BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF048M09

Length=625
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009598882.1|  PREDICTED: putative peptide chain release fa...    143   2e-36   Nicotiana tomentosiformis
ref|XP_009598881.1|  PREDICTED: putative peptide chain release fa...    136   4e-34   
ref|XP_006354686.1|  PREDICTED: putative peptide chain release fa...    136   5e-34   Solanum tuberosum [potatoes]
ref|XP_006354685.1|  PREDICTED: putative peptide chain release fa...    136   6e-34   Solanum tuberosum [potatoes]
ref|XP_009791270.1|  PREDICTED: putative peptide chain release fa...    135   7e-34   Nicotiana sylvestris
ref|XP_004237247.1|  PREDICTED: peptide chain release factor 1-li...    135   1e-33   Solanum lycopersicum
ref|XP_002276037.1|  PREDICTED: peptide chain release factor PrfB...    133   7e-33   Vitis vinifera
emb|CBI17600.3|  unnamed protein product                                133   8e-33   Vitis vinifera
ref|XP_011084675.1|  PREDICTED: peptide chain release factor PrfB...    131   3e-32   Sesamum indicum [beniseed]
ref|XP_002514811.1|  peptide chain release factor, putative             130   5e-32   Ricinus communis
ref|XP_008218473.1|  PREDICTED: putative peptide chain release fa...    127   7e-31   Prunus mume [ume]
emb|CDP04172.1|  unnamed protein product                                126   2e-30   Coffea canephora [robusta coffee]
gb|EPS67120.1|  hypothetical protein M569_07654                         125   3e-30   Genlisea aurea
gb|KHG10328.1|  Peptide chain release factor 2                          125   3e-30   Gossypium arboreum [tree cotton]
ref|XP_010101235.1|  Peptide chain release factor 2                     125   4e-30   Morus notabilis
ref|XP_006480480.1|  PREDICTED: peptide chain release factor 1, m...    125   4e-30   Citrus sinensis [apfelsine]
ref|XP_010258507.1|  PREDICTED: peptide chain release factor 1-li...    124   6e-30   Nelumbo nucifera [Indian lotus]
ref|XP_004172841.1|  PREDICTED: peptide chain release factor 2-like     120   1e-29   
gb|KJB26869.1|  hypothetical protein B456_004G264100                    123   3e-29   Gossypium raimondii
ref|XP_007029207.1|  High chlorophyll fluorescent 109 isoform 2         122   3e-29   
ref|XP_010673888.1|  PREDICTED: peptide chain release factor PrfB...    122   4e-29   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010038617.1|  PREDICTED: peptide chain release factor 1-li...    122   5e-29   Eucalyptus grandis [rose gum]
gb|KFK30645.1|  hypothetical protein AALP_AA6G008900                    121   1e-28   Arabis alpina [alpine rockcress]
ref|XP_010450443.1|  PREDICTED: peptide chain release factor 1-li...    120   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010528652.1|  PREDICTED: peptide chain release factor 1, m...    120   2e-28   Tarenaya hassleriana [spider flower]
emb|CDY68504.1|  BnaAnng27520D                                          120   3e-28   Brassica napus [oilseed rape]
ref|XP_009144652.1|  PREDICTED: putative peptide chain release fa...    120   3e-28   Brassica rapa
ref|XP_009144654.1|  PREDICTED: putative peptide chain release fa...    119   3e-28   
ref|XP_009361583.1|  PREDICTED: peptide chain release factor 1, m...    119   3e-28   Pyrus x bretschneideri [bai li]
ref|XP_010435494.1|  PREDICTED: peptide chain release factor 1-li...    119   4e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010435490.1|  PREDICTED: peptide chain release factor 1-li...    119   5e-28   
gb|KGN66643.1|  hypothetical protein Csa_1G652260                       119   5e-28   
ref|XP_003534498.1|  PREDICTED: peptide chain release factor 2-like     119   5e-28   Glycine max [soybeans]
ref|XP_010435495.1|  PREDICTED: putative peptide chain release fa...    119   5e-28   Camelina sativa [gold-of-pleasure]
ref|XP_002870470.1|  HCF109                                             119   6e-28   
ref|NP_851096.1|  protein high chlorophyll fluorescent 109              119   7e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KDO53118.1|  hypothetical protein CISIN_1g0170091mg                  113   8e-28   Citrus sinensis [apfelsine]
ref|XP_011006686.1|  PREDICTED: peptide chain release factor PrfB...    119   9e-28   Populus euphratica
ref|NP_198466.2|  protein high chlorophyll fluorescent 109              118   9e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010908923.1|  PREDICTED: peptide chain release factor PrfB...    118   1e-27   Elaeis guineensis
ref|XP_004304824.1|  PREDICTED: peptide chain release factor PrfB...    118   1e-27   Fragaria vesca subsp. vesca
ref|XP_002312196.2|  hypothetical protein POPTR_0008s07570g             118   1e-27   
ref|XP_009393515.1|  PREDICTED: peptide chain release factor 1-li...    118   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_851097.1|  protein high chlorophyll fluorescent 109              117   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008788225.1|  PREDICTED: peptide chain release factor 1-li...    117   2e-27   Phoenix dactylifera
ref|XP_006395914.1|  hypothetical protein EUTSA_v10004205mg             117   3e-27   Eutrema salsugineum [saltwater cress]
emb|CAG25777.1|  putative translation releasing factor 2                116   4e-27   Cucumis sativus [cucumbers]
gb|KDO53117.1|  hypothetical protein CISIN_1g0170091mg                  113   5e-27   Citrus sinensis [apfelsine]
ref|XP_007139703.1|  hypothetical protein PHAVU_008G052200g             115   9e-27   Phaseolus vulgaris [French bean]
ref|XP_008388820.1|  PREDICTED: peptide chain release factor 1, m...    115   1e-26   Malus domestica [apple tree]
ref|XP_008443659.1|  PREDICTED: peptide chain release factor 1, m...    115   2e-26   Cucumis melo [Oriental melon]
emb|CDY06442.1|  BnaC06g12020D                                          115   2e-26   
gb|KDP26898.1|  hypothetical protein JCGZ_18056                         114   2e-26   Jatropha curcas
ref|XP_003624209.1|  Peptide chain release factor                       115   2e-26   Medicago truncatula
ref|XP_006283633.1|  hypothetical protein CARUB_v10004691mg             115   2e-26   
tpg|DAA63046.1|  TPA: hypothetical protein ZEAMMB73_861498              113   7e-26   
ref|XP_004492862.1|  PREDICTED: peptide chain release factor 2-like     113   7e-26   Cicer arietinum [garbanzo]
ref|XP_003560113.2|  PREDICTED: peptide chain release factor 1-li...    113   8e-26   
tpg|DAA63044.1|  TPA: hypothetical protein ZEAMMB73_861498              112   9e-26   
ref|NP_001152654.1|  peptide chain release factor 2                     112   1e-25   Zea mays [maize]
ref|XP_004957951.1|  PREDICTED: peptide chain release factor 1, m...    111   3e-25   Setaria italica
dbj|BAJ87733.1|  predicted protein                                      112   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002462979.1|  hypothetical protein SORBIDRAFT_02g035755          109   9e-25   
gb|EMT33004.1|  Peptide chain release factor 2                          110   9e-25   
ref|XP_010435491.1|  PREDICTED: putative peptide chain release fa...    108   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_007205352.1|  hypothetical protein PRUPE_ppa007171mg             108   3e-24   
ref|NP_001059924.1|  Os07g0546600                                       108   4e-24   
gb|EEE67361.1|  hypothetical protein OsJ_24645                          107   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006858849.1|  hypothetical protein AMTR_s00066p00184560          106   2e-23   Amborella trichopoda
ref|XP_007029206.1|  High chlorophyll fluorescent 109 isoform 1         106   4e-23   
ref|XP_011006754.1|  PREDICTED: peptide chain release factor PrfB...    103   1e-22   Populus euphratica
ref|XP_006658669.1|  PREDICTED: peptide chain release factor 1, m...    103   4e-22   
ref|XP_008443661.1|  PREDICTED: peptide chain release factor 1, m...    102   4e-22   
ref|XP_008443660.1|  PREDICTED: peptide chain release factor 1, m...  97.8    1e-20   
gb|EMS47820.1|  Peptide chain release factor 2                        99.4    2e-20   Triticum urartu
gb|EAZ04247.1|  hypothetical protein OsI_26391                        95.5    2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_004139158.1|  PREDICTED: peptide chain release factor 2-like   94.0    6e-19   
ref|XP_006428672.1|  hypothetical protein CICLE_v10012132mg           75.5    8e-13   
ref|XP_010445528.1|  PREDICTED: uncharacterized protein LOC104728206  65.9    2e-10   
ref|XP_010436685.1|  PREDICTED: probable peptide chain release fa...  57.8    3e-07   Camelina sativa [gold-of-pleasure]
gb|EYU39728.1|  hypothetical protein MIMGU_mgv1a016376mg              52.8    7e-06   Erythranthe guttata [common monkey flower]
ref|XP_002992014.1|  hypothetical protein SELMODRAFT_134701           53.9    2e-05   
ref|XP_002964513.1|  hypothetical protein SELMODRAFT_64370            53.5    3e-05   



>ref|XP_009598882.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
isoform X2 [Nicotiana tomentosiformis]
Length=464

