BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF048P04

Length=209
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002512455.1|  60S ribosomal protein L18, putative                116   4e-29   
ref|XP_010559184.1|  PREDICTED: 60S ribosomal protein L18-2-like        108   4e-28   Tarenaya hassleriana [spider flower]
ref|XP_009629074.1|  PREDICTED: 60S ribosomal protein L18-2             109   1e-27   Nicotiana tomentosiformis
ref|XP_010523956.1|  PREDICTED: 60S ribosomal protein L18-2-like        108   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_010544997.1|  PREDICTED: 60S ribosomal protein L18-2-like        108   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_009625475.1|  PREDICTED: 60S ribosomal protein L18-2-like        108   1e-27   Nicotiana tomentosiformis
ref|XP_010559185.1|  PREDICTED: 60S ribosomal protein L18-2-like        108   1e-27   Tarenaya hassleriana [spider flower]
gb|KDP23459.1|  hypothetical protein JCGZ_23292                         108   1e-27   Jatropha curcas
ref|XP_011042004.1|  PREDICTED: 60S ribosomal protein L18-2-like        108   1e-27   Populus euphratica
ref|XP_006386732.1|  hypothetical protein POPTR_0002s20400g             108   1e-27   
ref|XP_002301485.1|  60S ribosomal protein L18                          108   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_002320999.1|  60S ribosomal protein L18                          108   1e-27   Populus trichocarpa [western balsam poplar]
gb|KDP28183.1|  hypothetical protein JCGZ_13954                         108   2e-27   Jatropha curcas
ref|XP_002523106.1|  60S ribosomal protein L18, putative                108   2e-27   Ricinus communis
ref|XP_010025256.1|  PREDICTED: 60S ribosomal protein L18-2             108   2e-27   Eucalyptus grandis [rose gum]
ref|XP_009783807.1|  PREDICTED: 60S ribosomal protein L18-2-like        108   3e-27   Nicotiana sylvestris
ref|XP_009772706.1|  PREDICTED: 60S ribosomal protein L18-2-like        107   4e-27   Nicotiana sylvestris
ref|XP_006344694.1|  PREDICTED: 60S ribosomal protein L18-2-like        107   4e-27   Solanum tuberosum [potatoes]
ref|XP_010313195.1|  PREDICTED: 60S ribosomal protein L18-2-like        107   4e-27   Solanum lycopersicum
gb|KJB45331.1|  hypothetical protein B456_007G301700                    107   4e-27   Gossypium raimondii
ref|XP_007163123.1|  hypothetical protein PHAVU_001G208200g             107   4e-27   Phaseolus vulgaris [French bean]
ref|XP_010684349.1|  PREDICTED: 60S ribosomal protein L18-2-like        107   5e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB41868.1|  hypothetical protein B456_007G127300                    107   6e-27   Gossypium raimondii
emb|CDX99969.1|  BnaC09g03320D                                          107   6e-27   
gb|KJB23304.1|  hypothetical protein B456_004G091200                    106   7e-27   Gossypium raimondii
ref|NP_001237789.1|  uncharacterized protein LOC100500164               107   7e-27   Glycine max [soybeans]
emb|CBI39539.3|  unnamed protein product                                108   7e-27   Vitis vinifera
gb|KHN43503.1|  60S ribosomal protein L18-2                             106   8e-27   Glycine soja [wild soybean]
gb|KHN20393.1|  60S ribosomal protein L18-2                             108   8e-27   Glycine soja [wild soybean]
emb|CDP17112.1|  unnamed protein product                                107   9e-27   Coffea canephora [robusta coffee]
ref|NP_001236701.1|  uncharacterized protein LOC100306301               106   9e-27   
ref|XP_009338229.1|  PREDICTED: 60S ribosomal protein L18-2-like        106   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_008386678.1|  PREDICTED: 60S ribosomal protein L18-2-like        106   1e-26   
ref|XP_007205962.1|  hypothetical protein PRUPE_ppa012012mg             106   1e-26   Prunus persica
ref|XP_008388515.1|  PREDICTED: 60S ribosomal protein L18-2-like        106   1e-26   Malus domestica [apple tree]
gb|KHF98574.1|  60S ribosomal L18-2 -like protein                       106   1e-26   Gossypium arboreum [tree cotton]
gb|KJB41867.1|  hypothetical protein B456_007G127300                    106   1e-26   Gossypium raimondii
ref|XP_010659657.1|  PREDICTED: 60S ribosomal protein L18-2-like        106   1e-26   Vitis vinifera
ref|XP_009630920.1|  PREDICTED: 60S ribosomal protein L18-2-like        106   1e-26   Nicotiana tomentosiformis
ref|XP_009335702.1|  PREDICTED: 60S ribosomal protein L18-2             106   1e-26   Pyrus x bretschneideri [bai li]
gb|KJB45330.1|  hypothetical protein B456_007G301700                    106   1e-26   Gossypium raimondii
ref|XP_010043043.1|  PREDICTED: 60S ribosomal protein L18-2             106   1e-26   Eucalyptus grandis [rose gum]
ref|XP_002270635.1|  PREDICTED: 60S ribosomal protein L18-2             106   1e-26   Vitis vinifera
emb|CDP05500.1|  unnamed protein product                                103   2e-26   Coffea canephora [robusta coffee]
ref|XP_009629121.1|  PREDICTED: 60S ribosomal protein L18-2             106   2e-26   Nicotiana tomentosiformis
ref|XP_002271179.1|  PREDICTED: 60S ribosomal protein L18-2             106   2e-26   Vitis vinifera
ref|XP_011023716.1|  PREDICTED: 60S ribosomal protein L18-2             105   2e-26   Populus euphratica
ref|XP_002319502.1|  60S ribosomal protein L18                          105   2e-26   Populus trichocarpa [western balsam poplar]
gb|ABK92688.1|  unknown                                                 105   2e-26   Populus trichocarpa [western balsam poplar]
ref|NP_001236071.1|  uncharacterized protein LOC100499789               105   2e-26   Glycine max [soybeans]
gb|KJB82634.1|  hypothetical protein B456_013G206100                    105   2e-26   Gossypium raimondii
ref|XP_007144959.1|  hypothetical protein PHAVU_007G197900g             105   2e-26   Phaseolus vulgaris [French bean]
gb|KHN03962.1|  60S ribosomal protein L18-2                             105   2e-26   Glycine soja [wild soybean]
ref|XP_007147006.1|  hypothetical protein PHAVU_006G088800g             105   3e-26   Phaseolus vulgaris [French bean]
gb|KJB82632.1|  hypothetical protein B456_013G206100                    105   3e-26   Gossypium raimondii
ref|XP_011036896.1|  PREDICTED: 60S ribosomal protein L18-2             105   3e-26   Populus euphratica
ref|XP_003556523.1|  PREDICTED: 60S ribosomal protein L18-2-like        105   3e-26   Glycine max [soybeans]
gb|KJB23303.1|  hypothetical protein B456_004G091200                    105   3e-26   Gossypium raimondii
emb|CDP22224.1|  unnamed protein product                                102   3e-26   Coffea canephora [robusta coffee]
ref|XP_006394935.1|  hypothetical protein EUTSA_v10004865mg             106   3e-26   
ref|XP_010273829.1|  PREDICTED: 60S ribosomal protein L18-2-like        105   3e-26   Nelumbo nucifera [Indian lotus]
ref|XP_006382454.1|  60S ribosomal protein L18                          105   3e-26   Populus trichocarpa [western balsam poplar]
ref|XP_007050975.1|  Ribosomal protein L18 isoform 2                    105   3e-26   
ref|XP_010546736.1|  PREDICTED: 60S ribosomal protein L18-3             105   3e-26   Tarenaya hassleriana [spider flower]
emb|CBI36879.3|  unnamed protein product                                107   3e-26   Vitis vinifera
ref|XP_010524859.1|  PREDICTED: 60S ribosomal protein L18-3             105   3e-26   Tarenaya hassleriana [spider flower]
emb|CDY25018.1|  BnaC02g39900D                                          105   4e-26   Brassica napus [oilseed rape]
ref|XP_007050974.1|  Ribosomal protein L18 isoform 1                    105   4e-26   Theobroma cacao [chocolate]
ref|XP_004144773.1|  PREDICTED: 60S ribosomal protein L18-3-like        105   4e-26   Cucumis sativus [cucumbers]
ref|XP_003591163.1|  Ribosomal protein L18                              105   4e-26   Medicago truncatula
ref|XP_009111741.1|  PREDICTED: 60S ribosomal protein L18-2-like        105   4e-26   Brassica rapa
ref|XP_007031040.1|  Ribosomal protein L18                              105   4e-26   Theobroma cacao [chocolate]
ref|XP_008454015.1|  PREDICTED: 60S ribosomal protein L18-3             105   4e-26   Cucumis melo [Oriental melon]
ref|XP_010550997.1|  PREDICTED: 60S ribosomal protein L18-3-like ...    104   5e-26   Tarenaya hassleriana [spider flower]
ref|XP_009151179.1|  PREDICTED: 60S ribosomal protein L18-2             104   5e-26   Brassica rapa
emb|CDY19736.1|  BnaA09g03890D                                          105   5e-26   Brassica napus [oilseed rape]
gb|AFK45456.1|  unknown                                                 104   6e-26   Lotus japonicus
emb|CDY66803.1|  BnaAnng22990D                                          105   6e-26   Brassica napus [oilseed rape]
ref|XP_009129884.1|  PREDICTED: 60S ribosomal protein L18-2-like        105   6e-26   Brassica rapa
gb|KHG07157.1|  60S ribosomal L18-2 -like protein                       104   7e-26   Gossypium arboreum [tree cotton]
emb|CDP07204.1|  unnamed protein product                                101   7e-26   Coffea canephora [robusta coffee]
ref|XP_008370417.1|  PREDICTED: 60S ribosomal protein L18-2             104   8e-26   Malus domestica [apple tree]
ref|XP_007201344.1|  hypothetical protein PRUPE_ppa012001mg             103   9e-26   Prunus persica
ref|XP_010674074.1|  PREDICTED: 60S ribosomal protein L18-2             103   1e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008775991.1|  PREDICTED: 60S ribosomal protein L18-2             103   1e-25   Phoenix dactylifera
ref|XP_008369026.1|  PREDICTED: 60S ribosomal protein L18-2             103   1e-25   
emb|CDX80616.1|  BnaC07g28280D                                          105   1e-25   
gb|AGV54741.1|  60S ribosomal protein L18-3-like protein                104   1e-25   Phaseolus vulgaris [French bean]
ref|XP_010938374.1|  PREDICTED: 60S ribosomal protein L18-2-like        103   1e-25   Elaeis guineensis
emb|CDY40718.1|  BnaC03g34340D                                          104   1e-25   Brassica napus [oilseed rape]
gb|KHG01788.1|  60S ribosomal L18-2 -like protein                       102   1e-25   Gossypium arboreum [tree cotton]
gb|KJB41866.1|  hypothetical protein B456_007G127300                    104   1e-25   Gossypium raimondii
ref|XP_006359857.1|  PREDICTED: 60S ribosomal protein L18-2-like        103   2e-25   Solanum tuberosum [potatoes]
ref|XP_009775352.1|  PREDICTED: 60S ribosomal protein L18-2             103   2e-25   Nicotiana sylvestris
emb|CDX74138.1|  BnaA03g29090D                                          103   2e-25   
gb|AFK49563.1|  unknown                                                 103   2e-25   Lotus japonicus
ref|XP_010528904.1|  PREDICTED: 60S ribosomal protein L18-2             103   2e-25   Tarenaya hassleriana [spider flower]
gb|KHN20252.1|  60S ribosomal protein L18-3                             103   2e-25   Glycine soja [wild soybean]
gb|KGN66048.1|  hypothetical protein Csa_1G569250                       104   2e-25   Cucumis sativus [cucumbers]
ref|XP_008810211.1|  PREDICTED: 60S ribosomal protein L18-2-like        103   2e-25   Phoenix dactylifera
ref|XP_008450608.1|  PREDICTED: 60S ribosomal protein L18-2             103   2e-25   Cucumis melo [Oriental melon]
ref|XP_003554636.2|  PREDICTED: 60S ribosomal protein L18-2-like        103   2e-25   Glycine max [soybeans]
emb|CDY18813.1|  BnaAnng02780D                                          104   3e-25   Brassica napus [oilseed rape]
gb|ABK22247.1|  unknown                                                 102   3e-25   Picea sitchensis
ref|XP_008784768.1|  PREDICTED: 60S ribosomal protein L18-2-like        102   3e-25   Phoenix dactylifera
ref|XP_004247404.1|  PREDICTED: 60S ribosomal protein L18-2             102   3e-25   Solanum lycopersicum
gb|AFW81440.1|  hypothetical protein ZEAMMB73_288952                    100   3e-25   
ref|XP_006288739.1|  hypothetical protein CARUB_v10002048mg             102   3e-25   Capsella rubella
ref|XP_010914484.1|  PREDICTED: 60S ribosomal protein L18-3             102   3e-25   Elaeis guineensis
emb|CDY05559.1|  BnaA02g31320D                                          106   3e-25   
ref|XP_010269589.1|  PREDICTED: 60S ribosomal protein L18-3             102   3e-25   Nelumbo nucifera [Indian lotus]
ref|XP_002874343.1|  60S ribosomal protein L18                          102   3e-25   Arabidopsis lyrata subsp. lyrata
ref|XP_011079632.1|  PREDICTED: 60S ribosomal protein L18-2             102   3e-25   Sesamum indicum [beniseed]
ref|XP_011079633.1|  PREDICTED: 60S ribosomal protein L18-2-like        102   4e-25   Sesamum indicum [beniseed]
gb|KFK26512.1|  hypothetical protein AALP_AA8G258600                    102   4e-25   Arabis alpina [alpine rockcress]
ref|NP_001235897.1|  uncharacterized protein LOC100527681               102   4e-25   
ref|XP_010259492.1|  PREDICTED: 60S ribosomal protein L18-3             102   4e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010495537.1|  PREDICTED: 60S ribosomal protein L18-3-like        100   4e-25   Camelina sativa [gold-of-pleasure]
ref|XP_004494383.1|  PREDICTED: 60S ribosomal protein L18-like          102   4e-25   Cicer arietinum [garbanzo]
ref|XP_009796134.1|  PREDICTED: 60S ribosomal protein L18-2-like        102   4e-25   Nicotiana sylvestris
ref|XP_004135776.1|  PREDICTED: uncharacterized protein LOC101207642    105   5e-25   
gb|ABK26318.1|  unknown                                                 102   5e-25   Picea sitchensis
ref|XP_010921627.1|  PREDICTED: uncharacterized protein LOC105045157    105   5e-25   
ref|XP_010931680.1|  PREDICTED: 60S ribosomal protein L18-2             102   5e-25   Elaeis guineensis
ref|XP_006840598.1|  hypothetical protein AMTR_s00343p00015240          101   5e-25   
ref|XP_009384409.1|  PREDICTED: 60S ribosomal protein L18-2             102   5e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006298640.1|  hypothetical protein CARUB_v10014730mg             102   6e-25   Capsella rubella
ref|XP_010455077.1|  PREDICTED: 60S ribosomal protein L18-3-like ...    102   6e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010421566.1|  PREDICTED: 60S ribosomal protein L18-2-like        102   6e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002985888.1|  hypothetical protein SELMODRAFT_181978             102   6e-25   Selaginella moellendorffii
ref|XP_009124870.1|  PREDICTED: 60S ribosomal protein L18-2-like        102   6e-25   Brassica rapa
ref|XP_002976425.1|  hypothetical protein SELMODRAFT_267976             102   6e-25   Selaginella moellendorffii
emb|CDO98841.1|  unnamed protein product                                103   7e-25   Coffea canephora [robusta coffee]
ref|XP_009134833.1|  PREDICTED: 60S ribosomal protein L18-2             101   7e-25   Brassica rapa
gb|AFW77276.1|  hypothetical protein ZEAMMB73_917876                    101   7e-25   
ref|XP_002882427.1|  hypothetical protein ARALYDRAFT_477850             101   8e-25   Arabidopsis lyrata subsp. lyrata
ref|NP_198137.1|  60S ribosomal protein L18-3                           101   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004494575.1|  PREDICTED: 60S ribosomal protein L18-like        98.6    9e-25   
gb|AFW81438.1|  hypothetical protein ZEAMMB73_288952                    100   9e-25   
ref|XP_009411663.1|  PREDICTED: 60S ribosomal protein L18-3-like        101   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010094463.1|  60S ribosomal protein L18-2                        101   1e-24   
ref|XP_008656150.1|  PREDICTED: 60S ribosomal protein L18-3-like        102   1e-24   
gb|AAO46881.1|  60S ribosomal protein                                   100   1e-24   Medicago sativa [alfalfa]
ref|XP_009417724.1|  PREDICTED: 60S ribosomal protein L18-2             101   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010104147.1|  60S ribosomal protein L18-2                        101   1e-24   
ref|XP_010486014.1|  PREDICTED: 60S ribosomal protein L18-3             101   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010464086.1|  PREDICTED: 60S ribosomal protein L18-3-like        101   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006855263.1|  hypothetical protein AMTR_s00183p00048560          100   1e-24   Amborella trichopoda
ref|NP_187210.1|  60S ribosomal protein L18-2                           100   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429374.1|  PREDICTED: 60S ribosomal protein L18-3-like        100   2e-24   Camelina sativa [gold-of-pleasure]
