+RRNS++DGVYGT CPI PG N TY +QVKDQ+G+
Sbjct  90   WNGLQHRRNSWQDGVYGTNCPIPPGRNLTYAIQVKDQIGS  129



>gb|KHN03487.1| L-ascorbate oxidase like [Glycine soja]
Length=556

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYRY TW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL INV+N L +PFL+S
Sbjct  30   EDPYRYLTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVYNYLREPFLIS  89

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q+RRNS++DGVYGT CPI PG N TY +QVKDQ+G+
Sbjct  90   WNGLQHRRNSWQDGVYGTNCPIPPGRNLTYAIQVKDQIGS  129



>ref|XP_006416260.1| hypothetical protein EUTSA_v10007292mg [Eutrema salsugineum]
 gb|ESQ34613.1| hypothetical protein EUTSA_v10007292mg [Eutrema salsugineum]
Length=545

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+F W+VTY  I PLGV QQGILING+FPGP+I  VTNDNL INVFN LD+PFL+S
Sbjct  28   EDPYRFFEWHVTYGNISPLGVEQQGILINGKFPGPDIYSVTNDNLIINVFNQLDEPFLIS  87

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GI+N RNSF+DGVYGTTCPI PG N+TY L VKDQ+G+
Sbjct  88   WSGIENLRNSFQDGVYGTTCPIPPGKNYTYALHVKDQIGS  127



>ref|XP_010690287.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=537

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY+YF W+V Y  +YPLGV Q+GILIN QFPGP+I  VTNDNL INV N LD+PFL+S
Sbjct  23   EDPYKYFDWHVNYGHVYPLGVQQRGILINNQFPGPDIISVTNDNLIINVHNHLDEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+GIQ R+NSFEDGVYGTTCPI PG NFTY LQVKDQ+G+
Sbjct  83   WDGIQQRKNSFEDGVYGTTCPIPPGQNFTYKLQVKDQIGS  122



>ref|XP_004253203.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=543

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYR++ WNVTY TI PLGVPQQGILINGQFPGP+I  VTNDN+ INV N+LD  FLLS
Sbjct  23   ENPYRFYEWNVTYGTISPLGVPQQGILINGQFPGPDIISVTNDNVIINVINNLDDDFLLS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W+G+QNRRNS++DGV+GTTCPI PG NFTY LQ+KDQ+G+
Sbjct  83   WHGVQNRRNSYQDGVWGTTCPIPPGKNFTYRLQMKDQIGS  122



>ref|XP_007026108.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 ref|XP_007026109.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 gb|EOY28730.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 gb|EOY28731.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
Length=542

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYRY TW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+V+N L++PFL+S
Sbjct  23   ENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLNEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGVQQRRNSWQDGVFGTNCPIRPGKNFTYVLQVKDQIGS  122



>ref|XP_010052867.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW76996.1| hypothetical protein EUGRSUZ_D01344 [Eucalyptus grandis]
Length=544

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            ++PYR+FTW VTY  IYPLGV Q+GILINGQFPGP I+ +TNDN+ I+V+N L +PFL+S
Sbjct  26   DNPYRFFTWKVTYGDIYPLGVKQKGILINGQFPGPHIDAITNDNVIISVYNYLKEPFLIS  85

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNGIQ RRNS++DGVYGT CPILPG NFTY++QVKDQ+G+
Sbjct  86   WNGIQQRRNSWQDGVYGTNCPILPGRNFTYVMQVKDQIGS  125



>ref|XP_007026110.1| SKU5 similar 4 isoform 3 [Theobroma cacao]
 gb|EOY28732.1| SKU5 similar 4 isoform 3 [Theobroma cacao]
Length=543

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            E+PYRY TW VTY  IYPLGV QQGILINGQFPGP+I+ VTNDNL I+V+N L++PFL+S
Sbjct  23   ENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLNEPFLIS  82

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+Q RRNS++DGV+GT CPI PG NFTY+LQVKDQ+G+
Sbjct  83   WNGVQQRRNSWQDGVFGTNCPIRPGKNFTYVLQVKDQIGS  122



>ref|XP_010923873.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=543

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPYR+FTWN+ Y  I+PLGV QQGILINGQFPGP+IE VTNDN+ INVFN+L +PFLLS
Sbjct  25   EDPYRFFTWNIAYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNIIINVFNNLPEPFLLS  84

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            WNG+  R+N ++DGVYGT CPI PG NFTY LQVKDQ+G+
Sbjct  85   WNGVLQRKNCWQDGVYGTNCPIPPGQNFTYALQVKDQIGS  124



>emb|CDY31468.1| BnaC05g15770D [Brassica napus]
Length=551

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  174  EDPYRYFTWNVTYATIYPLGVPQQGILINGQFPGPEIECVTNDNLFINVFNSLDQPFLLS  353
            EDPY ++ W+VTY TI P+GV QQGILIN  FPGPEI  VTNDNL INVFN LD+PFL+S
Sbjct  29   EDPYIFYEWHVTYGTISPMGVQQQGILINKMFPGPEIRSVTNDNLIINVFNELDEPFLIS  88

Query  354  WNGIQNRRNSFEDGVYGTTCPILPGHNFTYMLQVKDQLGA  473
            W GIQNR+NSF+DGVYGTTCPI PG N+TY+LQVKDQ+G+
Sbjct  89   WAGIQNRKNSFQDGVYGTTCPIPPGKNYTYVLQVKDQIGS  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567171140730