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 112/126 (89%), Gaps = 3/126 (2%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            ATPEV  VS++ET  REWAMQDFY LRKDVE V +RVEEIRAAAGL+QL+ D+AALEAAA
Sbjct  70   ATPEV-GVSNTET--REWAMQDFYTLRKDVETVFERVEEIRAAAGLKQLQHDLAALEAAA  126

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            AD++LWD+RA+AQ+TLQ LTD K+KLKLL+DF TQ  DAETII LTEEMDSID+GLL+EA
Sbjct  127  ADSSLWDNRAKAQETLQALTDYKDKLKLLHDFKTQADDAETIIKLTEEMDSIDSGLLQEA  186

Query  605  AGIIKE  622
            AGIIKE
Sbjct  187  AGIIKE  192



>ref|XP_009598881.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
isoform X1 [Nicotiana tomentosiformis]
Length=470

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 112/132 (85%), Gaps = 9/132 (7%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            ATPEV  VS++ET  REWAMQDFY LRKDVE V +RVEEIRAAAGL+QL+ D+AALEAAA
Sbjct  70   ATPEV-GVSNTET--REWAMQDFYTLRKDVETVFERVEEIRAAAGLKQLQHDLAALEAAA  126

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMT------QVGDAETIINLTEEMDSIDT  586
            AD++LWD+RA+AQ+TLQ LTD K+KLKLL+DF T      Q  DAETII LTEEMDSID+
Sbjct  127  ADSSLWDNRAKAQETLQALTDYKDKLKLLHDFKTQEFALPQADDAETIIKLTEEMDSIDS  186

Query  587  GLLEEAAGIIKE  622
            GLL+EAAGIIKE
Sbjct  187  GLLQEAAGIIKE  198



>ref|XP_006354686.1| PREDICTED: putative peptide chain release factor 1, mitochondrial-like 
isoform X2 [Solanum tuberosum]
Length=469

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            ATPEV  VS++ET  REWAMQDFY LRKDVE V +RV+EIRAAAGL+QL+ED+AALEAAA
Sbjct  75   ATPEV-GVSNTET--REWAMQDFYTLRKDVETVLERVQEIRAAAGLKQLQEDLAALEAAA  131

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            AD++LWDDRA+AQ+TLQ LTD K+KLKLL DF TQ  DAETII LTEEMDSID+  L+EA
Sbjct  132  ADSSLWDDRAKAQETLQALTDCKDKLKLLRDFKTQADDAETIIKLTEEMDSIDSVFLQEA  191

Query  605  AGIIKE  622
            +GIIKE
Sbjct  192  SGIIKE  197



>ref|XP_006354685.1| PREDICTED: putative peptide chain release factor 1, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=472

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 110/126 (87%), Gaps = 3/126 (2%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            ATPEV  VS++ET  REWAMQDFY LRKDVE V +RV+EIRAAAGL+QL+ED+AALEAAA
Sbjct  78   ATPEV-GVSNTET--REWAMQDFYTLRKDVETVLERVQEIRAAAGLKQLQEDLAALEAAA  134

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            AD++LWDDRA+AQ+TLQ LTD K+KLKLL DF TQ  DAETII LTEEMDSID+  L+EA
Sbjct  135  ADSSLWDDRAKAQETLQALTDCKDKLKLLRDFKTQADDAETIIKLTEEMDSIDSVFLQEA  194

Query  605  AGIIKE  622
            +GIIKE
Sbjct  195  SGIIKE  200



>ref|XP_009791270.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
[Nicotiana sylvestris]
Length=467

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 111/132 (84%), Gaps = 9/132 (7%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            ATPEV  VS++ET  REWAMQDFY LRKDVE   +RVEEIRAAAGL+QL+ D+AALEAAA
Sbjct  67   ATPEV-GVSNTET--REWAMQDFYTLRKDVETALERVEEIRAAAGLKQLQHDLAALEAAA  123

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMT------QVGDAETIINLTEEMDSIDT  586
            AD++LWD+RA+AQ+TLQ LTD K+KLKLL+DF T      Q  DAETII LTEEMDSID+
Sbjct  124  ADSSLWDNRAKAQETLQALTDCKDKLKLLHDFKTQEFTLPQADDAETIIKLTEEMDSIDS  183

Query  587  GLLEEAAGIIKE  622
            GLL+EAAGIIKE
Sbjct  184  GLLQEAAGIIKE  195



>ref|XP_004237247.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
[Solanum lycopersicum]
Length=469

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 3/126 (2%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            ATPEV  V+++ET  REWAMQDFY LRKDVE V +RV+EIRAAAGL+QL+ED+AALEAAA
Sbjct  75   ATPEV-GVTNTET--REWAMQDFYTLRKDVETVLERVQEIRAAAGLKQLQEDLAALEAAA  131

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            AD +LWDDRA+AQ+TLQ LTD K+KLKLL DF TQ  DAETII LTEEMDSID+  L+EA
Sbjct  132  ADRSLWDDRAKAQETLQALTDCKDKLKLLRDFKTQADDAETIIKLTEEMDSIDSVFLQEA  191

Query  605  AGIIKE  622
            +GIIKE
Sbjct  192  SGIIKE  197



>ref|XP_002276037.1| PREDICTED: peptide chain release factor PrfB1, chloroplastic 
[Vitis vinifera]
Length=454

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 3/128 (2%)
 Frame = +2

Query  245  ATPE--VDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaalea  418
            A+PE  +D   ++ET + EWAMQDFY LR+DVE +S+R EEIRA+AGLQQLEE++AALE 
Sbjct  58   ASPESQLDMEVTTETSS-EWAMQDFYTLRRDVEAISERAEEIRASAGLQQLEEELAALEM  116

Query  419  aaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLE  598
             AAD++ WDDRA+AQ+TL  LTD K+K+KLL DF TQV DAETI+ LTEEMDSIDTGLLE
Sbjct  117  KAADSSFWDDRAKAQETLLALTDVKDKIKLLTDFKTQVEDAETIVKLTEEMDSIDTGLLE  176

Query  599  EAAGIIKE  622
            EAA IIKE
Sbjct  177  EAANIIKE  184



>emb|CBI17600.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 3/128 (2%)
 Frame = +2

Query  245  ATPE--VDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaalea  418
            A+PE  +D   ++ET + EWAMQDFY LR+DVE +S+R EEIRA+AGLQQLEE++AALE 
Sbjct  55   ASPESQLDMEVTTETSS-EWAMQDFYTLRRDVEAISERAEEIRASAGLQQLEEELAALEM  113

Query  419  aaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLE  598
             AAD++ WDDRA+AQ+TL  LTD K+K+KLL DF TQV DAETI+ LTEEMDSIDTGLLE
Sbjct  114  KAADSSFWDDRAKAQETLLALTDVKDKIKLLTDFKTQVEDAETIVKLTEEMDSIDTGLLE  173

Query  599  EAAGIIKE  622
            EAA IIKE
Sbjct  174  EAANIIKE  181



>ref|XP_011084675.1| PREDICTED: peptide chain release factor PrfB1, chloroplastic 
[Sesamum indicum]
Length=473

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 103/126 (82%), Gaps = 4/126 (3%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            ATPEV  VS+    T EWAMQDFY LRK+VE   +RVEEIRAAAGL+ LEE +A LE A+
Sbjct  79   ATPEV-GVSAE---TSEWAMQDFYSLRKEVETTLERVEEIRAAAGLKLLEESLADLEEAS  134

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            AD++LWDDR +AQQTLQ LTD KEK+KLL+DF  QV +AETI+ LTEEMDSIDTGLLEEA
Sbjct  135  ADSSLWDDRVKAQQTLQALTDVKEKIKLLDDFKAQVEEAETIVKLTEEMDSIDTGLLEEA  194

Query  605  AGIIKE  622
            A IIKE
Sbjct  195  ASIIKE  200



>ref|XP_002514811.1| peptide chain release factor, putative [Ricinus communis]
 gb|EEF47365.1| peptide chain release factor, putative [Ricinus communis]
Length=458

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            A P+       +T TREWAMQDFY LR+DVE  S+RVEEIR +AGLQQLE+++  LE+ A
Sbjct  64   AAPDSQLNVGVDTETREWAMQDFYSLRRDVEAASERVEEIRTSAGLQQLEQEVTNLESKA  123

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            A+T+ WDDRA AQ+TL  LTD K+K+KLL +F T+V DAETI+ LTEEMDSIDTGLLEEA
Sbjct  124  ANTSFWDDRATAQETLLALTDVKDKIKLLTEFKTKVEDAETIVKLTEEMDSIDTGLLEEA  183

Query  605  AGIIKE  622
            + IIKE
Sbjct  184  SSIIKE  189



>ref|XP_008218473.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
[Prunus mume]
Length=456

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            ATPE    +   T TREWAMQDFY LR+DVE +++RV+EIR +A LQQLE+++A LE  A
Sbjct  59   ATPESQVSTGLNTDTREWAMQDFYFLRRDVETMAERVKEIRDSACLQQLEQEVADLELKA  118

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            AD++ WDDRA+AQ+ L  LTD K++++LLN+F +QV DAETI+ LTEEMDS+D GLLEEA
Sbjct  119  ADSSFWDDRAKAQENLSALTDVKDRIRLLNEFKSQVEDAETIVKLTEEMDSVDNGLLEEA  178

Query  605  AGIIKE  622
            A IIKE
Sbjct  179  ASIIKE  184



>emb|CDP04172.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 101/126 (80%), Gaps = 4/126 (3%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            A PEV       T T EWAM DFY LR++VEV S+RVEEIRAAAGL+QLEED+A LE AA
Sbjct  92   AAPEVGV----STETSEWAMPDFYTLRRNVEVTSERVEEIRAAAGLKQLEEDLAKLEDAA  147