gb|AAA69928.1|  cytoplasmic ribosomal protein L18                       100   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003626231.1|  60S ribosomal protein L18                          100   2e-24   Medicago truncatula
gb|ACJ85943.1|  unknown                                                 100   2e-24   Medicago truncatula
ref|XP_003568896.1|  PREDICTED: 60S ribosomal protein L18-2-like        100   2e-24   Brachypodium distachyon [annual false brome]
ref|XP_009630742.1|  PREDICTED: 60S ribosomal protein L18-2-like        100   2e-24   Nicotiana tomentosiformis
gb|EMT12638.1|  60S ribosomal protein L18-2                             100   2e-24   
ref|XP_010088293.1|  60S ribosomal protein L18-3                        100   2e-24   
gb|AFC88838.1|  60S ribosomal protein L18-like protein                  100   2e-24   Miscanthus sinensis
gb|KEH24393.1|  60S ribosomal protein L18-3                             100   2e-24   Medicago truncatula
gb|AFK34017.1|  unknown                                                 100   2e-24   Medicago truncatula
ref|NP_001132852.1|  uncharacterized protein LOC100194344               100   2e-24   Zea mays [maize]
gb|ABK21809.1|  unknown                                                 100   2e-24   Picea sitchensis
gb|EMS45435.1|  60S ribosomal protein L18-2                             100   2e-24   Triticum urartu
ref|XP_002439318.1|  hypothetical protein SORBIDRAFT_09g004290          100   2e-24   Sorghum bicolor [broomcorn]
ref|XP_008669243.1|  PREDICTED: uncharacterized protein LOC103646289    100   3e-24   
ref|XP_002465302.1|  hypothetical protein SORBIDRAFT_01g035860          100   3e-24   Sorghum bicolor [broomcorn]
ref|XP_004977069.1|  PREDICTED: 60S ribosomal protein L18-2-like        100   3e-24   Setaria italica
ref|XP_004494578.1|  PREDICTED: 60S ribosomal protein L18-like          100   3e-24   
ref|XP_009611670.1|  PREDICTED: 60S ribosomal protein L18-2-like        100   3e-24   Nicotiana tomentosiformis
ref|NP_001131538.1|  uncharacterized protein LOC100192878               100   3e-24   Zea mays [maize]
ref|XP_003562459.1|  PREDICTED: 60S ribosomal protein L18-3-like        100   3e-24   
ref|XP_002461201.1|  hypothetical protein SORBIDRAFT_02g042750          100   3e-24   Sorghum bicolor [broomcorn]
emb|CBI22977.3|  unnamed protein product                                101   4e-24   Vitis vinifera
pdb|3J61|Q  Chain Q, Localization Of The Large Subunit Ribosomal ...    100   4e-24   Triticum aestivum [Canadian hard winter wheat]
gb|EMT18368.1|  60S ribosomal protein L18-2                             100   4e-24   
dbj|BAJ90421.1|  predicted protein                                      100   4e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006433452.1|  hypothetical protein CICLE_v10002597mg           99.4    4e-24   
gb|KDO39192.1|  hypothetical protein CISIN_1g030771mg                 99.4    5e-24   Citrus sinensis [apfelsine]
ref|XP_004984437.1|  PREDICTED: 60S ribosomal protein L18-2-like      99.8    5e-24   
ref|NP_001054688.1|  Os05g0155100                                     99.8    5e-24   
ref|XP_010228645.1|  PREDICTED: 60S ribosomal protein L18-2-like      99.4    7e-24   Brachypodium distachyon [annual false brome]
ref|XP_008789961.1|  PREDICTED: uncharacterized protein LOC103707302    104   7e-24   
ref|XP_009381102.1|  PREDICTED: 60S ribosomal protein L18-2-like      99.4    7e-24   
ref|XP_004958675.1|  PREDICTED: 60S ribosomal protein L18-3-like      99.0    8e-24   Setaria italica
gb|KJB26287.1|  hypothetical protein B456_004G239000                  99.8    9e-24   Gossypium raimondii
ref|XP_006408052.1|  hypothetical protein EUTSA_v10021598mg           99.0    9e-24   Eutrema salsugineum [saltwater cress]
ref|XP_009402513.1|  PREDICTED: 60S ribosomal protein L18-2-like      98.6    1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006433453.1|  hypothetical protein CICLE_v10002597mg           98.2    2e-23   Citrus clementina [clementine]
emb|CEF99132.1|  Ribosomal protein L18e, conserved site               98.2    2e-23   Ostreococcus tauri
ref|XP_007050976.1|  Ribosomal protein L18 isoform 3                  97.8    2e-23   
ref|XP_006654064.1|  PREDICTED: 60S ribosomal protein L18-2-like      97.8    2e-23   Oryza brachyantha
gb|KFK37967.1|  hypothetical protein AALP_AA3G053100                  97.8    2e-23   Arabis alpina [alpine rockcress]
ref|NP_001050069.1|  Os03g0341100                                     97.4    3e-23   
ref|NP_001060617.1|  Os07g0674700                                     96.7    7e-23   
gb|EPS67068.1|  hypothetical protein M569_07709                       96.7    8e-23   Genlisea aurea
ref|XP_001785869.1|  predicted protein                                96.3    9e-23   
gb|EMS65848.1|  60S ribosomal protein L18-2                           96.7    1e-22   Triticum urartu
gb|KFK32338.1|  hypothetical protein AALP_AA6G228700                  95.9    1e-22   Arabis alpina [alpine rockcress]
gb|EYU21621.1|  hypothetical protein MIMGU_mgv1a014504mg              95.5    2e-22   Erythranthe guttata [common monkey flower]
sp|O22254.3|RL181_ARATH  RecName: Full=Putative 60S ribosomal pro...  95.5    2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006650060.1|  PREDICTED: 60S ribosomal protein L18-3-like      95.1    3e-22   Oryza brachyantha
ref|XP_001419602.1|  Ribosomal protein L18, component of cytosoli...  95.1    3e-22   Ostreococcus lucimarinus CCE9901
emb|CDY27753.1|  BnaA05g31620D                                        93.2    3e-22   Brassica napus [oilseed rape]
ref|XP_001760959.1|  predicted protein                                94.7    4e-22   
ref|XP_006444385.1|  hypothetical protein CICLE_v10022435mg           94.4    5e-22   Citrus clementina [clementine]
ref|XP_001751734.1|  predicted protein                                94.4    5e-22   
ref|XP_006658116.1|  PREDICTED: 60S ribosomal protein L18-3-like      94.0    7e-22   Oryza brachyantha
ref|XP_001781485.1|  predicted protein                                94.0    7e-22   
ref|XP_001760902.1|  predicted protein                                94.0    8e-22   
ref|XP_001690885.1|  ribosomal protein L18, component of cytosoli...  93.6    9e-22   Chlamydomonas reinhardtii
ref|XP_002948325.1|  component of cytosolic 80S ribosome and 60S ...  93.6    1e-21   Volvox carteri f. nagariensis
sp|O65729.1|RL18_CICAR  RecName: Full=60S ribosomal protein L18       93.2    1e-21   Cicer arietinum [garbanzo]
gb|EYU46738.1|  hypothetical protein MIMGU_mgv1a014520mg              92.4    3e-21   Erythranthe guttata [common monkey flower]
ref|XP_005643635.1|  ribosomal protein L18 component of cytosolic...  91.3    8e-21   Coccomyxa subellipsoidea C-169
gb|KIZ05100.1|  60S ribosomal protein L18-3                           89.7    3e-20   Monoraphidium neglectum
emb|CDP04821.1|  unnamed protein product                              86.7    6e-20   Coffea canephora [robusta coffee]
gb|EWM27599.1|  Ribosomal protein L18e/L15P                           88.6    8e-20   Nannochloropsis gaditana
emb|CDY05183.1|  BnaC05g46200D                                        88.6    1e-19   
ref|XP_002506220.1|  ribosomal protein L18                            89.4    2e-19   Micromonas commoda
ref|XP_003056676.1|  predicted protein                                87.0    3e-19   Micromonas pusilla CCMP1545
ref|XP_005843726.1|  hypothetical protein CHLNCDRAFT_37334            85.9    7e-19   Chlorella variabilis
ref|XP_011396696.1|  60S ribosomal protein L18-3                      85.9    8e-19   Auxenochlorella protothecoides
emb|CBI22337.3|  unnamed protein product                              84.7    9e-19   Vitis vinifera
ref|XP_004495692.1|  PREDICTED: 60S ribosomal protein L18-like        85.9    9e-19   Cicer arietinum [garbanzo]
ref|XP_007510670.1|  predicted protein                                86.7    9e-19   Bathycoccus prasinos
emb|CAN68117.1|  hypothetical protein VITISV_012514                   84.7    5e-18   Vitis vinifera
ref|XP_005535130.1|  60S ribosomal protein L18                        79.7    1e-16   Cyanidioschyzon merolae strain 10D
ref|XP_006677675.1|  hypothetical protein BATDEDRAFT_87003            79.7    2e-16   Batrachochytrium dendrobatidis JAM81
gb|ABW90395.1|  putative ribosomal protein L18                        79.3    3e-16   Barentsia elongata
ref|XP_005787945.1|  hypothetical protein EMIHUDRAFT_433854           78.6    5e-16   Emiliania huxleyi CCMP1516
ref|XP_005704346.1|  60S ribosomal protein L18e                       78.6    5e-16   Galdieria sulphuraria
gb|AAN35197.1|  ribosomal protein L18                                 75.1    8e-16   Euprymna scolopes
emb|CEP17694.1|  hypothetical protein                                 77.0    1e-15   Parasitella parasitica
ref|XP_008607735.1|  60S ribosomal protein                            77.4    1e-15   Saprolegnia diclina VS20
gb|ESA23412.1|  hypothetical protein GLOINDRAFT_342179                77.0    1e-15   
emb|CEG66137.1|  Putative 60S ribosomal protein L18-A                 77.4    1e-15   Rhizopus microsporus
emb|CEI89354.1|  Putative 60S ribosomal protein L18-A                 77.0    1e-15   Rhizopus microsporus
ref|XP_968042.1|  PREDICTED: 60S ribosomal protein L18                77.0    2e-15   Tribolium castaneum [rust-red flour beetle]
gb|EIE90592.1|  60S ribosomal protein L18-B                           77.0    2e-15   Rhizopus delemar RA 99-880
ref|XP_011351685.1|  PREDICTED: 60S ribosomal protein L18             77.0    2e-15   Ooceraea biroi
emb|CCT68782.1|  probable ribosomal protein L18, cytosolic            77.4    2e-15   Fusarium fujikuroi IMI 58289
emb|CCU77907.1|  putative 60S ribosomal protein L18                   77.0    2e-15   Blumeria graminis f. sp. hordei DH14
emb|CEI93758.1|  Putative 50S ribosomal protein L18e                  76.6    2e-15   Rhizopus microsporus
emb|CEG65761.1|  Putative 50S ribosomal protein L18e                  76.6    2e-15   Rhizopus microsporus
emb|CEG79287.1|  Putative 60S ribosomal protein L18-A                 76.6    2e-15   Rhizopus microsporus
ref|XP_010277700.1|  PREDICTED: uncharacterized protein LOC104612082  79.7    2e-15   
ref|XP_004290808.1|  PREDICTED: 60S ribosomal protein L18-2           76.6    2e-15   Fragaria vesca subsp. vesca
gb|ELR09673.1|  hypothetical protein GMDG_04159                       77.0    2e-15   Pseudogymnoascus destructans 20631-21
ref|XP_008085192.1|  Ribosomal proteins L15p and L18e                 76.6    2e-15   Glarea lozoyensis ATCC 20868
emb|CEP19927.1|  hypothetical protein                                 76.6    2e-15   Parasitella parasitica
ref|XP_007295858.1|  eukaryotic ribosomal protein L18                 76.6    3e-15   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_011135288.1|  PREDICTED: 60S ribosomal protein L18             76.3    3e-15   Harpegnathos saltator
ref|XP_006561192.1|  PREDICTED: 60S ribosomal protein L18-like        76.3    3e-15   Apis mellifera [bee]
emb|CEJ01696.1|  Putative 50S ribosomal protein L18e                  76.3    3e-15   Rhizopus microsporus
ref|XP_003691391.1|  PREDICTED: 60S ribosomal protein L18-like        76.3    3e-15   Apis florea [dwarf honeybee]
gb|EIE85188.1|  60S ribosomal protein L18-A                           75.9    3e-15   Rhizopus delemar RA 99-880
ref|XP_003707499.1|  PREDICTED: 60S ribosomal protein L18-like        76.3    4e-15   
gb|KIN06517.1|  hypothetical protein OIDMADRAFT_24819                 75.9    4e-15   Oidiodendron maius Zn
ref|XP_003710973.1|  60S ribosomal protein L18                        75.9    4e-15   Magnaporthe oryzae 70-15
ref|XP_011062886.1|  PREDICTED: 60S ribosomal protein L18             76.6    4e-15   Acromyrmex echinatior
ref|XP_005822438.1|  large subunit ribosomal protein L18e, cytopl...  76.3    4e-15   Guillardia theta CCMP2712
ref|XP_003344879.1|  60S ribosomal protein L18                        75.9    4e-15   Sordaria macrospora k-hell
dbj|GAN04379.1|  60S ribosomal protein L18                            75.9    4e-15   Mucor ambiguus
ref|XP_956573.1|  60S ribosomal protein L18                           75.9    4e-15   Neurospora crassa OR74A
gb|ABX44820.1|  putative 60S ribosomal protein RPL18                  75.9    4e-15   Flustra foliacea
ref|XP_011351645.1|  PREDICTED: 60S ribosomal protein L18-like        75.9    5e-15   Ooceraea biroi
gb|ABW23172.1|  ribosomal protein rpl18                               75.9    5e-15   Arenicola marina [rock worm]
ref|XP_009225814.1|  60S ribosomal protein L18                        75.5    5e-15   Gaeumannomyces tritici R3-111a-1
gb|KIJ70376.1|  hypothetical protein HYDPIDRAFT_143674                75.5    5e-15   Hydnomerulius pinastri MD-312
ref|XP_011255380.1|  PREDICTED: 60S ribosomal protein L18             75.5    6e-15   Camponotus floridanus
gb|EGU80235.1|  hypothetical protein FOXB_09162                       75.5    6e-15   Fusarium oxysporum Fo5176
gb|ERT01872.1|  60S ribosomal protein L18-B                           75.5    6e-15   Sporothrix schenckii ATCC 58251
gb|KEF62683.1|  large subunit ribosomal protein L18e                  75.5    6e-15   Exophiala aquamarina CBS 119918
ref|XP_002887259.1|  predicted protein                                72.8    7e-15   
ref|XP_005312106.1|  PREDICTED: 60S ribosomal protein L18             75.5    7e-15   Chrysemys picta bellii
ref|XP_008546759.1|  PREDICTED: 60S ribosomal protein L18             75.1    7e-15   Microplitis demolitor
ref|XP_005235710.1|  PREDICTED: ribosomal protein L18-like            73.2    7e-15   
gb|KIL96123.1|  hypothetical protein FAVG1_00865                      75.1    7e-15   Fusarium avenaceum
gb|EWG39972.1|  50S ribosomal protein L18e                            75.1    8e-15   Fusarium verticillioides 7600
gb|KIX00906.1|  60S ribosomal protein L18-A                           75.1    8e-15   
ref|XP_011313252.1|  PREDICTED: 60S ribosomal protein L18             75.1    8e-15   
emb|CEJ92208.1|  Putative 60S ribosomal protein L18                   75.1    9e-15   
sp|Q4GXG7.1|RL18_TIMBA  RecName: Full=60S ribosomal protein L18       75.1    9e-15   
emb|CCE31760.1|  probable ribosomal protein L18, cytosolic            75.1    9e-15   
ref|XP_008201914.1|  PREDICTED: 60S ribosomal protein L18             75.1    9e-15   
ref|XP_011163555.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...  75.5    9e-15   
ref|XP_007423078.1|  PREDICTED: 60S ribosomal protein L18             75.1    1e-14   
gb|ETE73081.1|  60S ribosomal protein L18                             75.1    1e-14   
gb|KIL00482.1|  hypothetical protein PAXRUDRAFT_821678                74.7    1e-14   
gb|EPE10006.1|  60s ribosomal protein l18                             74.7    1e-14   
ref|XP_002901873.1|  60S ribosomal protein L18-2                      74.7    1e-14   
ref|XP_003050699.1|  60S ribosomal protein L18                        74.7    1e-14   
gb|KDR14978.1|  60S ribosomal protein L18                             74.7    1e-14   
ref|XP_002837719.1|  60S ribosomal protein L18                        74.7    1e-14   
gb|KIY03022.1|  60S ribosomal protein L18-A                           74.7    1e-14   
ref|XP_008727056.1|  hypothetical protein G647_04492                  74.7    1e-14   
gb|ACD65122.1|  putative 60S ribosomal protein RPL18                  73.9    1e-14   
gb|KIW75160.1|  60S ribosomal protein L18-A                           74.7    1e-14   
gb|AAN73382.1|  ribosomal protein L18                                 74.7    1e-14   
ref|XP_007756404.1|  60S ribosomal protein L18-B                      74.7    1e-14   
gb|KIW69267.1|  hypothetical protein PV04_05151                       74.7    1e-14   
gb|KHJ35313.1|  putative 60s ribosomal protein l18                    74.7    1e-14   
ref|XP_011318768.1|  hypothetical protein FGSG_09866                  74.7    1e-14   
gb|KIW89279.1|  60S ribosomal protein L18-A                           74.7    1e-14   
ref|XP_008876054.1|  hypothetical protein H310_11242                  74.7    1e-14   
gb|KIW28110.1|  60S ribosomal protein L18-A                           74.7    1e-14   
dbj|GAN11649.1|  60S ribosomal protein L18                            75.1    1e-14   
ref|XP_009834317.1|  hypothetical protein H257_09702                  74.7    1e-14   
gb|ELT99918.1|  hypothetical protein CAPTEDRAFT_159560                74.7    1e-14   
gb|EHK40529.1|  hypothetical protein TRIATDRAFT_301380                74.3    1e-14   