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
             D++LWDDRA+AQ+ LQ LTD ++++KLLNDF  Q+ DAETI+ LTEEMDSIDTGLLEEA
Sbjct  148  VDSSLWDDRAKAQEILQDLTDVRDRMKLLNDFKAQIEDAETIVKLTEEMDSIDTGLLEEA  207

Query  605  AGIIKE  622
              IIK+
Sbjct  208  VSIIKD  213



>gb|EPS67120.1| hypothetical protein M569_07654, partial [Genlisea aurea]
Length=396

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            A+ +V   S+  T T EW MQDFY LRKDVEV  Q VEEIRAAAG+++L+E++A LE AA
Sbjct  2    ASRDVGVSSTETTTTTEWIMQDFYTLRKDVEVTLQHVEEIRAAAGMKRLKENVADLEEAA  61

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            AD++LWDDR +AQQTLQ LTD KEK+KLLNDF  QV DAETI+ LTEEM+S+D GLL+EA
Sbjct  62   ADSSLWDDRQKAQQTLQSLTDLKEKIKLLNDFKAQVEDAETIVKLTEEMESVDAGLLQEA  121

Query  605  AGIIKE  622
            +GIIKE
Sbjct  122  SGIIKE  127



>gb|KHG10328.1| Peptide chain release factor 2 [Gossypium arboreum]
Length=467

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  ETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddrar  457
            ET TREW MQDFY LRKDVE+ S+RV EIR +AG+QQLE+++  LE+  AD++ WDDRA+
Sbjct  74   ETSTREWVMQDFYALRKDVEMASERVNEIRTSAGMQQLEKELVVLESKTADSSFWDDRAK  133

Query  458  aQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            AQ+TL  LTD K+K+ LLN+F T+V DAETI+NLTEEMDSID  LLEEA  +IK+
Sbjct  134  AQETLLALTDVKDKINLLNEFKTKVEDAETIVNLTEEMDSIDAALLEEAVNVIKD  188



>ref|XP_010101235.1| Peptide chain release factor 2 [Morus notabilis]
 gb|EXB88159.1| Peptide chain release factor 2 [Morus notabilis]
Length=464

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            AT E    +      REWAMQDFY LRKDVE VS+RVEEIRA+AGLQQLEE++A LE+ A
Sbjct  64   ATQERQVGTEVNNDVREWAMQDFYSLRKDVETVSERVEEIRASAGLQQLEEELAVLESKA  123

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            AD++ WDDRA+AQ+TL  LTD K+K+KLL++F  +V DAETII LTEEMDSIDT LLEEA
Sbjct  124  ADSSFWDDRAKAQETLLALTDVKDKIKLLSEFKAKVEDAETIIMLTEEMDSIDTALLEEA  183

Query  605  AGIIKE  622
              IIKE
Sbjct  184  NTIIKE  189



>ref|XP_006480480.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Citrus sinensis]
Length=460

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = +2

Query  233  PTARATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaal  412
            P  +A  E    +     TREW MQDFY LRKDVE  S RVEEIRA+AGLQQLE+++A L
Sbjct  59   PVRQAAQESQLSAEVNADTREWVMQDFYNLRKDVEAASDRVEEIRASAGLQQLEKELAEL  118

Query  413  eaaaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGL  592
            E  AAD++ WD+RA+AQ+TLQ LTD K+K+ LL DF T++ DA TI+ LTEEMDS D GL
Sbjct  119  EMKAADSSFWDNRAKAQETLQALTDVKDKINLLTDFKTKMDDAVTIVKLTEEMDSTDAGL  178

Query  593  LEEAAGIIKE  622
            LEEAA IIKE
Sbjct  179  LEEAASIIKE  188



>ref|XP_010258507.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
[Nelumbo nucifera]
Length=449

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            AT E  + +       EWAMQDFY LRK+VEV+ +RVEEIRA+AGL  LEED  ALE  A
Sbjct  53   ATSESQSSAGISNEIVEWAMQDFYTLRKEVEVIMERVEEIRASAGLHHLEEDFLALEQKA  112

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            AD++LWDDRA+AQ+TL  LTD K+K+KLLN+F TQV DAETII LTEEM+SIDTGLLEEA
Sbjct  113  ADSSLWDDRAKAQETLLALTDVKDKIKLLNEFKTQVEDAETIIKLTEEMESIDTGLLEEA  172

Query  605  AGIIKE  622
            A IIK+
Sbjct  173  ANIIKD  178



>ref|XP_004172841.1| PREDICTED: peptide chain release factor 2-like, partial [Cucumis 
sativus]
Length=204

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            AT E     + +T TREWAMQDFY LRK+VE  S+RVEEIR +AGL QL++++A LE+ A
Sbjct  58   ATHESPVGEAIDTDTREWAMQDFYTLRKEVETTSERVEEIRNSAGLLQLDQELADLESKA  117

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            AD + WDDR++AQ+ L  +TD K+K+K+L DF TQV +AETI+ LTEEMDS+D GLLEEA
Sbjct  118  ADNSFWDDRSKAQKVLMAMTDVKDKIKMLTDFKTQVEEAETIVKLTEEMDSVDVGLLEEA  177

Query  605  AGIIKE  622
              IIK+
Sbjct  178  TKIIKD  183



>gb|KJB26869.1| hypothetical protein B456_004G264100 [Gossypium raimondii]
Length=463

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +2

Query  278  ETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddrar  457
            ET TREW MQDFY LRKDVE  S+RV EIR +AG+QQLE+++  LE+  AD++ WDDRA+
Sbjct  74   ETSTREWVMQDFYALRKDVETASERVNEIRTSAGMQQLEKELVVLESKTADSSFWDDRAK  133

Query  458  aQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            AQ+TL  LTD K+K+ LLN+F T+V DAETI+NLTEEMDSID  LLEEA  +I +
Sbjct  134  AQETLLALTDVKDKINLLNEFKTKVEDAETIVNLTEEMDSIDAALLEEAVNVIND  188



>ref|XP_007029207.1| High chlorophyll fluorescent 109 isoform 2 [Theobroma cacao]
 gb|EOY09709.1| High chlorophyll fluorescent 109 isoform 2 [Theobroma cacao]
Length=465

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            ATPE       +T TREW MQDFY LRKDVE  S+RVEEI A+ GLQ LE+++A LE+ A
Sbjct  66   ATPESQLTEGVDTNTREWVMQDFYALRKDVETASERVEEIIASTGLQLLEKELADLESKA  125

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            AD++ WDDRA+AQ+TL  LTD K+K+ LLN+F T+V DAETI+ LTEEMD+ID  LLEEA
Sbjct  126  ADSSFWDDRAKAQETLLALTDVKDKINLLNEFKTKVEDAETIVKLTEEMDAIDAALLEEA  185

Query  605  AGIIKE  622
              +IKE
Sbjct  186  VSVIKE  191



>ref|XP_010673888.1| PREDICTED: peptide chain release factor PrfB1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=454

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 102/128 (80%), Gaps = 4/128 (3%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTR--EWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaalea  418
            ATP  D+  S E GT   EW MQDFYILRK+VE  S+RVEEI  +AGL+ LE+++AALE+
Sbjct  59   ATP--DSQLSVEVGTESSEWGMQDFYILRKEVENTSKRVEEIVLSAGLEHLEKELAALES  116

Query  419  aaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLE  598
             +AD+ LWDDRA+AQ+TL  LTD K+KLKLL DF +QV DAETI+NLTEEMDS DT LL+
Sbjct  117  KSADSTLWDDRAKAQETLSALTDVKDKLKLLKDFQSQVEDAETIVNLTEEMDSTDTALLQ  176

Query  599  EAAGIIKE  622
            EAA IIKE
Sbjct  177  EAANIIKE  184



>ref|XP_010038617.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
[Eucalyptus grandis]
 gb|KCW84636.1| hypothetical protein EUGRSUZ_B01462 [Eucalyptus grandis]
Length=451

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +2

Query  272  SSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddr  451
            S E  + EWAMQDFY LR++VE  S RV +IRA+AGLQQLE+++A LE  A+D + WDDR
Sbjct  62   SVEADSSEWAMQDFYSLRREVEAASARVVDIRASAGLQQLEKELADLELKASDASFWDDR  121

Query  452  araQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            A+AQQTL  LTD K+K++LL+DF TQV +AET++ LTEEMDS DTGLLEEAAGIIKE
Sbjct  122  AKAQQTLLALTDVKDKIRLLSDFKTQVEEAETVVMLTEEMDSKDTGLLEEAAGIIKE  178



>gb|KFK30645.1| hypothetical protein AALP_AA6G008900 [Arabis alpina]
Length=453

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = +2

Query  233  PTARATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaal  412
            P   A  E +   S E+ T EW MQDFY LRKDVE+ + RVEEIRA+AGLQQ+E DIA L
Sbjct  52   PILFAAQESNLSVSDESDTSEWVMQDFYTLRKDVEIATARVEEIRASAGLQQIELDIANL  111

Query  413  eaaaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGL  592
            E+ A+DT+ WDDRA+AQ+TL  L D K++ +LL+DF + V DAETI+ LTEEMDS D  L
Sbjct  112  ESKASDTSFWDDRAQAQETLSSLNDLKDRFRLLSDFKSMVEDAETIVKLTEEMDSTDVSL  171

Query  593  LEEAAGIIKE  622
            LEEA GIIKE
Sbjct  172  LEEAMGIIKE  181



>ref|XP_010450443.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
[Camelina sativa]
Length=459

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +2

Query  233  PTARATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaal  412
            P   A  E +   S+E+ T EW MQDFY LRKDVE+ S RVEEIR +AGLQQLE++IA L
Sbjct  58   PIVFAAQESNLSVSNESETSEWVMQDFYTLRKDVEIASARVEEIRDSAGLQQLEQEIANL  117

Query  413  eaaaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGL  592
            E+ A DT+ WDDRA+AQ+TL  L D K++++LL+DF + V DAETI+ LTEEMDS D  L
Sbjct  118  ESKATDTSFWDDRAKAQETLSALNDLKDRMRLLSDFKSMVEDAETIVKLTEEMDSTDVSL  177

Query  593  LEEAAGIIKE  622
            LEEA GIIKE
Sbjct  178  LEEAMGIIKE  187



>ref|XP_010528652.1| PREDICTED: peptide chain release factor 1, mitochondrial [Tarenaya 
hassleriana]
Length=463

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = +2

Query  287  TREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQ  466
            TREW MQDFY LRKDVE  S RVEEIRA+ GLQ+LE+++  LE+ A+D++ WDDRA+AQ+
Sbjct  78   TREWVMQDFYTLRKDVETASARVEEIRASVGLQKLEQELEDLESKASDSSFWDDRAKAQE  137

Query  467  TLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            TL  LTD K+K++LL++F ++V DAETI+ LTEEM+SID GLLEEA GIIKE
Sbjct  138  TLLALTDIKDKIRLLSEFKSKVEDAETIVKLTEEMESIDPGLLEEAMGIIKE  189



>emb|CDY68504.1| BnaAnng27520D [Brassica napus]
Length=452

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = +2

Query  233  PTARATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaal  412
            P + AT E   +S S+T   EW MQDFY LRKDVE+ S RVEEIRA+AGL+QL+ +IA L
Sbjct  53   PISFATQESSNLSESDTS--EWVMQDFYTLRKDVEIASARVEEIRASAGLEQLQHEIALL  110

Query  413  eaaaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGL  592
            E+ A DT+ WDDRA+AQ+TL  L D K++L+LL++F + V DAETI+ LTEEMDS D  L
Sbjct  111  ESKATDTSFWDDRAKAQETLSALNDLKDRLRLLSEFKSMVEDAETIVKLTEEMDSTDVSL  170

Query  593  LEEAAGIIKE  622
            LEEA GIIKE
Sbjct  171  LEEAMGIIKE  180



>ref|XP_009144652.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
isoform X1 [Brassica rapa]
Length=452

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = +2

Query  233  PTARATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaal  412
            P + AT E   +S S+T   EW MQDFY LRKDVE+ S RVEEIRA+AGL+QL+ +IA L
Sbjct  53   PISFATQESSNLSESDTS--EWVMQDFYTLRKDVEIASARVEEIRASAGLEQLQHEIALL  110

Query  413  eaaaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGL  592
            E+ A DT+ WDDRA+AQ+TL  L D K++L+LL++F + V DAETI+ LTEEMDS D  L
Sbjct  111  ESKATDTSFWDDRAKAQETLSALNDLKDRLRLLSEFKSMVEDAETIVKLTEEMDSTDVSL  170

Query  593  LEEAAGIIKE  622
            LEEA GIIKE
Sbjct  171  LEEAMGIIKE  180



>ref|XP_009144654.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
isoform X2 [Brassica rapa]
Length=370

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 99/130 (76%), Gaps = 2/130 (2%)
 Frame = +2

Query  233  PTARATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaal  412
            P + AT E   +S S+T   EW MQDFY LRKDVE+ S RVEEIRA+AGL+QL+ +IA L
Sbjct  53   PISFATQESSNLSESDTS--EWVMQDFYTLRKDVEIASARVEEIRASAGLEQLQHEIALL  110

Query  413  eaaaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGL  592
            E+ A DT+ WDDRA+AQ+TL  L D K++L+LL++F + V DAETI+ LTEEMDS D  L
Sbjct  111  ESKATDTSFWDDRAKAQETLSALNDLKDRLRLLSEFKSMVEDAETIVKLTEEMDSTDVSL  170

Query  593  LEEAAGIIKE  622
            LEEA GIIKE
Sbjct  171  LEEAMGIIKE  180



>ref|XP_009361583.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009340366.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009340373.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Pyrus x bretschneideri]
Length=455

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            A PE  A S   T  REWAMQDFY LRKDVE  + RV+EIR +A L +LE+++A LE  A
Sbjct  63   AKPESQASSGVNTDAREWAMQDFYFLRKDVETAAIRVKEIRNSACLHKLEQEVADLELKA  122

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
             DTA WDDRA+AQ+ L  LTD K+++KLLN+F +QV D ETI+ LTEEMDSID GLLEEA
Sbjct  123  GDTAFWDDRAQAQENLSVLTDVKDRIKLLNEFKSQVEDVETIVKLTEEMDSIDHGLLEEA  182

Query  605  AGIIKE  622
            A IIKE
Sbjct  183  ASIIKE  188



>ref|XP_010435494.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
isoform X4 [Camelina sativa]
Length=458

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            A  E +   S+E+ T EW MQDFY LRKDVE+ S RVEEIR +AGLQQLE++IA LE+ A
Sbjct  61   AAQESNLSVSNESETSEWVMQDFYTLRKDVEIASARVEEIRDSAGLQQLEQEIANLESKA  120

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
             DT+ WDDR++AQ+TL  L D K++++LL+DF + V DAETI+ LTEEMDS D  LLEEA
Sbjct  121  TDTSFWDDRSKAQETLSALNDLKDRMRLLSDFKSMVEDAETIVKLTEEMDSTDVSLLEEA  180

Query  605  AGIIKE  622
             GIIKE
Sbjct  181  MGIIKE  186



>ref|XP_010435490.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
isoform X1 [Camelina sativa]
 ref|XP_010435493.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
isoform X3 [Camelina sativa]
Length=459

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            A  E +   S+E+ T EW MQDFY LRKDVE+ S RVEEIR +AGLQQLE++IA LE+ A
Sbjct  62   AAQESNLSVSNESETSEWVMQDFYTLRKDVEIASARVEEIRDSAGLQQLEQEIANLESKA  121

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
             DT+ WDDR++AQ+TL  L D K++++LL+DF + V DAETI+ LTEEMDS D  LLEEA
Sbjct  122  TDTSFWDDRSKAQETLSALNDLKDRMRLLSDFKSMVEDAETIVKLTEEMDSTDVSLLEEA  181

Query  605  AGIIKE  622
             GIIKE
Sbjct  182  MGIIKE  187



>gb|KGN66643.1| hypothetical protein Csa_1G652260 [Cucumis sativus]
Length=453

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            AT E     + +T TREWAMQDFY LRK+VE  S+RVEEIR +AGL QL++++A LE+ A
Sbjct  58   ATHESPVGEAIDTDTREWAMQDFYTLRKEVETTSERVEEIRNSAGLLQLDQELADLESKA  117

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            AD + WDDR++AQ+ L  +TD K+K+K+L DF TQV +AETI+ LTEEMDS+D GLLEEA
Sbjct  118  ADNSFWDDRSKAQKVLMAMTDVKDKIKMLTDFKTQVEEAETIVKLTEEMDSVDVGLLEEA  177

Query  605  AGIIKE  622
              IIK+
Sbjct  178  TKIIKD  183



>ref|XP_003534498.1| PREDICTED: peptide chain release factor 2-like [Glycine max]
 gb|KHN29252.1| Peptide chain release factor 2 [Glycine soja]
Length=456

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 98/132 (74%), Gaps = 2/132 (2%)
 Frame = +2

Query  233  PTARATPE--VDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleedia  406
            P   ATPE  +       T   +WA+QDFY LRKDVE++SQRV EIR ++GLQ LE+++ 
Sbjct  53   PLLFATPENQLSIGEGENTDASDWALQDFYSLRKDVEIMSQRVGEIRESSGLQLLEQELG  112

Query  407  aleaaaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDT  586
             LE  AAD++ WD+R +AQ+TL  L D K+K+KLLNDF TQV DAETI++LTEEMDSID 
Sbjct  113  NLEEQAADSSFWDNRGKAQETLSTLADVKDKIKLLNDFKTQVEDAETIVSLTEEMDSIDR  172

Query  587  GLLEEAAGIIKE  622
            GL EEA+ +IKE
Sbjct  173  GLFEEASNLIKE  184



>ref|XP_010435495.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
isoform X5 [Camelina sativa]
Length=394

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            A  E +   S+E+ T EW MQDFY LRKDVE+ S RVEEIR +AGLQQLE++IA LE+ A
Sbjct  62   AAQESNLSVSNESETSEWVMQDFYTLRKDVEIASARVEEIRDSAGLQQLEQEIANLESKA  121

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
             DT+ WDDR++AQ+TL  L D K++++LL+DF + V DAETI+ LTEEMDS D  LLEEA
Sbjct  122  TDTSFWDDRSKAQETLSALNDLKDRMRLLSDFKSMVEDAETIVKLTEEMDSTDVSLLEEA  181