gb|KIV82136.1|  60S ribosomal protein L18-A                           74.3    1e-14   
gb|EQK99300.1|  Ribosomal protein L18e                                74.3    1e-14   
dbj|BAG56896.1|  unnamed protein product                              73.6    1e-14   
dbj|GAN01748.1|  60S ribosomal protein L18                            74.7    1e-14   
gb|EFW99284.1|  60S ribosomal protein l18                             74.3    2e-14   
gb|KGG52298.1|  60S ribosomal protein L18                             73.9    2e-14   
gb|EPB87658.1|  60S ribosomal protein L18-A                           74.3    2e-14   
ref|XP_001226565.1|  60S ribosomal protein L18                        74.3    2e-14   
emb|CBJ25909.1|  cytoplasmic ribosomal protein L18                    74.3    2e-14   
gb|KFM61778.1|  60S ribosomal protein L18                             73.9    2e-14   
gb|EGW13839.1|  60S ribosomal protein L18                             72.0    2e-14   
gb|KFY46288.1|  hypothetical protein V495_02580                       77.0    2e-14   
gb|EPB85693.1|  50S ribosomal protein L18e                            74.3    2e-14   
emb|CCE31761.1|  probable ribosomal protein L18, cytosolic            73.9    2e-14   
ref|XP_003225100.1|  PREDICTED: 60S ribosomal protein L18             74.3    2e-14   
gb|EHK21490.1|  hypothetical protein TRIVIDRAFT_91171                 73.9    2e-14   
gb|EIE77872.1|  60S ribosomal protein L18-A                           73.9    2e-14   
emb|CEP15166.1|  hypothetical protein                                 74.3    2e-14   
gb|EIE89554.1|  60S ribosomal protein L18-A                           73.9    2e-14   
ref|XP_006963039.1|  hypothetical protein TRIREDRAFT_75609            73.9    2e-14   
ref|XP_007807138.1|  60S ribosomal protein L18                        73.9    2e-14   
ref|XP_001903890.1|  hypothetical protein                             74.7    2e-14   
gb|AEE62646.1|  unknown                                               73.9    2e-14   
gb|EFN87206.1|  60S ribosomal protein L18                             73.9    2e-14   
ref|XP_003650912.1|  60S ribosomal protein L18                        73.9    2e-14   
gb|EDM07304.1|  rCG53680, isoform CRA_c                               72.8    2e-14   
ref|XP_008547226.1|  PREDICTED: 60S ribosomal protein L18-like        73.9    2e-14   
ref|XP_007797810.1|  putative 60s ribosomal protein l18 protein       73.9    2e-14   
gb|EAW52362.1|  ribosomal protein L18, isoform CRA_d                  73.2    2e-14   
ref|XP_005715661.1|  unnamed protein product                          73.9    2e-14   
dbj|BAN21088.1|  ribosomal protein L18                                73.9    2e-14   
ref|XP_011497333.1|  PREDICTED: 60S ribosomal protein L18             73.9    2e-14   
ref|XP_007913539.1|  putative 60s ribosomal protein l18 protein       73.6    3e-14   
emb|CDP28017.1|  Putative cytosolic 60S ribosomal protein Rpl18       73.6    3e-14   
gb|EPB81859.1|  50S ribosomal protein L18e                            73.9    3e-14   
emb|CBK21900.2|  Ribosomal protein L18e                               73.6    3e-14   
ref|XP_007722189.1|  large subunit ribosomal protein L18e             73.6    3e-14   
gb|ACO15258.1|  60S ribosomal protein L18                             73.6    3e-14   
ref|XP_009158973.1|  50S ribosomal protein L18e                       73.6    3e-14   
ref|XP_006138489.1|  PREDICTED: 60S ribosomal protein L18-like        73.6    3e-14   
gb|EAW52364.1|  ribosomal protein L18, isoform CRA_f                  72.8    3e-14   
gb|EDM07303.1|  rCG53680, isoform CRA_b                               72.8    3e-14   
ref|XP_008891573.1|  hypothetical protein PPTG_02269                  73.6    3e-14   
sp|Q0PXY6.1|RL18_DIACI  RecName: Full=60S ribosomal protein L18       73.6    3e-14   
gb|KFZ07357.1|  hypothetical protein V501_06543                       76.3    3e-14   
gb|KIK20716.1|  hypothetical protein PISMIDRAFT_576002                73.2    4e-14   
ref|XP_009519518.1|  hypothetical protein PHYSODRAFT_284882           73.6    4e-14   
gb|EFQ34059.1|  eukaryotic ribosomal protein L18                      73.2    4e-14   
ref|XP_006039668.1|  PREDICTED: 60S ribosomal protein L18-like        72.4    4e-14   
sp|P09897.2|RL18A_XENLA  RecName: Full=60S ribosomal protein L18-...  73.2    4e-14   
ref|XP_007824423.1|  hypothetical protein MAA_08234                   73.2    4e-14   
gb|KFY54291.1|  hypothetical protein V496_07299                       75.9    4e-14   
gb|KIV96156.1|  60S ribosomal protein L18-B                           73.2    4e-14   
gb|KID66920.1|  Ribosomal protein L18e                                73.2    4e-14   
gb|KIW43484.1|  60S ribosomal protein L18-B                           73.6    4e-14   
ref|XP_001244800.1|  60S ribosomal protein L18                        73.2    4e-14   
gb|KIW11507.1|  60S ribosomal protein L18-A                           73.2    4e-14   
gb|KEY66717.1|  hypothetical protein S7711_06765                      73.2    4e-14   
gb|KFA60744.1|  hypothetical protein S40285_04747                     73.2    4e-14   
ref|XP_007586342.1|  putative 60s ribosomal protein l18 protein       73.2    4e-14   
ref|XP_003022831.1|  hypothetical protein TRV_03055                   73.2    4e-14   
emb|CCD58684.1|  60S ribosomal protein L18, putative                  73.2    4e-14   
emb|CCF40156.1|  eukaryotic ribosomal protein L18                     73.2    4e-14   
ref|XP_003177852.1|  60S ribosomal protein L18                        73.2    4e-14   
gb|EGD98734.1|  60S ribosomal protein L18                             73.2    5e-14   
ref|XP_001745439.1|  hypothetical protein                             73.2    5e-14   
gb|EFZ15690.1|  hypothetical protein SINV_04174                       73.2    5e-14   
gb|KII96054.1|  hypothetical protein PLICRDRAFT_48977                 73.2    5e-14   
ref|NP_001082683.1|  60S ribosomal protein L18-B                      73.2    5e-14   
ref|XP_003011118.1|  hypothetical protein ARB_02640                   73.2    5e-14   
gb|ABZ04231.1|  ribosomal protein rpl18                               73.2    5e-14   
gb|EAW52359.1|  ribosomal protein L18, isoform CRA_b                  72.8    5e-14   
ref|XP_005664749.1|  PREDICTED: 60S ribosomal protein L18-like        72.8    5e-14   
emb|CAB40827.1|  unnamed protein product                              73.2    5e-14   
ref|XP_005664739.1|  PREDICTED: 60S ribosomal protein L18 isoform X2  72.4    5e-14   
emb|CAA28689.1|  ribosomal protein L14                                72.8    5e-14   
ref|NP_001082681.1|  60S ribosomal protein L18-A                      72.8    5e-14   
ref|XP_007879935.1|  hypothetical protein PFL1_04221                  72.8    5e-14   
sp|P02412.4|RL18B_XENLA  RecName: Full=60S ribosomal protein L18-...  72.8    6e-14   
ref|XP_004077973.2|  PREDICTED: 60S ribosomal protein L18             73.2    6e-14   
ref|XP_007315262.1|  hypothetical protein SERLADRAFT_381487           72.8    6e-14   
gb|KDQ08824.1|  hypothetical protein BOTBODRAFT_37519                 72.8    6e-14   
gb|KIO03112.1|  hypothetical protein M404DRAFT_15806                  72.8    6e-14   
ref|NP_033103.2|  60S ribosomal protein L18                           72.8    6e-14   
dbj|BAB24923.1|  unnamed protein product                              72.8    6e-14   
gb|AFC88843.1|  60S ribosomal protein L18-3-like protein              72.4    6e-14   
ref|XP_005879546.1|  PREDICTED: 60S ribosomal protein L18             72.8    6e-14   
ref|XP_005084756.1|  PREDICTED: 60S ribosomal protein L18 isoform X1  72.8    6e-14   
ref|XP_004672329.1|  PREDICTED: 60S ribosomal protein L18             72.8    6e-14   
gb|KIM67674.1|  hypothetical protein SCLCIDRAFT_13851                 72.8    6e-14   
gb|AEE61752.1|  unknown                                               72.8    6e-14   
ref|XP_004415164.1|  PREDICTED: ribosomal protein L18-like            72.8    6e-14   
ref|XP_002762404.2|  PREDICTED: 60S ribosomal protein L18             72.8    6e-14   
ref|XP_003465581.1|  PREDICTED: 60S ribosomal protein L18             72.8    6e-14   
gb|AAH81468.1|  Ribosomal protein L18                                 72.8    6e-14   
ref|XP_004888751.1|  PREDICTED: 60S ribosomal protein L18             72.8    6e-14   
gb|EPZ37075.1|  60S ribosomal protein L18-2                           72.8    6e-14   
gb|EDL08686.1|  mCG127313                                             72.8    6e-14   
ref|XP_008250645.1|  PREDICTED: 60S ribosomal protein L18             72.8    6e-14   
ref|XP_011125411.1|  hypothetical protein AOL_s00112g79               72.8    6e-14   
ref|XP_007112433.1|  PREDICTED: 60S ribosomal protein L18             72.8    7e-14   
ref|XP_005366833.1|  PREDICTED: 60S ribosomal protein L18             72.8    7e-14   
ref|XP_004089423.1|  PREDICTED: 60S ribosomal protein L18             72.4    7e-14   
ref|XP_004597070.1|  PREDICTED: 60S ribosomal protein L18             72.8    7e-14   
ref|XP_010385886.1|  PREDICTED: 60S ribosomal protein L18             72.8    7e-14   
ref|XP_004015402.1|  PREDICTED: 60S ribosomal protein L18             72.8    7e-14   
ref|NP_112364.1|  60S ribosomal protein L18                           72.8    7e-14   
ref|XP_007168295.1|  PREDICTED: 60S ribosomal protein L18 isoform X2  72.4    7e-14   
gb|ENH83703.1|  60s ribosomal protein l18                             72.8    7e-14   
gb|AAH21743.1|  Ribosomal protein L18                                 72.4    7e-14   
ref|NP_000970.1|  60S ribosomal protein L18 isoform 1                 72.4    7e-14   
ref|XP_001082813.1|  PREDICTED: 60S ribosomal protein L18-like is...  72.4    7e-14   
ref|XP_008046837.1|  PREDICTED: 60S ribosomal protein L18 isoform X1  72.4    7e-14   
ref|XP_007168294.1|  PREDICTED: 60S ribosomal protein L18 isoform X1  72.4    7e-14   
gb|EAW52358.1|  ribosomal protein L18, isoform CRA_a                  72.4    7e-14   
ref|XP_006160253.1|  PREDICTED: 60S ribosomal protein L18             72.4    7e-14   
ref|XP_004451162.1|  PREDICTED: ribosomal protein L18-like            72.4    7e-14   
gb|KDN61013.1|  putative eukaryotic ribosomal protein L18             72.4    7e-14   
gb|KIW61527.1|  hypothetical protein PV05_01638                       72.4    7e-14   
ref|XP_007779084.1|  60S ribosomal protein L18-B                      72.4    7e-14   
ref|XP_004061142.1|  PREDICTED: 60S ribosomal protein L18             72.4    7e-14   
ref|XP_008567503.1|  PREDICTED: 60S ribosomal protein L18             72.4    7e-14   
ref|NP_001182442.1|  60S ribosomal protein L18                        72.4    7e-14   
ref|XP_001550924.1|  60S ribosomal protein L18                        72.4    7e-14   
ref|XP_002068278.1|  GK13159                                          72.4    7e-14   
ref|XP_003801570.1|  PREDICTED: ribosomal protein L18-like            72.4    7e-14   
ref|XP_007074184.1|  PREDICTED: ribosomal protein L18-like            72.4    7e-14   
ref|XP_006868227.1|  PREDICTED: ribosomal protein L18-like            72.4    7e-14   
ref|XP_005336693.1|  PREDICTED: 60S ribosomal protein L18             72.4    7e-14   
ref|XP_008843215.1|  PREDICTED: 60S ribosomal protein L18 isoform X2  72.4    8e-14   
ref|XP_008843214.1|  PREDICTED: 60S ribosomal protein L18 isoform X1  72.4    8e-14   
ref|XP_006109734.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...  72.4    8e-14   
ref|XP_010366954.1|  PREDICTED: 60S ribosomal protein L18             72.4    8e-14   
ref|XP_007506757.1|  PREDICTED: 60S ribosomal protein L18             72.4    8e-14   
ref|XP_008152619.1|  PREDICTED: 60S ribosomal protein L18             72.4    8e-14   
ref|XP_001956062.1|  GF24783                                          72.4    8e-14   
ref|XP_007742086.1|  large subunit ribosomal protein L18e             72.4    8e-14   
gb|KFZ15448.1|  hypothetical protein V502_05612                       75.1    8e-14   
ref|XP_004694311.1|  PREDICTED: 60S ribosomal protein L18             72.4    8e-14   
ref|NP_001015556.1|  60S ribosomal protein L18                        72.4    8e-14   
ref|XP_004271135.1|  PREDICTED: 60S ribosomal protein L18 isoform 1   72.4    8e-14   
ref|NP_648091.1|  ribosomal protein L18, isoform A                    72.4    8e-14   
ref|XP_007536290.1|  PREDICTED: 60S ribosomal protein L18             72.4    8e-14   
ref|XP_003766518.1|  PREDICTED: 60S ribosomal protein L18             72.4    8e-14   
ref|XP_001588139.1|  60S ribosomal protein L18                        72.4    8e-14   
gb|AAA40067.1|  ribosomal protein L18                                 72.4    9e-14   
ref|XP_004526749.1|  PREDICTED: 60S ribosomal protein L18-like        72.4    9e-14   
ref|XP_005434338.1|  PREDICTED: 60S ribosomal protein L18-like        72.4    9e-14   
emb|CAX79061.1|  ribosomal protein L18                                72.4    9e-14   
gb|KFY89224.1|  hypothetical protein V500_05886                       75.1    9e-14   
gb|AAW25981.1|  SJCHGC06655 protein                                   72.4    9e-14   
ref|XP_570671.1|  hypothetical protein                                72.4    9e-14   
ref|NP_001011030.1|  60S ribosomal protein L18                        72.4    9e-14   
ref|XP_005190752.1|  PREDICTED: 60S ribosomal protein L18             72.4    9e-14   
ref|XP_003193768.1|  60S ribosomal protein L18-B                      72.4    9e-14   
gb|KGB74955.1|  60S ribosomal protein L18-A                           72.4    9e-14   
ref|XP_004646586.1|  PREDICTED: 60S ribosomal protein L18             72.0    1e-13   
dbj|BAJ97000.1|  predicted protein                                    72.0    1e-13   
emb|CAJ17294.1|  ribosomal protein L18e                               72.0    1e-13   
dbj|GAD98621.1|  60S ribosomal protein L18                            72.0    1e-13   
gb|AFR94920.1|  large subunit ribosomal protein L18-A                 72.0    1e-13   
ref|XP_003485273.1|  PREDICTED: hypothetical protein LOC100746406     74.3    1e-13   
emb|CDH60299.1|  60s ribosomal protein l18                            72.0    1e-13   
ref|XP_003393579.1|  PREDICTED: hypothetical protein LOC100643724     74.3    1e-13   
ref|XP_003668013.1|  ribosomal protein L18                            72.0    1e-13   
ref|XP_003385450.1|  PREDICTED: 60S ribosomal protein L18-like        72.0    1e-13   
ref|XP_451321.1|  60S ribosomal protein L18                           72.0    1e-13   
ref|XP_003791010.1|  PREDICTED: ribosomal protein L18-like            72.0    1e-13   
emb|CDS08904.1|  Putative 50S ribosomal protein L18e                  72.0    1e-13   
gb|ERE86552.1|  60S ribosomal protein L18-like protein                72.4    1e-13   
ref|XP_007833554.1|  60S ribosomal protein L18-B                      72.0    1e-13   
gb|KHJ97877.1|  putative eukaryotic ribosomal protein L18             70.9    1e-13   
gb|KFY39663.1|  hypothetical protein V494_03902                       74.7    1e-13   
gb|KFY14169.1|  hypothetical protein V492_02802                       74.7    1e-13   
ref|XP_002094010.1|  GE20435                                          71.6    1e-13   
ref|XP_004619784.1|  PREDICTED: 60S ribosomal protein L18             72.0    1e-13   
ref|XP_002047296.1|  GJ13360                                          71.6    1e-13   
ref|XP_006026818.1|  PREDICTED: 60S ribosomal protein L18             71.6    1e-13   
ref|XP_001971483.1|  GG14989                                          71.6    1e-13   
ref|XP_006779428.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...  71.2    1e-13   
ref|XP_002035667.1|  GM13785                                          71.6    1e-13   
gb|ELW47918.1|  60S ribosomal protein L18                             71.6    1e-13   
ref|NP_001187045.1|  60S ribosomal protein L18                        71.6    1e-13   
gb|EJU06490.1|  60S ribosomal protein L18                             71.6    1e-13   
gb|KIL67232.1|  hypothetical protein M378DRAFT_22860                  71.6    1e-13   
gb|ERL94357.1|  hypothetical protein D910_11638                       75.1    1e-13   
gb|KIY45967.1|  ribosomal protein L18e                                71.6    2e-13   
ref|XP_006894610.1|  PREDICTED: ribosomal protein L18-like            71.6    2e-13   
ref|XP_003235591.1|  60S ribosomal protein L18                        71.6    2e-13   
gb|EKG21215.1|  Ribosomal protein L18e                                71.6    2e-13   