Query  605  AGIIKE  622
             GIIKE
Sbjct  182  MGIIKE  187



>ref|XP_002870470.1| HCF109 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46729.1| HCF109 [Arabidopsis lyrata subsp. lyrata]
Length=453

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            A  E +   S+E  T EW MQDFY LRKDVE+ S RVEEIRA+AGL+QLE++IA LE+ A
Sbjct  56   AAQESNLSVSNENETSEWLMQDFYTLRKDVEIASARVEEIRASAGLEQLEQEIANLESKA  115

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
             DT+ WDDR +AQ+TL  L D K++++LL++F T V DAETI+ LTEEMDS D  LLEEA
Sbjct  116  TDTSFWDDRTKAQETLSALNDLKDRMRLLSEFKTMVEDAETIVKLTEEMDSTDVSLLEEA  175

Query  605  AGIIKE  622
             GIIKE
Sbjct  176  MGIIKE  181



>ref|NP_851096.1| protein high chlorophyll fluorescent 109 [Arabidopsis thaliana]
 sp|Q9LVY0.1|PRFB1_ARATH RecName: Full=Peptide chain release factor PrfB1, chloroplastic; 
Short=AtPrfB1; AltName: Full=AtPrfB; AltName: Full=Protein 
HIGH CHLOROPHYLL FLUORESCENCE 109; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAA96892.1| translation releasing factor RF-2 [Arabidopsis thaliana]
 gb|AAL07083.1| putative translation releasing factor RF-2 [Arabidopsis thaliana]
 gb|AAM51328.1| putative translation releasing factor RF-2 [Arabidopsis thaliana]
 gb|AAM61285.1| translation releasing factor RF-2 [Arabidopsis thaliana]
 gb|AED94051.1| protein high chlorophyll fluorescent 109 [Arabidopsis thaliana]
Length=456

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 95/130 (73%), Gaps = 0/130 (0%)
 Frame = +2

Query  233  PTARATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaal  412
            P   A  E +   S+E  T EW MQDFY LRKDVE+ S RVEEIRA+A LQQLE++I  L
Sbjct  55   PIVFAAQESNLSVSNENETSEWLMQDFYTLRKDVEIASARVEEIRASANLQQLEQEITNL  114

Query  413  eaaaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGL  592
            E+ A DT+ WDDR +AQ+TL  L D K++++LL++F T V DAETI+ LTEEMDS D  L
Sbjct  115  ESKATDTSFWDDRTKAQETLSSLNDLKDRMRLLSEFKTMVEDAETIVKLTEEMDSTDVSL  174

Query  593  LEEAAGIIKE  622
            LEEA GIIKE
Sbjct  175  LEEAMGIIKE  184



>gb|KDO53118.1| hypothetical protein CISIN_1g0170091mg, partial [Citrus sinensis]
Length=144

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  302  MQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTLQGL  481
            MQDFY LRKDVE  S RVEEIRA+AGLQQLE+++A LE  AAD++ WD+RA AQ+TLQ L
Sbjct  1    MQDFYNLRKDVEAASDRVEEIRASAGLQQLEKELAELEMKAADSSFWDNRAEAQETLQAL  60

Query  482  TDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            TD K+K+ LL DF T++ DA TI+ LTEEMDS D GLLEEAA IIKE
Sbjct  61   TDVKDKINLLTDFKTKMDDAVTIVKLTEEMDSTDAGLLEEAASIIKE  107



>ref|XP_011006686.1| PREDICTED: peptide chain release factor PrfB1, chloroplastic 
isoform X1 [Populus euphratica]
Length=464

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  290  REWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQT  469
            REWAMQDFY LRKDVE  SQRVEE+RA++GL  LE+++A LE+ AAD++LWDDRA+AQ+T
Sbjct  82   REWAMQDFYSLRKDVETASQRVEEMRASSGLHLLEQELADLESKAADSSLWDDRAKAQET  141

Query  470  LQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            L  LTD K+K+KLL +F T+V +AETI+ LTEEMDS D G LEEA GIIKE
Sbjct  142  LLALTDVKDKIKLLTEFKTKVEEAETIVKLTEEMDSTDAGFLEEATGIIKE  192



>ref|NP_198466.2| protein high chlorophyll fluorescent 109 [Arabidopsis thaliana]
 gb|AED94052.1| protein high chlorophyll fluorescent 109 [Arabidopsis thaliana]
Length=391

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 95/130 (73%), Gaps = 0/130 (0%)
 Frame = +2

Query  233  PTARATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaal  412
            P   A  E +   S+E  T EW MQDFY LRKDVE+ S RVEEIRA+A LQQLE++I  L
Sbjct  55   PIVFAAQESNLSVSNENETSEWLMQDFYTLRKDVEIASARVEEIRASANLQQLEQEITNL  114

Query  413  eaaaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGL  592
            E+ A DT+ WDDR +AQ+TL  L D K++++LL++F T V DAETI+ LTEEMDS D  L
Sbjct  115  ESKATDTSFWDDRTKAQETLSSLNDLKDRMRLLSEFKTMVEDAETIVKLTEEMDSTDVSL  174

Query  593  LEEAAGIIKE  622
            LEEA GIIKE
Sbjct  175  LEEAMGIIKE  184



>ref|XP_010908923.1| PREDICTED: peptide chain release factor PrfB1, chloroplastic 
[Elaeis guineensis]
Length=460

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +2

Query  287  TREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQ  466
            T EWAMQDFY LRKDVE  ++RV+EIRA+AGL++LEED+A LE  AAD++LWD+ ++AQ+
Sbjct  77   TAEWAMQDFYALRKDVEATAERVDEIRASAGLERLEEDLAVLEKKAADSSLWDNPSKAQE  136

Query  467  TLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
             L  LTD KEK+KLL DF TQV +AETI+NLTEE++SIDT LLEEA+ II+E
Sbjct  137  ILLALTDVKEKIKLLTDFKTQVEEAETIVNLTEELESIDTSLLEEASKIIRE  188



>ref|XP_004304824.1| PREDICTED: peptide chain release factor PrfB1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=456

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 100/126 (79%), Gaps = 4/126 (3%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            ATPE   VS+ E   REWAMQDFY LR++VE+ ++RV+EIRA+A L+QLE+++A LE+ A
Sbjct  63   ATPE-SQVSAEE---REWAMQDFYTLRREVEIAAERVQEIRASACLEQLEKEVAELESKA  118

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            ADT+ WDDRA AQ+ L  LTD K+++K LNDF +QV DAETI+ LTEEMDS D  LLEEA
Sbjct  119  ADTSFWDDRALAQENLLALTDVKDRIKSLNDFKSQVEDAETIVKLTEEMDSTDNALLEEA  178

Query  605  AGIIKE  622
            A IIKE
Sbjct  179  ASIIKE  184



>ref|XP_002312196.2| hypothetical protein POPTR_0008s07570g [Populus trichocarpa]
 gb|EEE89563.2| hypothetical protein POPTR_0008s07570g [Populus trichocarpa]
Length=466

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  290  REWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQT  469
            REWAMQDFY LRKDVE  SQRVEE+RA++GL  LE+++A LE+ AAD++LWDDRA+AQ+T
Sbjct  84   REWAMQDFYSLRKDVETASQRVEEMRASSGLHLLEQELADLESKAADSSLWDDRAKAQET  143

Query  470  LQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            L  LTD K+K+KLL +F T+V +AETI+ LTEEMDS D G LEEA GIIKE
Sbjct  144  LLALTDVKDKIKLLAEFKTKVEEAETIVKLTEEMDSTDAGFLEEATGIIKE  194



>ref|XP_009393515.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=467

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +2

Query  287  TREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQ  466
            T EWAMQDFY LRKDVE  +QRVEEIR +AGL++LE D+A+LE  AAD++LWDDR +AQ+
Sbjct  84   TAEWAMQDFYALRKDVETTAQRVEEIRISAGLERLEADLASLEKKAADSSLWDDRLKAQE  143

Query  467  TLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
             L  LTD K+K+K LNDF +QV +AETI+NLTEE+++IDTGLL+EA+ II+E
Sbjct  144  ILLSLTDVKDKIKFLNDFKSQVEEAETIVNLTEELETIDTGLLQEASKIIRE  195



>ref|NP_851097.1| protein high chlorophyll fluorescent 109 [Arabidopsis thaliana]
 emb|CAC36322.1| translation releasing factor2 [Arabidopsis thaliana]
 gb|AED94053.1| protein high chlorophyll fluorescent 109 [Arabidopsis thaliana]
Length=455

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            A  E +   S+E  T EW MQDFY LRKDVE+ S RVEEIRA+A LQQLE++I  LE+ A
Sbjct  58   AAQESNLSVSNENETSEWLMQDFYTLRKDVEIASARVEEIRASANLQQLEQEITNLESKA  117

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
             DT+ WDDR +AQ+TL  L D K++++LL++F T V DAETI+ LTEEMDS D  LLEEA
Sbjct  118  TDTSFWDDRTKAQETLSSLNDLKDRMRLLSEFKTMVEDAETIVKLTEEMDSTDVSLLEEA  177

Query  605  AGIIKE  622
             GIIKE
Sbjct  178  MGIIKE  183



>ref|XP_008788225.1| PREDICTED: peptide chain release factor 1-like, mitochondrial 
[Phoenix dactylifera]
Length=470