>ref|XP_002512455.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF49907.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=403

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +1

Query  19   PLQRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLF  198
            P  RR++MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLF
Sbjct  210  PTSRRASMGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLF  269

Query  199  MSK  207
            MSK
Sbjct  270  MSK  272



>ref|XP_010559184.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=145

 Score =   108 bits (271),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_009629074.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
 ref|XP_009788537.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=187

 Score =   109 bits (272),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_010523956.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_010544997.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_009625475.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_010559185.1| PREDICTED: 60S ribosomal protein L18-2-like [Tarenaya hassleriana]
Length=187

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/56 (98%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>gb|KDP23459.1| hypothetical protein JCGZ_23292 [Jatropha curcas]
Length=187

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_011042004.1| PREDICTED: 60S ribosomal protein L18-2-like [Populus euphratica]
Length=187

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_006386732.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
 gb|ERP64529.1| hypothetical protein POPTR_0002s20400g [Populus trichocarpa]
Length=184

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_002301485.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE80758.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_002320999.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93820.1| unknown [Populus trichocarpa]
 gb|EEE99314.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   108 bits (271),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>gb|KDP28183.1| hypothetical protein JCGZ_13954 [Jatropha curcas]
Length=187

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_002523106.1| 60S ribosomal protein L18, putative [Ricinus communis]
 gb|EEF39291.1| 60S ribosomal protein L18, putative [Ricinus communis]
Length=187

 Score =   108 bits (270),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_010025256.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW61872.1| hypothetical protein EUGRSUZ_H04551 [Eucalyptus grandis]
Length=187

 Score =   108 bits (269),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAV+LKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVVLKRLFMSK  56



>ref|XP_009783807.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   108 bits (269),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGK+K+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_009772706.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
 ref|XP_009772708.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTG KFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGCKFNAVILKRLFMSK  56



>ref|XP_006344694.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score =   107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSK  56



>ref|XP_010313195.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum lycopersicum]
Length=187

 Score =   107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSK  56



>gb|KJB45331.1| hypothetical protein B456_007G301700 [Gossypium raimondii]
Length=195

 Score =   107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_007163123.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
 gb|ESW35117.1| hypothetical protein PHAVU_001G208200g [Phaseolus vulgaris]
Length=187

 Score =   107 bits (267),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>ref|XP_010684349.1| PREDICTED: 60S ribosomal protein L18-2-like [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   107 bits (267),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+DVYLKLLVKLYRFLVRRTGSKFNAV+LKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDVYLKLLVKLYRFLVRRTGSKFNAVVLKRLFMSK  56



>gb|KJB41868.1| hypothetical protein B456_007G127300 [Gossypium raimondii]
Length=178

 Score =   107 bits (266),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>emb|CDX99969.1| BnaC09g03320D [Brassica napus]
Length=210

 Score =   107 bits (268),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 61/70 (87%), Gaps = 1/70 (1%)
 Frame = +1

Query  1    PLSPKPPLQRRS-TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNA  177
            PL+P  P    +  MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+A
Sbjct  10   PLAPSVPSSSVTDAMGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDA  69

Query  178  VILKRLFMSK  207
            VILKRLFMSK
Sbjct  70   VILKRLFMSK  79



>gb|KJB23304.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=159

 Score =   106 bits (264),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|NP_001237789.1| uncharacterized protein LOC100500164 [Glycine max]
 gb|ACU15099.1| unknown [Glycine max]
 gb|KHN16096.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   107 bits (266),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>emb|CBI39539.3| unnamed protein product [Vitis vinifera]
Length=249

 Score =   108 bits (269),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +1

Query  37   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            TMGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  62   TMGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  118



>gb|KHN43503.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   106 bits (265),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSK  56



>gb|KHN20393.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=274

 Score =   108 bits (270),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +1

Query  34   STMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            S MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  86   SAMGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  143



>emb|CDP17112.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   107 bits (268),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFN VILKRLFMSK
Sbjct  48   MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNVVILKRLFMSK  103



>ref|NP_001236701.1| uncharacterized protein LOC100306301 [Glycine max]
 gb|ACU14418.1| unknown [Glycine max]
Length=187

 Score =   106 bits (265),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSK  56



>ref|XP_009338229.1| PREDICTED: 60S ribosomal protein L18-2-like [Pyrus x bretschneideri]
Length=187

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_008386678.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_007205962.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
 ref|XP_008245548.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ07161.1| hypothetical protein PRUPE_ppa012012mg [Prunus persica]
Length=187

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_008388515.1| PREDICTED: 60S ribosomal protein L18-2-like [Malus domestica]
Length=187

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>gb|KHF98574.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
 gb|KJB22518.1| hypothetical protein B456_004G052100 [Gossypium raimondii]
Length=187

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>gb|KJB41867.1| hypothetical protein B456_007G127300 [Gossypium raimondii]
Length=187

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_010659657.1| PREDICTED: 60S ribosomal protein L18-2-like [Vitis vinifera]
 emb|CAN65685.1| hypothetical protein VITISV_022459 [Vitis vinifera]
Length=187

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_009630920.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGK+K+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFN VILKRLFMSK
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNTVILKRLFMSK  56



>ref|XP_009335702.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
 ref|XP_009335725.1| PREDICTED: 60S ribosomal protein L18-2 [Pyrus x bretschneideri]
Length=187

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>gb|KJB45330.1| hypothetical protein B456_007G301700 [Gossypium raimondii]
Length=187

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_010043043.1| PREDICTED: 60S ribosomal protein L18-2 [Eucalyptus grandis]
 gb|KCW85064.1| hypothetical protein EUGRSUZ_B01908 [Eucalyptus grandis]
Length=187

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_002270635.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>emb|CDP05500.1| unnamed protein product [Coffea canephora]
Length=89

 Score =   103 bits (257),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGK K+TKRTAPKSDD+Y+KLLVKLYRFLVRRTGS+FNAV+LKRLFMSK
Sbjct  1    MGIDLKAGGKVKKTKRTAPKSDDIYIKLLVKLYRFLVRRTGSRFNAVLLKRLFMSK  56



>ref|XP_009629121.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana tomentosiformis]
Length=187

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSK  56



>ref|XP_002271179.1| PREDICTED: 60S ribosomal protein L18-2 [Vitis vinifera]
Length=187

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKRTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_011023716.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSK  56



>ref|XP_002319502.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|EEE95425.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSK  56



>gb|ABK92688.1| unknown [Populus trichocarpa]
Length=187

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTQSKFNAVILKRLFMSK  56



>ref|NP_001236071.1| uncharacterized protein LOC100499789 [Glycine max]
 gb|ACU13660.1| unknown [Glycine max]
Length=187

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>gb|KJB82634.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=184

 Score =   105 bits (262),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVK+YRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKIYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_007144959.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
 gb|ESW16953.1| hypothetical protein PHAVU_007G197900g [Phaseolus vulgaris]
Length=187

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>gb|KHN03962.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=187

 Score =   105 bits (262),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>ref|XP_007147006.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
 gb|ESW19000.1| hypothetical protein PHAVU_006G088800g [Phaseolus vulgaris]
Length=187

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>gb|KJB82632.1| hypothetical protein B456_013G206100 [Gossypium raimondii]
Length=187

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVK+YRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKIYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_011036896.1| PREDICTED: 60S ribosomal protein L18-2 [Populus euphratica]
Length=187

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLK GGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK
Sbjct  1    MGIDLKRGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSK  56



>ref|XP_003556523.1| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
Length=187

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>gb|KJB23303.1| hypothetical protein B456_004G091200 [Gossypium raimondii]
Length=187

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>emb|CDP22224.1| unnamed protein product [Coffea canephora]
Length=94

 Score =   102 bits (255),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGK K+TKRTAPKSDD+Y+KLLVKLYRFLVRRTGS+FNAV+LKRLFMSK
Sbjct  1    MGIDLKAGGKVKKTKRTAPKSDDIYIKLLVKLYRFLVRRTGSRFNAVLLKRLFMSK  56



>ref|XP_006394935.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
 gb|ESQ32221.1| hypothetical protein EUTSA_v10004865mg [Eutrema salsugineum]
Length=230

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +1

Query  25   QRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMS  204
            ++   MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+GSKFNAVILKRLFMS
Sbjct  39   RQHKAMGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSGSKFNAVILKRLFMS  98

Query  205  K  207
            K
Sbjct  99   K  99



>ref|XP_010273829.1| PREDICTED: 60S ribosomal protein L18-2-like [Nelumbo nucifera]
Length=187

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMS+
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSR  56



>ref|XP_006382454.1| 60S ribosomal protein L18 [Populus trichocarpa]
 gb|ABK93398.1| unknown [Populus trichocarpa]
 gb|ABK93783.1| unknown [Populus trichocarpa]
 gb|ERP60251.1| 60S ribosomal protein L18 [Populus trichocarpa]
Length=187

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLK GGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK
Sbjct  1    MGIDLKRGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSK  56



>ref|XP_007050975.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
 gb|EOX95132.1| Ribosomal protein L18 isoform 2 [Theobroma cacao]
Length=180

 Score =   105 bits (261),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_010546736.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score =   105 bits (261),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>emb|CBI36879.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  37   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
             MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  110  AMGIDLVAGGKSKRTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  166



>ref|XP_010524859.1| PREDICTED: 60S ribosomal protein L18-3 [Tarenaya hassleriana]
Length=187

 Score =   105 bits (261),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>emb|CDY25018.1| BnaC02g39900D [Brassica napus]
Length=197

 Score =   105 bits (262),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  37   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
             MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK
Sbjct  10   AMGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSK  66



>ref|XP_007050974.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
 gb|EOX95131.1| Ribosomal protein L18 isoform 1 [Theobroma cacao]
Length=187

 Score =   105 bits (261),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_004144773.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 ref|XP_004158733.1| PREDICTED: 60S ribosomal protein L18-3-like [Cucumis sativus]
 gb|KGN60965.1| hypothetical protein Csa_2G032220 [Cucumis sativus]
Length=187

 Score =   105 bits (261),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>ref|XP_003591163.1| Ribosomal protein L18 [Medicago truncatula]
 gb|AES61414.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=187

 Score =   105 bits (261),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGK+K+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKNKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>ref|XP_009111741.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score =   105 bits (261),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSK  56



>ref|XP_007031040.1| Ribosomal protein L18 [Theobroma cacao]
 gb|EOY11542.1| Ribosomal protein L18 [Theobroma cacao]
Length=187

 Score =   105 bits (261),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_008454015.1| PREDICTED: 60S ribosomal protein L18-3 [Cucumis melo]
Length=187

 Score =   105 bits (261),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>ref|XP_010550997.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Tarenaya 
hassleriana]
Length=187

 Score =   104 bits (260),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSSFNAVILKRLFMSK  56



>ref|XP_009151179.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score =   104 bits (260),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSK  56



>emb|CDY19736.1| BnaA09g03890D [Brassica napus]
Length=215

 Score =   105 bits (262),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  37   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
             MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK
Sbjct  28   AMGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSK  84



>gb|AFK45456.1| unknown [Lotus japonicus]
Length=187

 Score =   104 bits (260),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FN+VILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNSVILKRLFMSK  56



>emb|CDY66803.1| BnaAnng22990D, partial [Brassica napus]
Length=200

 Score =   105 bits (261),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  37   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
             MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK
Sbjct  13   AMGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSK  69



>ref|XP_009129884.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=222

 Score =   105 bits (262),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  37   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
             MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK
Sbjct  35   AMGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSK  91



>gb|KHG07157.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
Length=207

 Score =   104 bits (260),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = +1

Query  16   PPLQRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRL  195
            P +     MGIDL AGGKSK+TKRTAPKSDD+YLKL+VKLYRFLVRRTGSKFNAVILKRL
Sbjct  13   PLVSASQAMGIDLVAGGKSKKTKRTAPKSDDIYLKLIVKLYRFLVRRTGSKFNAVILKRL  72

Query  196  FMSK  207
            FM K
Sbjct  73   FMCK  76



>emb|CDP07204.1| unnamed protein product [Coffea canephora]
Length=86

 Score =   101 bits (252),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGK K+TKRTAPKSDD+YLKLLVKLYRFL RRTGS+FNAV+LKRLFMSK
Sbjct  1    MGIDLKAGGKVKKTKRTAPKSDDIYLKLLVKLYRFLERRTGSRFNAVLLKRLFMSK  56



>ref|XP_008370417.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score =   104 bits (259),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTASKFNAVILKRLFMSK  56



>ref|XP_007201344.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
 ref|XP_008235116.1| PREDICTED: 60S ribosomal protein L18-2 [Prunus mume]
 gb|EMJ02543.1| hypothetical protein PRUPE_ppa012001mg [Prunus persica]
Length=187

 Score =   103 bits (258),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFSAVILKRLFMSK  56



>ref|XP_010674074.1| PREDICTED: 60S ribosomal protein L18-2 [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+DVYLKLLVKLYRFLVRRTGS FN V+LKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDVYLKLLVKLYRFLVRRTGSSFNGVVLKRLFMSK  56



>ref|XP_008775991.1| PREDICTED: 60S ribosomal protein L18-2 [Phoenix dactylifera]
Length=187

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG+SK+ KRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRSKKAKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_008369026.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008345218.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
 ref|XP_008355492.1| PREDICTED: 60S ribosomal protein L18-2 [Malus domestica]
Length=187

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTSSKFNAVILKRLFMSK  56



>emb|CDX80616.1| BnaC07g28280D [Brassica napus]
Length=232

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  37   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
             MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLFMSK
Sbjct  45   AMGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLFMSK  101



>gb|AGV54741.1| 60S ribosomal protein L18-3-like protein [Phaseolus vulgaris]
Length=222

 Score =   104 bits (260),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGID KAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDFKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>ref|XP_010938374.1| PREDICTED: 60S ribosomal protein L18-2-like [Elaeis guineensis]
Length=187

 Score =   103 bits (258),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVIL+RLFMSK
Sbjct  1    MGIDLKAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSRFNAVILRRLFMSK  56



>emb|CDY40718.1| BnaC03g34340D [Brassica napus]
Length=227

 Score =   104 bits (260),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +1

Query  34   STMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            +TMGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  39   ATMGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSK  96



>gb|KHG01788.1| 60S ribosomal L18-2 -like protein [Gossypium arboreum]
Length=160

 Score =   102 bits (255),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFN VILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNTVILKRLFMSK  56



>gb|KJB41866.1| hypothetical protein B456_007G127300, partial [Gossypium raimondii]
Length=227

 Score =   104 bits (260),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/55 (95%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  43   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            GIDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  42   GIDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  96



>ref|XP_006359857.1| PREDICTED: 60S ribosomal protein L18-2-like [Solanum tuberosum]
Length=187

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRIAPKSDDVYLKLLVKLYRFLARRTGSKFNAVILKRLFMSK  56



>ref|XP_009775352.1| PREDICTED: 60S ribosomal protein L18-2 [Nicotiana sylvestris]
Length=173

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRT P+SDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTTPQSDDVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSK  56



>emb|CDX74138.1| BnaA03g29090D [Brassica napus]
Length=213

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +1

Query  34   STMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            +TMGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  25   ATMGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSK  82



>gb|AFK49563.1| unknown [Lotus japonicus]
Length=187

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKR APKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRIAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>ref|XP_010528904.1| PREDICTED: 60S ribosomal protein L18-2 [Tarenaya hassleriana]
Length=187

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRVAPKSDDVYLKLLVKLYRFLVRRTGSSFNAVILKRLFMSK  56



>gb|KHN20252.1| 60S ribosomal protein L18-3, partial [Glycine soja]
Length=187

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
             GIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    QGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>gb|KGN66048.1| hypothetical protein Csa_1G569250 [Cucumis sativus]
Length=244

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 59/73 (81%), Gaps = 4/73 (5%)
 Frame = +1

Query  1    PLSPKPPL----QRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSK  168
            PLS  P      +R   MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRFLVRRTGS 
Sbjct  41   PLSSTPAAPADTRRAFVMGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFLVRRTGSN  100

Query  169  FNAVILKRLFMSK  207
            FNAVILKRLFMSK
Sbjct  101  FNAVILKRLFMSK  113



>ref|XP_008810211.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_008450608.1| PREDICTED: 60S ribosomal protein L18-2 [Cucumis melo]
Length=187

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>ref|XP_003554636.2| PREDICTED: 60S ribosomal protein L18-2-like [Glycine max]
 gb|KHN43312.1| 60S ribosomal protein L18-2 [Glycine soja]
Length=214

 Score =   103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +1

Query  34   STMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            + MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  26   AAMGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSK  83



>emb|CDY18813.1| BnaAnng02780D [Brassica napus]
Length=249

 Score =   104 bits (259),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  28   RRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            R + MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  59   REAIMGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSK  118



>gb|ABK22247.1| unknown [Picea sitchensis]
Length=187

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSKQTKRTAPKS+D+YLKLLVKLYRFLVRRT S+FNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKQTKRTAPKSEDIYLKLLVKLYRFLVRRTSSRFNAVILKRLFMSK  56



>ref|XP_008784768.1| PREDICTED: 60S ribosomal protein L18-2-like [Phoenix dactylifera]
Length=187

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLIAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_004247404.1| PREDICTED: 60S ribosomal protein L18-2 [Solanum lycopersicum]
Length=187

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKR APKSDDVYLKLLVKLYRFL RRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRIAPKSDDVYLKLLVKLYRFLSRRTGSKFNAVILKRLFMSK  56



>gb|AFW81440.1| hypothetical protein ZEAMMB73_288952 [Zea mays]
Length=85

 Score =   100 bits (248),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSK  56



>ref|XP_006288739.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
 gb|EOA21637.1| hypothetical protein CARUB_v10002048mg [Capsella rubella]
Length=187

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSKFNAVILKRLFMSK  56



>ref|XP_010914484.1| PREDICTED: 60S ribosomal protein L18-3 [Elaeis guineensis]
Length=187

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>emb|CDY05559.1| BnaA02g31320D [Brassica napus]
Length=503

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 58/63 (92%), Gaps = 3/63 (5%)
 Frame = +1

Query  28   RRST---MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLF  198
            R ST   MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRRTGSKF+AVILKRLF
Sbjct  29   RHSTAHAMGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFDAVILKRLF  88

Query  199  MSK  207
            MSK
Sbjct  89   MSK  91



>ref|XP_010269589.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMS+
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSR  56



>ref|XP_002874343.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50602.1| 60S ribosomal protein L18 [Arabidopsis lyrata subsp. lyrata]
Length=187

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSK  56



>ref|XP_011079632.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
 ref|XP_011084062.1| PREDICTED: 60S ribosomal protein L18-2 [Sesamum indicum]
Length=187

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMS+
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSRFNAVVLKRLFMSR  56



>ref|XP_011079633.1| PREDICTED: 60S ribosomal protein L18-2-like [Sesamum indicum]
Length=187

 Score =   102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMS+
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSRFNAVVLKRLFMSR  56



>gb|KFK26512.1| hypothetical protein AALP_AA8G258600 [Arabis alpina]
Length=187

 Score =   102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSDSKFNAVILKRLFMSK  56



>ref|NP_001235897.1| uncharacterized protein LOC100527681 [Glycine max]
 gb|ACU16823.1| unknown [Glycine max]
Length=187

 Score =   102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYR LVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRSLVRRTGSNFNAVILKRLFMSK  56



>ref|XP_010259492.1| PREDICTED: 60S ribosomal protein L18-3 [Nelumbo nucifera]
Length=187

 Score =   102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMS+
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSR  56



>ref|XP_010495537.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=130

 Score =   100 bits (250),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  43   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            GIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK
Sbjct  37   GIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSK  91



>ref|XP_004494383.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESSFNAVILKRLFMSK  56



>ref|XP_009796134.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana sylvestris]
Length=187

 Score =   102 bits (254),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKSDDVYLKL+VKLYRFLV+RTGSKFN VILK LFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSDDVYLKLIVKLYRFLVQRTGSKFNTVILKWLFMSK  56



>ref|XP_004135776.1| PREDICTED: uncharacterized protein LOC101207642 [Cucumis sativus]
 ref|XP_004169487.1| PREDICTED: uncharacterized protein LOC101228164 [Cucumis sativus]
Length=389

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 59/73 (81%), Gaps = 4/73 (5%)
 Frame = +1