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = +2

Query  287  TREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQ  466
            T EWAMQDFY LRKDVE  ++RV+EIRA+AGL++LEE++A LE  AAD++LWD+ ++AQ+
Sbjct  87   TAEWAMQDFYALRKDVEATAERVDEIRASAGLERLEEELAVLEKKAADSSLWDNPSKAQE  146

Query  467  TLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
             L  LTD KEK+KLL DF TQV +AETI+NLTEE++SIDT LLEEA+ II++
Sbjct  147  ILLSLTDVKEKIKLLTDFKTQVEEAETIVNLTEELESIDTSLLEEASNIIRD  198



>ref|XP_006395914.1| hypothetical protein EUTSA_v10004205mg [Eutrema salsugineum]
 gb|ESQ33200.1| hypothetical protein EUTSA_v10004205mg [Eutrema salsugineum]
Length=450

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = +2

Query  233  PTARATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaal  412
            P   A  E +   S+E+ T EW MQDFY LRKDVEV S RVEEIRA++GLQQ+E +I+ L
Sbjct  49   PLLFAAQESNLSVSNESDTIEWQMQDFYTLRKDVEVASARVEEIRASSGLQQIENEISIL  108

Query  413  eaaaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGL  592
            E+ A DT+ WDDRA+AQ+TL  L D K++ +LL++F + V DAETI+ LTEEMDS D  L
Sbjct  109  ESKATDTSFWDDRAKAQETLSALNDLKDRSRLLSEFKSMVEDAETIVKLTEEMDSTDVSL  168

Query  593  LEEAAGIIKE  622
            LEEA GIIKE
Sbjct  169  LEEAMGIIKE  178



>emb|CAG25777.1| putative translation releasing factor 2 [Cucumis sativus]
Length=453

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            AT E     + +T TREWA QDFY LRK+VE  S+RVEEIR +AGL QL++++A LE+ A
Sbjct  58   ATHESPVGEAIDTDTREWATQDFYTLRKEVETTSERVEEIRNSAGLLQLDQELADLESKA  117

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            AD + WDDR++AQ+ L  +TD K+K+K+L DF TQV +AETI+ LTEEMDS+D GLLEEA
Sbjct  118  ADNSFWDDRSKAQKVLMAMTDVKDKIKMLTDFKTQVEEAETIVKLTEEMDSVDVGLLEEA  177

Query  605  AGIIKE  622
              IIK+
Sbjct  178  TKIIKD  183



>gb|KDO53117.1| hypothetical protein CISIN_1g0170091mg, partial [Citrus sinensis]
Length=216

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  302  MQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTLQGL  481
            MQDFY LRKDVE  S RVEEIRA+AGLQQLE+++A LE  AAD++ WD+RA AQ+TLQ L
Sbjct  1    MQDFYNLRKDVEAASDRVEEIRASAGLQQLEKELAELEMKAADSSFWDNRAEAQETLQAL  60

Query  482  TDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            TD K+K+ LL DF T++ DA TI+ LTEEMDS D GLLEEAA IIKE
Sbjct  61   TDVKDKINLLTDFKTKMDDAVTIVKLTEEMDSTDAGLLEEAASIIKE  107



>ref|XP_007139703.1| hypothetical protein PHAVU_008G052200g [Phaseolus vulgaris]
 gb|ESW11697.1| hypothetical protein PHAVU_008G052200g [Phaseolus vulgaris]
Length=456

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +2

Query  281  TGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddrara  460
            T   +WA+QDFY LR+DVE++ QRVEEIR ++GLQ LE+++A LE  AAD++ W++RA A
Sbjct  71   TDASDWALQDFYSLRRDVEIMLQRVEEIRESSGLQLLEQELANLEEQAADSSFWENRANA  130

Query  461  QQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            Q+TL  L D KEK+KLLNDF TQV DAETI+ LTEEM+SID GL +EAA +IKE
Sbjct  131  QKTLSTLADIKEKIKLLNDFKTQVEDAETIVKLTEEMESIDRGLFDEAANLIKE  184



>ref|XP_008388820.1| PREDICTED: peptide chain release factor 1, mitochondrial [Malus 
domestica]
Length=456

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 96/126 (76%), Gaps = 4/126 (3%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            ATPE    S   T  +EWAMQDFY LRKDVE  + RV+EIR +A L +LE+++A LE  A
Sbjct  63   ATPE----SQVSTDAKEWAMQDFYFLRKDVETAAIRVKEIRDSACLHKLEQEVADLELKA  118

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            ADTA WDDRA+AQ+ L  LTD K+++KLLN+F +QV D ETI+ LTEEMD+ID GLLEEA
Sbjct  119  ADTAFWDDRAKAQENLSALTDVKDRIKLLNEFKSQVEDVETIVKLTEEMDAIDHGLLEEA  178

Query  605  AGIIKE  622
            A IIKE
Sbjct  179  ASIIKE  184



>ref|XP_008443659.1| PREDICTED: peptide chain release factor 1, mitochondrial isoform 
X1 [Cucumis melo]
Length=453

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  287  TREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQ  466
            TREWAMQDFY LRK+VE  S+RVEEIR +AGL QL++++A LE+ A D + WDDR++AQ+
Sbjct  72   TREWAMQDFYTLRKEVETTSERVEEIRNSAGLLQLDQELADLESKATDNSFWDDRSKAQK  131

Query  467  TLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
             L  +TD K+K+K+L DF TQV +AETI+ LTEEMDS+D GLLEEA  II++
Sbjct  132  VLVAMTDVKDKIKMLTDFKTQVEEAETIVKLTEEMDSVDVGLLEEATRIIQD  183



>emb|CDY06442.1| BnaC06g12020D [Brassica napus]
Length=450

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +2

Query  275  SETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddra  454
            SE+ T EW MQDFY LRKDVE+ S RVEEIRA+AGLQQL+ +IA LE+ A DT+ WDDRA
Sbjct  63   SESDTSEWVMQDFYTLRKDVEIASARVEEIRASAGLQQLQHEIALLESKATDTSFWDDRA  122

Query  455  raQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            +AQ+TL  L D K++L+LL++F + V DAETI+ LTEEM+S D  LLEEA  IIK+
Sbjct  123  KAQETLSALNDLKDRLRLLSEFKSMVEDAETIVKLTEEMESTDVSLLEEAMAIIKD  178



>gb|KDP26898.1| hypothetical protein JCGZ_18056 [Jatropha curcas]
Length=460

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 99/128 (77%), Gaps = 4/128 (3%)
 Frame = +2

Query  245  ATPE--VDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaalea  418
            A PE  +D    +ETG  EWAMQDFY LR+DVE  S+RVEEI A+AG+Q L++++A LEA
Sbjct  63   AAPENQLDVGVDTETG--EWAMQDFYSLRRDVEAASERVEEIIASAGMQLLQQELAGLEA  120

Query  419  aaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLE  598
             AAD++LWDDRARAQ+ L  LTD K+K+KLL +F T V DAETI+ LTEEMDS D GLLE
Sbjct  121  KAADSSLWDDRARAQEILSALTDVKDKIKLLTEFKTMVEDAETIVKLTEEMDSTDAGLLE  180

Query  599  EAAGIIKE  622
            EA  I+KE
Sbjct  181  EATAIVKE  188



>ref|XP_003624209.1| Peptide chain release factor [Medicago truncatula]
 gb|AES80427.1| peptide chain release factor 2 [Medicago truncatula]
Length=475

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 98/130 (75%), Gaps = 4/130 (3%)
 Frame = +2

Query  245  ATPEVDAVSSSE----TGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaal  412
            ATPE    S  E    T T + A+QDFY LRKDVE+ SQRV+EIR ++GLQ LE+++A L
Sbjct  74   ATPENQLSSVGEGEEDTHTSDSALQDFYSLRKDVEIASQRVKEIRESSGLQLLEQELAKL  133

Query  413  eaaaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGL  592
            E  A+ ++ WDDRA+AQQTL  L D KEK+KLLND+ TQV DAETI+ LTEEM+S+D GL
Sbjct  134  EEEASCSSFWDDRAKAQQTLSTLADVKEKIKLLNDYKTQVEDAETIVMLTEEMESVDKGL  193

Query  593  LEEAAGIIKE  622
             EEA+ +IKE
Sbjct  194  YEEASSLIKE  203



>ref|XP_006283633.1| hypothetical protein CARUB_v10004691mg [Capsella rubella]
 gb|EOA16531.1| hypothetical protein CARUB_v10004691mg [Capsella rubella]
Length=485

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            A  E +   S+E+ T EW MQDFY LRKDVE+ S RVEEIR +AGL QLE++IA LE+ A
Sbjct  88   AAQESNLSVSNESETSEWVMQDFYTLRKDVEIASARVEEIRDSAGLTQLEQEIANLESKA  147

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
             DT+ WDDR +AQ+TL  L D K++++LL++F + V DAETI+ LTEEMDS D  LLEEA
Sbjct  148  TDTSFWDDRVKAQETLSSLNDLKDRMRLLSEFKSMVEDAETIVKLTEEMDSTDVSLLEEA  207

Query  605  AGIIKE  622
             GIIKE
Sbjct  208  MGIIKE  213



>tpg|DAA63046.1| TPA: hypothetical protein ZEAMMB73_861498, partial [Zea mays]
Length=421

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  293  EWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTL  472
            EWA+QDFYILRKDVE+  +RV E+R +AGLQQLEEDIA+LE  ++D++LWDD ++AQ  L
Sbjct  129  EWALQDFYILRKDVELALERVNEVRQSAGLQQLEEDIASLENKSSDSSLWDDPSKAQGIL  188