Query  1    PLSPKPPL----QRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSK  168
            PLS  P      +R   MGIDL AGGKSK+TKR APKSDD+YLKLLVKLYRFLVRRTGS 
Sbjct  186  PLSSTPAAPADTRRAFVMGIDLVAGGKSKKTKRVAPKSDDIYLKLLVKLYRFLVRRTGSN  245

Query  169  FNAVILKRLFMSK  207
            FNAVILKRLFMSK
Sbjct  246  FNAVILKRLFMSK  258



>gb|ABK26318.1| unknown [Picea sitchensis]
Length=187

 Score =   102 bits (254),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSKQT+RTAPKS+D+YLKLLVKLYRFLVRRT S+FNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKQTRRTAPKSEDIYLKLLVKLYRFLVRRTSSRFNAVILKRLFMSK  56



>ref|XP_010921627.1| PREDICTED: uncharacterized protein LOC105045157 [Elaeis guineensis]
Length=398

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +1

Query  19   PLQRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLF  198
            P + RS+ GIDL AGG+SK+ +RTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLF
Sbjct  205  PTRLRSSQGIDLIAGGRSKKARRTAPKSDDVYLKLLVKLYRFLVRRTGSRFNAVILKRLF  264

Query  199  MSK  207
            MSK
Sbjct  265  MSK  267



>ref|XP_010931680.1| PREDICTED: 60S ribosomal protein L18-2 [Elaeis guineensis]
Length=187

 Score =   102 bits (253),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_006840598.1| hypothetical protein AMTR_s00343p00015240, partial [Amborella 
trichopoda]
 gb|ERN02273.1| hypothetical protein AMTR_s00343p00015240, partial [Amborella 
trichopoda]
Length=165

 Score =   101 bits (252),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  43   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            GIDL AGGKSK+TKRTAPKS D+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    GIDLVAGGKSKKTKRTAPKSGDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  55



>ref|XP_009384409.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   102 bits (253),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_006298640.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
 gb|EOA31538.1| hypothetical protein CARUB_v10014730mg [Capsella rubella]
Length=187

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSK  56



>ref|XP_010455077.1| PREDICTED: 60S ribosomal protein L18-3-like isoform X1 [Camelina 
sativa]
Length=187

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSK  56



>ref|XP_010421566.1| PREDICTED: 60S ribosomal protein L18-2-like [Camelina sativa]
Length=187

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ SKFNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSESKFNAVILKRLFMSK  56



>ref|XP_002985888.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
 gb|EFJ13065.1| hypothetical protein SELMODRAFT_181978 [Selaginella moellendorffii]
Length=187

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGID++AGG++K+TKRTAPKSD+VYLKLLVKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDIEAGGRNKKTKRTAPKSDNVYLKLLVKLYRFLVRRTNSKFNAVILKRLFMSK  56



>ref|XP_009124870.1| PREDICTED: 60S ribosomal protein L18-2-like [Brassica rapa]
Length=187

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSK  56



>ref|XP_002976425.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
 gb|EFJ22685.1| hypothetical protein SELMODRAFT_267976 [Selaginella moellendorffii]
Length=187

 Score =   102 bits (253),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGID++AGG++K+TKRTAPKSD+VYLKLLVKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDIEAGGRNKKTKRTAPKSDNVYLKLLVKLYRFLVRRTNSKFNAVILKRLFMSK  56



>emb|CDO98841.1| unnamed protein product [Coffea canephora]
Length=243

 Score =   103 bits (256),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +1

Query  31   RSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            +  MGIDLKAGGK K+TKRTAPKS D+YLKLLVKLYRFLVRRTGS+FNAV+LKRLFMSK
Sbjct  54   KEEMGIDLKAGGKVKKTKRTAPKSHDIYLKLLVKLYRFLVRRTGSRFNAVLLKRLFMSK  112



>ref|XP_009134833.1| PREDICTED: 60S ribosomal protein L18-2 [Brassica rapa]
Length=187

 Score =   101 bits (252),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSK  56



>gb|AFW77276.1| hypothetical protein ZEAMMB73_917876 [Zea mays]
Length=160

 Score =   101 bits (251),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSK  56



>ref|XP_002882427.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58686.1| hypothetical protein ARALYDRAFT_477850 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score =   101 bits (252),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSK  56



>ref|NP_198137.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
 sp|Q940B0.1|RL183_ARATH RecName: Full=60S ribosomal protein L18-3 [Arabidopsis thaliana]
 gb|AAL07220.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAM67529.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AAN31854.1| putative 60S ribosomal protein [Arabidopsis thaliana]
 gb|AED93736.1| 60S ribosomal protein L18-3 [Arabidopsis thaliana]
Length=187

 Score =   101 bits (252),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKLLVKLYRFLVRR+ S FNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSNFNAVILKRLFMSK  56



>ref|XP_004494575.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=83

 Score = 98.6 bits (244),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGK+K+TKRT+PKS+D+YLKLLVKLYRFLVRRT S FNAVILKR FMSK
Sbjct  1    MGIDLKAGGKNKKTKRTSPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRFFMSK  56



>gb|AFW81438.1| hypothetical protein ZEAMMB73_288952 [Zea mays]
Length=130

 Score =   100 bits (248),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSK  56



>ref|XP_009411663.1| PREDICTED: 60S ribosomal protein L18-3-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGID+ AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDIVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_010094463.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB56096.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=198

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  43   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            GID+ AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  13   GIDIVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  67



>ref|XP_008656150.1| PREDICTED: 60S ribosomal protein L18-3-like [Zea mays]
Length=222

 Score =   102 bits (253),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/67 (78%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +1

Query  7    SPKPPLQRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVIL  186
            S  P     + MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVIL
Sbjct  25   SRNPSTAASAAMGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVIL  84

Query  187  KRLFMSK  207
            KRLFMSK
Sbjct  85   KRLFMSK  91



>gb|AAO46881.1| 60S ribosomal protein [Medicago sativa]
Length=164

 Score =   100 bits (250),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSK  56



>ref|XP_009417724.1| PREDICTED: 60S ribosomal protein L18-2 [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGID+ AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDIVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|XP_010104147.1| 60S ribosomal protein L18-2 [Morus notabilis]
 gb|EXB98712.1| 60S ribosomal protein L18-2 [Morus notabilis]
Length=209

 Score =   101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/55 (91%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +1

Query  43   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            GID+ AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  24   GIDIVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  78



>ref|XP_010486014.1| PREDICTED: 60S ribosomal protein L18-3 [Camelina sativa]
Length=187

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFLVRRTESKFNAVILKRLFMSK  56



>ref|XP_010464086.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score =   101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFLVRRTESKFNAVILKRLFMSK  56



>ref|XP_006855263.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
 gb|ERN16730.1| hypothetical protein AMTR_s00183p00048560 [Amborella trichopoda]
Length=187

 Score =   100 bits (250),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGID+ AGGKSK+T RTAPKS DVYLK+LVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDIVAGGKSKKTHRTAPKSGDVYLKILVKLYRFLVRRTGSKFNAVILKRLFMSK  56



>ref|NP_187210.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
 sp|P42791.2|RL182_ARATH RecName: Full=60S ribosomal protein L18-2 [Arabidopsis thaliana]
 gb|AAF26138.1|AC011620_14 putative 60S ribosomal protein L18 [Arabidopsis thaliana]
 gb|AAK59824.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AAL31164.1| AT3g05590/F18C1_14 [Arabidopsis thaliana]
 gb|AEE74263.1| 60S ribosomal protein L18-2 [Arabidopsis thaliana]
Length=187

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFN VILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSK  56



>ref|XP_010429374.1| PREDICTED: 60S ribosomal protein L18-3-like [Camelina sativa]
Length=187

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+T+RTAPKSDDVYLKL VKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTRRTAPKSDDVYLKLTVKLYRFLVRRTQSKFNAVILKRLFMSK  56



>gb|AAA69928.1| cytoplasmic ribosomal protein L18 [Arabidopsis thaliana]
Length=187

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT SKFN VILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSK  56



>ref|XP_003626231.1| 60S ribosomal protein L18 [Medicago truncatula]
 gb|ACJ85938.1| unknown [Medicago truncatula]
 gb|AES82449.1| 60S ribosomal protein L18-3 [Medicago truncatula]
 gb|AFK48984.1| unknown [Medicago truncatula]
Length=187

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK TKRT PKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKNTKRTEPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSK  56



>gb|ACJ85943.1| unknown [Medicago truncatula]
 gb|AFK48653.1| unknown [Medicago truncatula]
Length=174

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSK  56



>ref|XP_003568896.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=188

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYL+LLVKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLRLLVKLYRFLVRRTKSKFNAVILKRLFMSK  56



>ref|XP_009630742.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MG+DLK GGKSK+TKRT PKSDDVYLKLLVKLYRF VRRT SKFNAVILKRLFMSK
Sbjct  1    MGVDLKVGGKSKKTKRTTPKSDDVYLKLLVKLYRFFVRRTESKFNAVILKRLFMSK  56



>gb|EMT12638.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=187

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S+FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKRTKRTAPKSDDVYLKLLVKLYRFLVRRTKSQFNAVILKRLFMSK  56



>ref|XP_010088293.1| 60S ribosomal protein L18-3 [Morus notabilis]
 gb|EXB33518.1| 60S ribosomal protein L18-3 [Morus notabilis]
Length=197

 Score =   100 bits (250),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  34   STMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            S  GIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRTGS FNAV+LKRLFMSK
Sbjct  9    SDDGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTGSNFNAVVLKRLFMSK  66



>gb|AFC88838.1| 60S ribosomal protein L18-like protein [Miscanthus sinensis]
Length=188

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSK  56



>gb|KEH24393.1| 60S ribosomal protein L18-3 [Medicago truncatula]
Length=188

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSK  56



>gb|AFK34017.1| unknown [Medicago truncatula]
Length=188

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FN VILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESNFNKVILKRLFMSK  56



>ref|NP_001132852.1| uncharacterized protein LOC100194344 [Zea mays]
 gb|ACG24961.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG34787.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG39589.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACR34137.1| unknown [Zea mays]
 gb|AFW77275.1| ribosomal protein L18 [Zea mays]
 gb|AFW81439.1| ribosomal protein L18 [Zea mays]
 gb|AGS43131.1| hypothetical protein [Zea mays]
Length=187

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSK  56



>gb|ABK21809.1| unknown [Picea sitchensis]
 gb|ABK26564.1| unknown [Picea sitchensis]
Length=187

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKRTAPKSEDIYLKLLVKLYRFLVRRTSSSFNAVILKRLFMSK  56



>gb|EMS45435.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=187

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S+FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKRTKRTAPKSDDVYLKLLVKLYRFLVRRTKSQFNAVILKRLFMSK  56



>ref|XP_002439318.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
 gb|EES17748.1| hypothetical protein SORBIDRAFT_09g004290 [Sorghum bicolor]
Length=188

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSK  56



>ref|XP_008669243.1| PREDICTED: uncharacterized protein LOC103646289 [Zea mays]
Length=201

 Score =   100 bits (249),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSK  56



>ref|XP_002465302.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
 gb|EER92300.1| hypothetical protein SORBIDRAFT_01g035860 [Sorghum bicolor]
Length=187

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSK  56



>ref|XP_004977069.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=188

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSSFNAVILKRLFMSK  56



>ref|XP_004494578.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGK+K+TKRT+PKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKNKKTKRTSPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSK  56



>ref|XP_009611670.1| PREDICTED: 60S ribosomal protein L18-2-like [Nicotiana tomentosiformis]
Length=187

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TK TAPKS DVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKTKCTAPKSGDVYLKLLVKLYRFLVRRTGSQFNAVILKRLFMSK  56



>ref|NP_001131538.1| uncharacterized protein LOC100192878 [Zea mays]
 gb|ACG24841.1| 60S ribosomal protein L18 [Zea mays]
 gb|ACG31936.1| 60S ribosomal protein L18 [Zea mays]
 tpg|DAA64098.1| TPA: ribosomal protein L18 [Zea mays]
Length=187

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSK  56



>ref|XP_003562459.1| PREDICTED: 60S ribosomal protein L18-3-like [Brachypodium distachyon]
Length=187

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSHFNAVILKRLFMSK  56



>ref|XP_002461201.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
 gb|EER97722.1| hypothetical protein SORBIDRAFT_02g042750 [Sorghum bicolor]
Length=187

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSK  56



>emb|CBI22977.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   101 bits (251),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/54 (94%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +1

Query  46   IDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            IDL AGGKSK+TKRTAPKSDD+YLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  70   IDLVAGGKSKKTKRTAPKSDDIYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  123



>pdb|3J61|Q Chain Q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAW50985.1| ribosomal protein L18 [Triticum aestivum]
Length=188

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSK  56



>gb|EMT18368.1| 60S ribosomal protein L18-2 [Aegilops tauschii]
Length=188

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSK  56



>dbj|BAJ90421.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88976.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKR APKSDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKRTKRVAPKSDDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSK  56



>ref|XP_006433452.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 gb|ESR46692.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 gb|KDO39193.1| hypothetical protein CISIN_1g030771mg [Citrus sinensis]
Length=171

 Score = 99.4 bits (246),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRT S FN VILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTDSNFNKVILKRLFMSK  56



>gb|KDO39192.1| hypothetical protein CISIN_1g030771mg [Citrus sinensis]
Length=170

 Score = 99.4 bits (246),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRT S FN VILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTDSNFNKVILKRLFMSK  56



>ref|XP_004984437.1| PREDICTED: 60S ribosomal protein L18-2-like [Setaria italica]
Length=187

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSDFNAVILKRLFMSK  56



>ref|NP_001054688.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|AAV32218.1| cytoplasmic ribosomal protein L18 [Oryza sativa Japonica Group]
 dbj|BAF16602.1| Os05g0155100 [Oryza sativa Japonica Group]
 gb|EAY96610.1| hypothetical protein OsI_18515 [Oryza sativa Indica Group]
 gb|ABR25945.1| 60S ribosomal protein l18 [Oryza sativa Indica Group]
 dbj|BAG88175.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00211.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62383.1| hypothetical protein OsJ_17172 [Oryza sativa Japonica Group]
Length=188

 Score = 99.8 bits (247),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAP+SDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSDDVYLKLLVKLYRFLVRRTKSNFNAVILKRLFMSK  56



>ref|XP_010228645.1| PREDICTED: 60S ribosomal protein L18-2-like [Brachypodium distachyon]
Length=187

 Score = 99.4 bits (246),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT + FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKNHFNAVILKRLFMSK  56



>ref|XP_008789961.1| PREDICTED: uncharacterized protein LOC103707302 [Phoenix dactylifera]
Length=988

 Score =   104 bits (260),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +1

Query  37   TMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
             MGIDL AGG+SK+ KRTAPKSDDVYLKLLVKLYRFLVRRTGS+FNAVILKRLFMSK
Sbjct  801  AMGIDLIAGGRSKKAKRTAPKSDDVYLKLLVKLYRFLVRRTGSRFNAVILKRLFMSK  857