Query  473  QGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIK  619
              LT+ K+K+KLLNDF  Q+ +AETI+ LTEE+DSIDTGLLEEA+ IIK
Sbjct  189  VSLTEVKDKVKLLNDFKLQIEEAETIVKLTEELDSIDTGLLEEASKIIK  237



>ref|XP_004492862.1| PREDICTED: peptide chain release factor 2-like [Cicer arietinum]
Length=461

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 99/132 (75%), Gaps = 2/132 (2%)
 Frame = +2

Query  233  PTARATPE--VDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleedia  406
            P   ATPE  +      +T T + A+QDFY+LR+DVE+ SQRV+EIR ++GLQ LE+++ 
Sbjct  58   PVLFATPENQLSVGEGEDTYTSDSALQDFYLLRRDVEITSQRVKEIRESSGLQLLEQELV  117

Query  407  aleaaaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDT  586
             LE  A+ ++ WD++A+AQQTL  L D K+K+KLLN++ TQV DAETI+ LTEEM+S+D 
Sbjct  118  NLEEEASSSSFWDNQAKAQQTLSTLADVKDKIKLLNEYKTQVEDAETIVMLTEEMESVDK  177

Query  587  GLLEEAAGIIKE  622
            GL EEA+ +IKE
Sbjct  178  GLYEEASNLIKE  189



>ref|XP_003560113.2| PREDICTED: peptide chain release factor 1-like, mitochondrial 
[Brachypodium distachyon]
Length=447

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 101/138 (73%), Gaps = 9/138 (7%)
 Frame = +2

Query  233  PTARATPEVDAVSSS---------ETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQ  385
            P A A+  V +VSS          E+ T EWAMQDFY LRKDVE+   RV E+R +AGL+
Sbjct  37   PRASASTAVQSVSSGAGSQSSVADESETVEWAMQDFYALRKDVELSVDRVNEVRRSAGLE  96

Query  386  QleediaaleaaaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTE  565
             LEE+IA+LE  + D+ LWDD ++AQ+ L  LT+ KEK+K+LNDF +QV +A+TI+ LTE
Sbjct  97   LLEEEIASLEKKSGDSTLWDDPSKAQELLVALTEVKEKVKILNDFKSQVEEADTIVKLTE  156

Query  566  EMDSIDTGLLEEAAGIIK  619
            E+DSIDTGLLEEA+ IIK
Sbjct  157  ELDSIDTGLLEEASKIIK  174



>tpg|DAA63044.1| TPA: hypothetical protein ZEAMMB73_861498 [Zea mays]
Length=364

 Score =   112 bits (280),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  293  EWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTL  472
            EWA+QDFYILRKDVE+  +RV E+R +AGLQQLEEDIA+LE  ++D++LWDD ++AQ  L
Sbjct  72   EWALQDFYILRKDVELALERVNEVRQSAGLQQLEEDIASLENKSSDSSLWDDPSKAQGIL  131

Query  473  QGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIK  619
              LT+ K+K+KLLNDF  Q+ +AETI+ LTEE+DSIDTGLLEEA+ IIK
Sbjct  132  VSLTEVKDKVKLLNDFKLQIEEAETIVKLTEELDSIDTGLLEEASKIIK  180



>ref|NP_001152654.1| peptide chain release factor 2 [Zea mays]
 gb|ACG48772.1| peptide chain release factor 2 [Zea mays]
 gb|ACN29186.1| unknown [Zea mays]
 tpg|DAA63045.1| TPA: peptide chain release factor 2 [Zea mays]
Length=449

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  293  EWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTL  472
            EWA+QDFYILRKDVE+  +RV E+R +AGLQQLEEDIA+LE  ++D++LWDD ++AQ  L
Sbjct  72   EWALQDFYILRKDVELALERVNEVRQSAGLQQLEEDIASLENKSSDSSLWDDPSKAQGIL  131

Query  473  QGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIK  619
              LT+ K+K+KLLNDF  Q+ +AETI+ LTEE+DSIDTGLLEEA+ IIK
Sbjct  132  VSLTEVKDKVKLLNDFKLQIEEAETIVKLTEELDSIDTGLLEEASKIIK  180



>ref|XP_004957951.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Setaria italica]
Length=448

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +2

Query  293  EWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTL  472
            EWAMQDFY LRK+VE+  +RV E+R +AGL+QL+E+IA+LE  +AD++LWDD ++AQ+ L
Sbjct  71   EWAMQDFYALRKEVELAIERVSEVRQSAGLEQLKEEIASLEKKSADSSLWDDPSKAQEIL  130

Query  473  QGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIK  619
              LT+ K+++KLLNDF +QV +AETI+ LTEE+DSIDTGLLEEA+ IIK
Sbjct  131  VSLTELKDRVKLLNDFKSQVEEAETIVKLTEELDSIDTGLLEEASNIIK  179



>dbj|BAJ87733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=517

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +2

Query  293  EWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTL  472
            EWAMQDFY LRKDVE+  +RV E+R  AGL+QL E+IA+LE  + D+ LWDD ++AQ+ L
Sbjct  136  EWAMQDFYALRKDVELAVERVNEVRQDAGLEQLLEEIASLENKSGDSTLWDDPSKAQELL  195

Query  473  QGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIK  619
              LT+ KEK+KLLNDF +QV +A+TI+ LTEE+DSIDTGLLEEA+ IIK
Sbjct  196  VALTELKEKVKLLNDFKSQVEEADTIVQLTEELDSIDTGLLEEASKIIK  244



>ref|XP_002462979.1| hypothetical protein SORBIDRAFT_02g035755 [Sorghum bicolor]
 gb|EER99500.1| hypothetical protein SORBIDRAFT_02g035755 [Sorghum bicolor]
Length=363

 Score =   109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  293  EWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTL  472
            EWA+QDFY LRKDVE+  +RV E+R +AGL+QLEEDIA+LE  +AD++LWDD ++AQ+ L
Sbjct  14   EWALQDFYTLRKDVELALERVNEVRQSAGLEQLEEDIASLEKKSADSSLWDDPSKAQEIL  73

Query  473  QGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIK  619
              LT+ K+++KLLNDF  QV +AETI+ LTEE+DSIDTGLLEEA+ IIK
Sbjct  74   VSLTEVKDRVKLLNDFKLQVEEAETIVKLTEELDSIDTGLLEEASKIIK  122



>gb|EMT33004.1| Peptide chain release factor 2 [Aegilops tauschii]
Length=459

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 98/132 (74%), Gaps = 7/132 (5%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTR-------EWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleedi  403
            A+  ++ V S+ +G         EWAMQDFY LRKDVE+  +RV E+R  AGL++L E+I
Sbjct  55   ASTWINTVQSASSGAGVDEPEAVEWAMQDFYALRKDVELAVERVNEVRQDAGLEKLLEEI  114

Query  404  aaleaaaadtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSID  583
            A+LE  + D+ LWDD ++AQ+ L  LT+ KEK+KLLNDF +QV +A+TI+ LTEE+DSID
Sbjct  115  ASLENKSGDSTLWDDPSKAQELLVALTELKEKVKLLNDFKSQVEEADTIVQLTEELDSID  174

Query  584  TGLLEEAAGIIK  619
            TGLLEEA+ IIK
Sbjct  175  TGLLEEASKIIK  186



>ref|XP_010435491.1| PREDICTED: putative peptide chain release factor 1, mitochondrial 
isoform X2 [Camelina sativa]
Length=379

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +2

Query  302  MQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTLQGL  481
            MQDFY LRKDVE+ S RVEEIR +AGLQQLE++IA LE+ A DT+ WDDR++AQ+TL  L
Sbjct  1    MQDFYTLRKDVEIASARVEEIRDSAGLQQLEQEIANLESKATDTSFWDDRSKAQETLSAL  60

Query  482  TDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
             D K++++LL+DF + V DAETI+ LTEEMDS D  LLEEA GIIKE
Sbjct  61   NDLKDRMRLLSDFKSMVEDAETIVKLTEEMDSTDVSLLEEAMGIIKE  107



>ref|XP_007205352.1| hypothetical protein PRUPE_ppa007171mg [Prunus persica]
 gb|EMJ06551.1| hypothetical protein PRUPE_ppa007171mg [Prunus persica]
Length=379

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +2

Query  302  MQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTLQGL  481
            MQDFY LR+DVE  ++RV+EIR +A LQQLE+++A LE  AAD++ WDDRA+AQ+ L  L
Sbjct  1    MQDFYFLRRDVETTAERVKEIRDSACLQQLEQEVADLELKAADSSFWDDRAKAQENLSAL  60

Query  482  TDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            TD K++++LLN+F +QV DAETI+ LTEEMDS+D GLLEEAA IIKE
Sbjct  61   TDVKDRIRLLNEFKSQVEDAETIVKLTEEMDSVDNGLLEEAASIIKE  107



>ref|NP_001059924.1| Os07g0546600 [Oryza sativa Japonica Group]
 dbj|BAC79675.1| putative translation releasing factor2 [Oryza sativa Japonica 
Group]
 dbj|BAF21838.1| Os07g0546600 [Oryza sativa Japonica Group]
Length=460

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +2

Query  293  EWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTL  472
            EWAMQDFY LRKDVE+   RV E+R +AGL QLEE+IA+LE  +AD++LWDD ++AQ+ L
Sbjct  79   EWAMQDFYALRKDVELAVARVSEVRQSAGLDQLEEEIASLEKKSADSSLWDDPSKAQEIL  138