>ref|XP_009381102.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score = 99.4 bits (246),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG+SK+ +RTAP+SDDVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRSKKARRTAPRSDDVYLKLLVKLYRFLVRRTESKFNAVILKRLFMSK  56



>ref|XP_004958675.1| PREDICTED: 60S ribosomal protein L18-3-like [Setaria italica]
Length=187

 Score = 99.0 bits (245),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLLVKLYRFLVRRTKSPFNAVILKRLFMSK  56



>gb|KJB26287.1| hypothetical protein B456_004G239000 [Gossypium raimondii]
Length=224

 Score = 99.8 bits (247),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRR GS FNAVILKRLFM K
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRAGSNFNAVILKRLFMRK  56



>ref|XP_006408052.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
 gb|ESQ49505.1| hypothetical protein EUTSA_v10021598mg [Eutrema salsugineum]
Length=187

 Score = 99.0 bits (245),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFL RRT SKFN VILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLFRRTNSKFNGVILKRLFMSK  56



>ref|XP_009402513.1| PREDICTED: 60S ribosomal protein L18-2-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score = 98.6 bits (244),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG+SK+ +RTA +SDDVYLKLLVKLYRFLVRRTGSKFNAVIL+RLFMSK
Sbjct  1    MGIDLVAGGRSKKARRTASRSDDVYLKLLVKLYRFLVRRTGSKFNAVILRRLFMSK  56



>ref|XP_006433453.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
 ref|XP_006472133.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR46693.1| hypothetical protein CICLE_v10002597mg [Citrus clementina]
Length=187

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK++KRTAPKSDD+YLKLLVKLYRFLVRRT S FN VILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLLVKLYRFLVRRTDSNFNKVILKRLFMSK  56



>emb|CEF99132.1| Ribosomal protein L18e, conserved site [Ostreococcus tauri]
Length=186

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGG++K+T RTAPKSD+VYLKLLVKLYRFL RRTGSKFN  +LKRLFMSK
Sbjct  1    MGIDLKAGGRNKKTSRTAPKSDNVYLKLLVKLYRFLARRTGSKFNETVLKRLFMSK  56



>ref|XP_007050976.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
 gb|EOX95133.1| Ribosomal protein L18 isoform 3 [Theobroma cacao]
Length=186

 Score = 97.8 bits (242),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 54/56 (96%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK++KRTAPKSDD+YLKLL +LYRFLVRRTGSKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGKSKKSKRTAPKSDDIYLKLL-QLYRFLVRRTGSKFNAVILKRLFMSK  55



>ref|XP_006654064.1| PREDICTED: 60S ribosomal protein L18-2-like [Oryza brachyantha]
Length=188

 Score = 97.8 bits (242),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAP+SDDVYLKL+VKLYRFL RRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSDDVYLKLIVKLYRFLYRRTKSKFNAVILKRLFMSK  56



>gb|KFK37967.1| hypothetical protein AALP_AA3G053100 [Arabis alpina]
Length=187

 Score = 97.8 bits (242),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT S FN VILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSNFNKVILKRLFMSK  56



>ref|NP_001050069.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|ABF95861.1| 60S ribosomal protein L18, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11983.1| Os03g0341100 [Oryza sativa Japonica Group]
 gb|EEC75232.1| hypothetical protein OsI_11506 [Oryza sativa Indica Group]
 gb|EEE59035.1| hypothetical protein OsJ_10788 [Oryza sativa Japonica Group]
Length=187

 Score = 97.4 bits (241),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAPKSDDVYLKL+VKLYRFLVRRT S FNAVIL+RLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPKSDDVYLKLIVKLYRFLVRRTKSPFNAVILRRLFMSK  56



>ref|NP_001060617.1| Os07g0674700 [Oryza sativa Japonica Group]
 dbj|BAC83538.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAD31974.1| putative cytoplasmic ribosomal protein L18 [Oryza sativa Japonica 
Group]
 dbj|BAF22531.1| Os07g0674700 [Oryza sativa Japonica Group]
 gb|EAZ05118.1| hypothetical protein OsI_27311 [Oryza sativa Indica Group]
 dbj|BAG89915.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67806.1| hypothetical protein OsJ_25556 [Oryza sativa Japonica Group]
Length=195

 Score = 96.7 bits (239),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAP+S+DVYLKL+VKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYLKLIVKLYRFLVRRTKSHFNAVILKRLFMSK  56



>gb|EPS67068.1| hypothetical protein M569_07709, partial [Genlisea aurea]
Length=186

 Score = 96.7 bits (239),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  43   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            GIDL AGGKSK+TKRTAPKS+D+YLKLLVKLYRFLVRRT SKFN V+LKRLFMS+
Sbjct  1    GIDLVAGGKSKKTKRTAPKSNDIYLKLLVKLYRFLVRRTESKFNGVVLKRLFMSR  55



>ref|XP_001785869.1| predicted protein [Physcomitrella patens]
 gb|EDQ49322.1| predicted protein [Physcomitrella patens]
Length=186

 Score = 96.3 bits (238),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGG++K+TKRTAPKSD+VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSDNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSR  56



>gb|EMS65848.1| 60S ribosomal protein L18-2 [Triticum urartu]
Length=229

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  43   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            GIDL AGG++K+TKR APKS+DVYLKLLVKLYRFLVRRT SKFNAVILKRLFMSK
Sbjct  8    GIDLVAGGRNKRTKRVAPKSNDVYLKLLVKLYRFLVRRTKSKFNAVILKRLFMSK  62



>gb|KFK32338.1| hypothetical protein AALP_AA6G228700 [Arabis alpina]
Length=197

 Score = 95.9 bits (237),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  34   STMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
             + GIDL AGGKSK+TKRTAPKSDDVYLKL VKLYRFLVRRT S FN VILKRLFMSK
Sbjct  11   ESSGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTQSNFNKVILKRLFMSK  68



>gb|EYU21621.1| hypothetical protein MIMGU_mgv1a014504mg [Erythranthe guttata]
Length=187

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRTAP+S+DVY+KLLVKLYRFL RRTGS FN++ILKRL MS+
Sbjct  1    MGIDLVAGGKSKKTKRTAPRSNDVYIKLLVKLYRFLTRRTGSSFNSIILKRLIMSR  56



>sp|O22254.3|RL181_ARATH RecName: Full=Putative 60S ribosomal protein L18-1 [Arabidopsis 
thaliana]
Length=188

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRT PKSDDVYLKLLVK  R+LVRRT SKFNAVILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKTKRTEPKSDDVYLKLLVKANRYLVRRTESKFNAVILKRLFMSK  56



>ref|XP_006650060.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAP+S+DVYLKL+VKLYRFLVRRT S FNAVIL+RLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYLKLIVKLYRFLVRRTKSPFNAVILRRLFMSK  56



>ref|XP_001419602.1| Ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97895.1| Ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=186

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGG++K+T RTAPKSD+VYLKLLVKLYRFL RRT SKFN  +LKRLFMSK
Sbjct  1    MGIDLKAGGRNKKTNRTAPKSDNVYLKLLVKLYRFLARRTDSKFNDTVLKRLFMSK  56



>emb|CDY27753.1| BnaA05g31620D [Brassica napus]
Length=118

 Score = 93.2 bits (230),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  28   RRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILK  189
             ++TMGIDL AGGKSK+TKRTAPKS+DVYLKL VKLYRFLVRRT SKFNAVILK
Sbjct  65   EKATMGIDLIAGGKSKKTKRTAPKSEDVYLKLTVKLYRFLVRRTQSKFNAVILK  118



>ref|XP_001760959.1| predicted protein [Physcomitrella patens]
 gb|EDQ74348.1| predicted protein [Physcomitrella patens]
Length=186

 Score = 94.7 bits (234),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FNAV+LKRLFMS+
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSGNVYLKLLVKLYRFLVRRTDAPFNAVVLKRLFMSR  56



>ref|XP_006444385.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 ref|XP_006479993.1| PREDICTED: 60S ribosomal protein L18-3-like [Citrus sinensis]
 gb|ESR57625.1| hypothetical protein CICLE_v10022435mg [Citrus clementina]
 gb|KDO87175.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
 gb|KDO87176.1| hypothetical protein CISIN_1g029841mg [Citrus sinensis]
Length=187

 Score = 94.4 bits (233),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK++KRTAPKS+D+YLKLLVKLYRFLVRRT S F+ VILKRLFMSK
Sbjct  1    MGIDLIAGGKSKKSKRTAPKSNDIYLKLLVKLYRFLVRRTDSNFDKVILKRLFMSK  56



>ref|XP_001751734.1| predicted protein [Physcomitrella patens]
 gb|EDQ83169.1| predicted protein [Physcomitrella patens]
Length=186

 Score = 94.4 bits (233),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FN+VILKRLFMS+
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSGNVYLKLLVKLYRFLVRRTDAPFNSVILKRLFMSR  56



>ref|XP_006658116.1| PREDICTED: 60S ribosomal protein L18-3-like [Oryza brachyantha]
Length=187

 Score = 94.0 bits (232),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+TKRTAP+S+DVY+KLLVKLYRFL RRT S FNAVILKRLFMSK
Sbjct  1    MGIDLVAGGRNKKTKRTAPRSEDVYVKLLVKLYRFLERRTKSHFNAVILKRLFMSK  56



>ref|XP_001781485.1| predicted protein [Physcomitrella patens]
 gb|EDQ53665.1| predicted protein [Physcomitrella patens]
Length=186

 Score = 94.0 bits (232),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSQNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSR  56



>ref|XP_001760902.1| predicted protein [Physcomitrella patens]
 gb|EDQ74291.1| predicted protein [Physcomitrella patens]
Length=186

 Score = 94.0 bits (232),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGG++K+TKRTAPKS +VYLKLLVKLYRFLVRRT + FN+V+LKRLFMS+
Sbjct  1    MGIDLKAGGRNKKTKRTAPKSQNVYLKLLVKLYRFLVRRTDAPFNSVVLKRLFMSR  56



>ref|XP_001690885.1| ribosomal protein L18, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 ref|XP_010832938.1| PREDICTED: 60S ribosomal protein L18-2-like [Bison bison bison]
 gb|EDP05331.1| ribosomal protein L18 [Chlamydomonas reinhardtii]
Length=187

 Score = 93.6 bits (231),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGG+SK+  RTAPKS +VYL LLVKLYRFLVRRT SKFN VILKRLFMSK
Sbjct  1    MGIDLKAGGRSKKVHRTAPKSQNVYLALLVKLYRFLVRRTESKFNKVILKRLFMSK  56



>ref|XP_002948325.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ50732.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=187

 Score = 93.6 bits (231),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGG+SK+  RTAPKS +VYL LLVKLYRFLVRRT SKFN VILKRLFMSK
Sbjct  1    MGIDLKAGGRSKKVHRTAPKSQNVYLALLVKLYRFLVRRTDSKFNKVILKRLFMSK  56



>sp|O65729.1|RL18_CICAR RecName: Full=60S ribosomal protein L18, partial [Cicer arietinum]
 emb|CAA06246.1| ribosomal protein L18 [Cicer arietinum]
Length=183

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/53 (87%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  49   DLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            DLKAGGK+K+TKRT+PKS+D+YLKLLVKLYRFLVRRT S FNAVILKRLFMSK
Sbjct  1    DLKAGGKNKKTKRTSPKSNDIYLKLLVKLYRFLVRRTDSNFNAVILKRLFMSK  53



>gb|EYU46738.1| hypothetical protein MIMGU_mgv1a014520mg [Erythranthe guttata]
Length=187

 Score = 92.4 bits (228),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK+TKRT PKSDD+Y+KLLVKLY FLVRRTGSKFN V+ KRL MS+
Sbjct  1    MGIDLVAGGKSKKTKRTKPKSDDIYIKLLVKLYSFLVRRTGSKFNEVVRKRLTMSR  56



>ref|XP_005643635.1| ribosomal protein L18 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE19091.1| ribosomal protein L18 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=186

 Score = 91.3 bits (225),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL+AGG++K+T RTAPKS++VYLKLLVKLY FLVRRT SKFN V+LKRLFMS+
Sbjct  1    MGIDLEAGGRNKKTWRTAPKSENVYLKLLVKLYTFLVRRTESKFNKVVLKRLFMSR  56



>gb|KIZ05100.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
 gb|KIZ07537.1| 60S ribosomal protein L18-3 [Monoraphidium neglectum]
Length=187

 Score = 89.7 bits (221),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++ +  RTAPKSD+VYLKLLVKLYRFL RRT S FNAV+LKRLFMSK
Sbjct  1    MGIDLVAGGRNTKKHRTAPKSDNVYLKLLVKLYRFLERRTESNFNAVVLKRLFMSK  56



>emb|CDP04821.1| unnamed protein product [Coffea canephora]
Length=90

 Score = 86.7 bits (213),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 47/51 (92%), Gaps = 1/51 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGS-KFNAVILK  189
            MGIDLKAGGK K+TKRTAPKSDD+YLKL VKLYRFLVRRTGS  FNAV+LK
Sbjct  1    MGIDLKAGGKVKKTKRTAPKSDDIYLKLFVKLYRFLVRRTGSTTFNAVLLK  51



>gb|EWM27599.1| Ribosomal protein L18e/L15P [Nannochloropsis gaditana]
Length=191

 Score = 88.6 bits (218),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTK-RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLK+GG+    K RTAPKSD+VYLKLLVKLYRFL RRT S FNAVILKRLFMSK
Sbjct  1    MGIDLKSGGRRTGHKTRTAPKSDNVYLKLLVKLYRFLARRTDSNFNAVILKRLFMSK  57



>emb|CDY05183.1| BnaC05g46200D [Brassica napus]
Length=223

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  43   GIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            GIDL AGGKSK+TKRTAPKSDDVYL      YRFLVRRT SKFNAVILKRLFMSK
Sbjct  38   GIDLIAGGKSKKTKRTAPKSDDVYLSSPESFYRFLVRRTQSKFNAVILKRLFMSK  92



>ref|XP_002506220.1| ribosomal protein L18 [Micromonas sp. RCC299]
 gb|ACO67478.1| ribosomal protein L18 [Micromonas sp. RCC299]
Length=386

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 4/67 (6%)
 Frame = +1

Query  7    SPKPPLQRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVIL  186
            +P PP     + GID++AGG++K+  RTAPKS++VYLKLLVKLYRFLVRRT SK N  IL
Sbjct  196  APPPPY----SQGIDIEAGGRNKKKSRTAPKSENVYLKLLVKLYRFLVRRTDSKVNETIL  251

Query  187  KRLFMSK  207
            KRLFMSK
Sbjct  252  KRLFMSK  258



>ref|XP_003056676.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58321.1| predicted protein [Micromonas pusilla CCMP1545]
Length=183

 Score = 87.0 bits (214),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL+AGG++K   RTAPKS++VYLKLLVKLYRFL RRT S FN  +LKRLFMSK
Sbjct  1    MGIDLEAGGRNKVKHRTAPKSENVYLKLLVKLYRFLARRTDSDFNKTVLKRLFMSK  56



>ref|XP_005843726.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
 gb|EFN51624.1| hypothetical protein CHLNCDRAFT_37334 [Chlorella variabilis]
Length=187

 Score = 85.9 bits (211),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGG++K+  RTAPKS++ Y+KLLVKLYRFLVRRT S FN V+LKRLFMSK
Sbjct  1    MGIDLIAGGRNKRVHRTAPKSENPYVKLLVKLYRFLVRRTESDFNKVVLKRLFMSK  56



>ref|XP_011396696.1| 60S ribosomal protein L18-3 [Auxenochlorella protothecoides]
 gb|KFM23818.1| 60S ribosomal protein L18-3 [Auxenochlorella protothecoides]
Length=187

 Score = 85.9 bits (211),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL+AGG++ +  RTAPKS + Y+KLLVKLYRFLVRRT S FN VILKRLFMSK
Sbjct  1    MGIDLRAGGRNTKVHRTAPKSQNPYVKLLVKLYRFLVRRTESDFNKVILKRLFMSK  56



>emb|CBI22337.3| unnamed protein product [Vitis vinifera]
Length=135

 Score = 84.7 bits (208),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  34   STMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            + MGI L    KSK+TK TAPKSDD+YLKL VKLY FLVR+TGSKFN V LKR FMSK
Sbjct  31   AAMGIGLVVDDKSKKTKCTAPKSDDIYLKLTVKLYHFLVRKTGSKFNVVTLKRFFMSK  88



>ref|XP_004495692.1| PREDICTED: 60S ribosomal protein L18-like [Cicer arietinum]
Length=187

 Score = 85.9 bits (211),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLKAGGKSK++KRTAPKS+D+YLKLLVKLYRFLVRRTGS FNAVILKRLFMSK
Sbjct  1    MGIDLKAGGKSKKSKRTAPKSNDIYLKLLVKLYRFLVRRTGSNFNAVILKRLFMSK  56



>ref|XP_007510670.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18203.1| predicted protein [Bathycoccus prasinos]
Length=240

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +1

Query  34   STMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            S  GIDL+AGG++K+TKRT+ KS++VYL LLVKLYRFL RRT SKFN  +LKRLFMSK
Sbjct  53   SGKGIDLEAGGRNKKTKRTSQKSENVYLALLVKLYRFLARRTDSKFNQTVLKRLFMSK  110



>emb|CAN68117.1| hypothetical protein VITISV_012514 [Vitis vinifera]
Length=271

 Score = 84.7 bits (208),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGI L    KSK+TK TAPKSDD+YLKL VKLY FLVR+TGSKFN V LKR FMSK
Sbjct  1    MGIGLVVDDKSKKTKCTAPKSDDIYLKLTVKLYHFLVRKTGSKFNVVTLKRFFMSK  56



>ref|XP_005535130.1| 60S ribosomal protein L18 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM78844.1| 60S ribosomal protein L18 [Cyanidioschyzon merolae strain 10D]
Length=189

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL+AGG+SK+ +R AP+S D YL+LLV+LY FL RRTG+ FNAV+ KRL MS+
Sbjct  1    MGIDLRAGGRSKRKQRDAPRSQDPYLQLLVRLYAFLARRTGAPFNAVVWKRLCMSR  56



>ref|XP_006677675.1| hypothetical protein BATDEDRAFT_87003 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82239.1| hypothetical protein BATDEDRAFT_87003 [Batrachochytrium dendrobatidis 
JAM81]
Length=186

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MG+DL+     K+  R APKSD+VYL+LLVKLYRFL RRT SKFN V+LKRLFMS+
Sbjct  1    MGVDLQKKHHQKKGARVAPKSDNVYLRLLVKLYRFLARRTNSKFNQVVLKRLFMSR  56



>gb|ABW90395.1| putative ribosomal protein L18 [Barentsia elongata]
Length=188

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGID+      ++T RTAPKSDDVYL+LLVKLYRFL RRT +KFN +ILKRLFMSK
Sbjct  1    MGIDINHK-HDRKTGRTAPKSDDVYLRLLVKLYRFLARRTDAKFNKIILKRLFMSK  55



>ref|XP_005787945.1| hypothetical protein EMIHUDRAFT_433854 [Emiliania huxleyi CCMP1516]
 gb|EOD35516.1| hypothetical protein EMIHUDRAFT_433854 [Emiliania huxleyi CCMP1516]
Length=190

 Score = 78.6 bits (192),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 50/58 (86%), Gaps = 2/58 (3%)
 Frame = +1

Query  40   MGIDLKAGGK--SKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGID+KAGG+  +K++ RTAP S+++YL+L+VKLYRFL RRT +KFN V+LKRLF SK
Sbjct  1    MGIDIKAGGRKATKKSGRTAPVSENLYLRLIVKLYRFLARRTDAKFNKVVLKRLFTSK  58



>ref|XP_005704346.1| 60S ribosomal protein L18e [Galdieria sulphuraria]
 gb|EME27826.1| 60S ribosomal protein L18e [Galdieria sulphuraria]
Length=190

 Score = 78.6 bits (192),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL+ GG+ K+  RTAPKS++ YL LLVKLYRFL RRT S FN  +LKRLFMS+
Sbjct  1    MGIDLEKGGRIKKRNRTAPKSENPYLLLLVKLYRFLARRTNSNFNKTVLKRLFMSR  56



>gb|AAN35197.1| ribosomal protein L18 [Euprymna scolopes]
Length=63

 Score = 75.1 bits (183),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGID+      ++ +RTAPKS+D+YL+LLVKLYRFL RRT S FN V+LKRLFMS+
Sbjct  1    MGIDI-CHRFERKVRRTAPKSNDIYLRLLVKLYRFLARRTNSMFNKVVLKRLFMSR  55



>emb|CEP17694.1| hypothetical protein [Parasitella parasitica]
Length=181

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLK     K + RTAPKSD+VYL LLVKLYRFL RRT + FN V+LKRLFMS+
Sbjct  1    MGIDLKKH-HVKNSNRTAPKSDNVYLALLVKLYRFLARRTNANFNKVVLKRLFMSR  55



>ref|XP_008607735.1| 60S ribosomal protein [Saprolegnia diclina VS20]
 gb|EQC38911.1| 60S ribosomal protein [Saprolegnia diclina VS20]
 gb|KDO29707.1| 60S ribosomal protein [Saprolegnia parasitica CBS 223.65]
Length=192

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTK-RTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MG D+ AGGKS   K RTAPKS++VYL LLV+LYRFL RRT +KFN V+LKRL+MS+
Sbjct  1    MGKDIIAGGKSTGRKSRTAPKSENVYLNLLVRLYRFLARRTDAKFNEVVLKRLYMSR  57



>gb|ESA23412.1| hypothetical protein GLOINDRAFT_342179 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX78030.1| ribosomal 60S subunit protein L18A [Rhizophagus irregularis DAOM 
197198w]
Length=183

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGID+K     ++  RTAPKS+DVYL+LLVK+YRFL RRT SKFN+ ILKRLFMS+
Sbjct  1    MGIDIKKH-HVRRKNRTAPKSEDVYLRLLVKIYRFLARRTNSKFNSAILKRLFMSR  55



>emb|CEG66137.1| Putative 60S ribosomal protein L18-A [Rhizopus microsporus]
Length=193

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +1

Query  25   QRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMS  204
            Q R   GIDLK     K + R+APKSD+VYL LLVKLYRFL RRT +KFN V+LKRLFMS
Sbjct  8    QERRKAGIDLKRH-HVKNSNRSAPKSDNVYLALLVKLYRFLARRTDAKFNKVVLKRLFMS  66

Query  205  K  207
            +
Sbjct  67   R  67



>emb|CEI89354.1| Putative 60S ribosomal protein L18-A [Rhizopus microsporus]
Length=193

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 1/61 (2%)
 Frame = +1

Query  25   QRRSTMGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMS  204
            Q R   GIDLK     K + R+APKSD+VYL LLVKLYRFL RRT +KFN V+LKRLFMS
Sbjct  8    QERRKAGIDLKRH-HVKNSNRSAPKSDNVYLALLVKLYRFLARRTDAKFNKVVLKRLFMS  66

Query  205  K  207
            +
Sbjct  67   R  67



>ref|XP_968042.1| PREDICTED: 60S ribosomal protein L18 [Tribolium castaneum]
 gb|EFA00786.1| hypothetical protein TcasGA2_TC003672 [Tribolium castaneum]
Length=188

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGID+      ++ +RT PKS DVYL+LLVKLYR+L RRTGSKFN +ILKRLFMSK
Sbjct  1    MGIDINHK-HDRKVRRTEPKSQDVYLRLLVKLYRYLARRTGSKFNKIILKRLFMSK  55



>gb|EIE90592.1| 60S ribosomal protein L18-B [Rhizopus delemar RA 99-880]
Length=181

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLK     K + RTAPKSD+VYL LLVKLYRFL RRT ++FN V+LKRLFMS+
Sbjct  1    MGIDLKRH-HVKNSNRTAPKSDNVYLALLVKLYRFLARRTDAEFNKVVLKRLFMSR  55



>ref|XP_011351685.1| PREDICTED: 60S ribosomal protein L18 [Cerapachys biroi]
 gb|EZA61183.1| 60S ribosomal protein L18 [Cerapachys biroi]
Length=188

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGID+      ++ +RT PKS+DVYL+LLVKLYRFL RRT SKFN +ILKRLFMSK
Sbjct  1    MGIDINHK-HDRKVRRTEPKSEDVYLRLLVKLYRFLARRTNSKFNRIILKRLFMSK  55



>emb|CCT68782.1| probable ribosomal protein L18, cytosolic [Fusarium fujikuroi 
IMI 58289]
Length=230

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 49/71 (69%), Gaps = 3/71 (4%)
 Frame = +1

Query  1    PLSPKPPLQRRST--MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFN  174
            PL P  P    +T  MGIDL      K T RTAPKSD+VYLKLLVKLYRFL RRT S FN
Sbjct  32   PLYPTSPNFTATTAAMGIDLDRH-HVKGTHRTAPKSDNVYLKLLVKLYRFLARRTDSSFN  90

Query  175  AVILKRLFMSK  207
             V+L+RLF SK
Sbjct  91   KVVLRRLFTSK  101



>emb|CCU77907.1| putative 60S ribosomal protein L18 [Blumeria graminis f. sp. 
hordei DH14]
Length=184

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL A    + T R APKSD+VY+KLLVKLYRFL RRT S FN V+L+RLFMS+
Sbjct  1    MGIDLNAH-HVRNTHRKAPKSDNVYIKLLVKLYRFLARRTDSSFNKVVLRRLFMSR  55



>emb|CEI93758.1| Putative 50S ribosomal protein L18e [Rhizopus microsporus]
Length=181

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLK     K + RT+PKSD+VYL LLVKLYRFL RRT +KFN V+LKRLFMS+
Sbjct  1    MGIDLKKH-HVKNSNRTSPKSDNVYLALLVKLYRFLARRTDAKFNKVVLKRLFMSR  55



>emb|CEG65761.1| Putative 50S ribosomal protein L18e [Rhizopus microsporus]
 emb|CEG65834.1| Putative 50S ribosomal protein L18e [Rhizopus microsporus]
 emb|CEI99283.1| Putative 50S ribosomal protein L18e [Rhizopus microsporus]
 emb|CEI92564.1| Putative 50S ribosomal protein L18e [Rhizopus microsporus]
Length=181

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLK     K + RT+PKSD+VYL LLVKLYRFL RRT +KFN V+LKRLFMS+
Sbjct  1    MGIDLKKH-HVKNSNRTSPKSDNVYLALLVKLYRFLARRTDAKFNKVVLKRLFMSR  55



>emb|CEG79287.1| Putative 60S ribosomal protein L18-A [Rhizopus microsporus]
Length=181

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 45/56 (80%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLK     K + RT+PKSD+VYL LLVKLYRFL RRT +KFN V+LKRLFMS+
Sbjct  1    MGIDLKKH-HVKNSNRTSPKSDNVYLALLVKLYRFLARRTDAKFNKVVLKRLFMSR  55



>ref|XP_010277700.1| PREDICTED: uncharacterized protein LOC104612082 [Nelumbo nucifera]
Length=491

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 4/50 (8%)
 Frame = +1

Query  58   AGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            AGGKSK+TKRTAPKS D+YLKL    YRFL+RRTGS FNAVILKRLFMS+
Sbjct  282  AGGKSKKTKRTAPKSKDIYLKL----YRFLIRRTGSNFNAVILKRLFMSR  327



>ref|XP_004290808.1| PREDICTED: 60S ribosomal protein L18-2 [Fragaria vesca subsp. 
vesca]
Length=187

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL AGGKSK T+RT+P+S D+YLKL VKLY F+ RRT S F+ VI  RL MSK
Sbjct  1    MGIDLVAGGKSKNTRRTSPRSQDIYLKLTVKLYDFIHRRTKSHFSKVIRHRLCMSK  56



>gb|ELR09673.1| hypothetical protein GMDG_04159, partial [Pseudogymnoascus destructans 
20631-21]
Length=213

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL A    + T R APKSD+VYLKLLVKLYRFL RRT S FN V+L+RLFMS+
Sbjct  30   MGIDLDAH-HVRSTHRKAPKSDNVYLKLLVKLYRFLARRTESSFNKVVLRRLFMSR  84



>ref|XP_008085192.1| Ribosomal proteins L15p and L18e [Glarea lozoyensis ATCC 20868]
 gb|EHL00438.1| putative 60S ribosomal protein L18-B [Glarea lozoyensis 74030]
 gb|EPE27833.1| Ribosomal proteins L15p and L18e [Glarea lozoyensis ATCC 20868]
Length=184

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDL A    + T R APKSD+VYLKLLVKLYRFL RRT S FN V+L+RLFMS+
Sbjct  1    MGIDLDAH-HVRSTHRKAPKSDNVYLKLLVKLYRFLARRTESSFNKVVLRRLFMSR  55



>emb|CEP19927.1| hypothetical protein [Parasitella parasitica]
Length=181

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +1

Query  40   MGIDLKAGGKSKQTKRTAPKSDDVYLKLLVKLYRFLVRRTGSKFNAVILKRLFMSK  207
            MGIDLK     K + RTAPKSD+VYL LLVKLYRFL RRT + FN V+LKRLFMS+
Sbjct  1    MGIDLKKH-HVKNSNRTAPKSDNVYLALLVKLYRFLARRTDANFNKVVLKRLFMSR  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559716100580