Query  473  QGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIK  619
              LT+ K+++KLLND   QV +AETI+ LTEE+DSIDTGLLEEA+ IIK
Sbjct  139  VALTEVKDRVKLLNDLKLQVEEAETIVKLTEELDSIDTGLLEEASKIIK  187



>gb|EEE67361.1| hypothetical protein OsJ_24645 [Oryza sativa Japonica Group]
Length=498

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +2

Query  293  EWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTL  472
            EWAMQDFY LRKDVE+   RV E+R +AGL QLEE+IA+LE  +AD++LWDD ++AQ+ L
Sbjct  117  EWAMQDFYALRKDVELAVARVSEVRQSAGLDQLEEEIASLEKKSADSSLWDDPSKAQEIL  176

Query  473  QGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIK  619
              LT+ K+++KLLND   QV +AETI+ LTEE+DSIDTGLLEEA+ IIK
Sbjct  177  VALTEVKDRVKLLNDLKLQVEEAETIVKLTEELDSIDTGLLEEASKIIK  225



>ref|XP_006858849.1| hypothetical protein AMTR_s00066p00184560 [Amborella trichopoda]
 gb|ERN20316.1| hypothetical protein AMTR_s00066p00184560 [Amborella trichopoda]
Length=458

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 92/121 (76%), Gaps = 2/121 (2%)
 Frame = +2

Query  260  DAVSSSETG--TREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadt  433
            D  SS  TG  T EWA+QDFY LRKDVE   +RV+EIRA+AGL QLEE+++ LE  AA +
Sbjct  67   DGQSSGGTGVATTEWAIQDFYTLRKDVETTQKRVDEIRASAGLAQLEEELSLLEKEAAKS  126

Query  434  alwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGI  613
            +LWD+ A+AQQTL  LTD K+K+KLL DF ++  DAE +I LTEEM+S D GLLEEA+ +
Sbjct  127  SLWDEPAKAQQTLLALTDVKDKIKLLTDFESKAQDAEMVIKLTEEMESTDAGLLEEASKL  186

Query  614  I  616
            I
Sbjct  187  I  187



>ref|XP_007029206.1| High chlorophyll fluorescent 109 isoform 1 [Theobroma cacao]
 gb|EOY09708.1| High chlorophyll fluorescent 109 isoform 1 [Theobroma cacao]
Length=537

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 97/158 (61%), Gaps = 32/158 (20%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQ--------------------------------DFYILRK  328
            ATPE       +T TREW MQ                                DFY LRK
Sbjct  66   ATPESQLTEGVDTNTREWVMQGSEAVGMLPWFYGHYHCFEVVGFNANKVLDFVDFYALRK  125

Query  329  DVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTLQGLTDAKEKLKL  508
            DVE  S+RVEEI A+ GLQ LE+++A LE+ AAD++ WDDRA+AQ+TL  LTD K+K+ L
Sbjct  126  DVETASERVEEIIASTGLQLLEKELADLESKAADSSFWDDRAKAQETLLALTDVKDKINL  185

Query  509  LNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            LN+F T+V DAETI+ LTEEMD+ID  LLEEA  +IKE
Sbjct  186  LNEFKTKVEDAETIVKLTEEMDAIDAALLEEAVSVIKE  223



>ref|XP_011006754.1| PREDICTED: peptide chain release factor PrfB1, chloroplastic 
isoform X2 [Populus euphratica]
Length=436

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +2

Query  308  DFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTLQGLTD  487
            DFY LRKDVE  SQRVEE+RA++GL  LE+++A LE+ AAD++LWDDRA+AQ+TL  LTD
Sbjct  60   DFYSLRKDVETASQRVEEMRASSGLHLLEQELADLESKAADSSLWDDRAKAQETLLALTD  119

Query  488  AKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
             K+K+KLL +F T+V +AETI+ LTEEMDS D G LEEA GIIKE
Sbjct  120  VKDKIKLLTEFKTKVEEAETIVKLTEEMDSTDAGFLEEATGIIKE  164



>ref|XP_006658669.1| PREDICTED: peptide chain release factor 1, mitochondrial-like 
[Oryza brachyantha]
Length=520

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +2

Query  293  EWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTL  472
            EWAMQDFY LRKDVE+   RV E+R +A + QLEE+IA+LE  +AD++LWDD ++AQ+ L
Sbjct  136  EWAMQDFYALRKDVELAVARVNEVRQSAAMDQLEEEIASLEKKSADSSLWDDPSKAQEIL  195

Query  473  QGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIK  619
              LT+ K+++KLLNDF +QV +AETI+ LTEE+DSIDT LLEEA+ I K
Sbjct  196  VALTEVKDRVKLLNDFKSQVEEAETIVKLTEELDSIDTSLLEEASKITK  244



>ref|XP_008443661.1| PREDICTED: peptide chain release factor 1, mitochondrial isoform 
X3 [Cucumis melo]
Length=377

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 86/107 (80%), Gaps = 0/107 (0%)
 Frame = +2

Query  302  MQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTLQGL  481
            MQDFY LRK+VE  S+RVEEIR +AGL QL++++A LE+ A D + WDDR++AQ+ L  +
Sbjct  1    MQDFYTLRKEVETTSERVEEIRNSAGLLQLDQELADLESKATDNSFWDDRSKAQKVLVAM  60

Query  482  TDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            TD K+K+K+L DF TQV +AETI+ LTEEMDS+D GLLEEA  II++
Sbjct  61   TDVKDKIKMLTDFKTQVEEAETIVKLTEEMDSVDVGLLEEATRIIQD  107



>ref|XP_008443660.1| PREDICTED: peptide chain release factor 1, mitochondrial isoform 
X2 [Cucumis melo]
Length=402

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  302  MQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTLQGL  481
              DFY LRK+VE  S+RVEEIR +AGL QL++++A LE+ A D + WDDR++AQ+ L  +
Sbjct  26   FHDFYTLRKEVETTSERVEEIRNSAGLLQLDQELADLESKATDNSFWDDRSKAQKVLVAM  85

Query  482  TDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            TD K+K+K+L DF TQV +AETI+ LTEEMDS+D GLLEEA  II++
Sbjct  86   TDVKDKIKMLTDFKTQVEEAETIVKLTEEMDSVDVGLLEEATRIIQD  132



>gb|EMS47820.1| Peptide chain release factor 2 [Triticum urartu]
Length=539

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +2

Query  308  DFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTLQGLTD  487
            DFY LRKDVE+  +RV E+R  AGL+QL E+IA LE  + D+ LWDD ++AQ+ L  LT+
Sbjct  46   DFYALRKDVELAVERVNEVRQDAGLEQLLEEIALLENKSGDSTLWDDPSKAQELLVALTE  105

Query  488  AKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIK  619
             KEK+KLLNDF +QV +A+TI+ LTEE+DSIDTGLLEEA+ IIK
Sbjct  106  LKEKVKLLNDFKSQVEEADTIVQLTEELDSIDTGLLEEASKIIK  149



>gb|EAZ04247.1| hypothetical protein OsI_26391 [Oryza sativa Indica Group]
Length=457

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +2

Query  308  DFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTLQGLTD  487
            DFY LRKDVE+   RV E+R +AGL QLEE+IA+LE  +AD++LWDD ++AQ+ L  LT+
Sbjct  81   DFYALRKDVELALARVGEVRQSAGLDQLEEEIASLEKKSADSSLWDDPSKAQEILVALTE  140

Query  488  AKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIK  619
             K+++KLLND  +QV +AETI+ LTEE+DSIDTGLLEEA+ IIK
Sbjct  141  VKDRVKLLNDLKSQVEEAETIVKLTEELDSIDTGLLEEASKIIK  184



>ref|XP_004139158.1| PREDICTED: peptide chain release factor 2-like [Cucumis sativus]
Length=450

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 91/126 (72%), Gaps = 3/126 (2%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaa  424
            AT E     + +T TREWAMQDFY LRK+VE  S+RVEEIR +AGL QL++++A LE+ A
Sbjct  58   ATHESPVGEAIDTDTREWAMQDFYTLRKEVETTSERVEEIRNSAGLLQLDQELADLESKA  117

Query  425  adtalwddraraQQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEA  604
            AD + WDDR++AQ+ L G+    E +  +   M QV +AETI+ LTEEMDS+D GLLEEA
Sbjct  118  ADNSFWDDRSKAQKVLMGVV-ILECVGCV--MMIQVEEAETIVKLTEEMDSVDVGLLEEA  174

Query  605  AGIIKE  622
              IIK+
Sbjct  175  TKIIKD  180



>ref|XP_006428672.1| hypothetical protein CICLE_v10012132mg [Citrus clementina]
 gb|ESR41912.1| hypothetical protein CICLE_v10012132mg [Citrus clementina]
Length=341

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  461  QQTLQGLTDAKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            Q+TLQ LTD K+K+ LL DF T++ DA TI+ LTEEMDS D GLLEEAA IIKE
Sbjct  16   QETLQALTDVKDKINLLTDFKTKMDDAVTIVKLTEEMDSTDAGLLEEAASIIKE  69



>ref|XP_010445528.1| PREDICTED: uncharacterized protein LOC104728206 [Camelina sativa]
Length=125

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +2

Query  302  MQDFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTLQGL  481
            MQDFY LRKDVE+ S RVEEIR +AGLQQLE++IA LE+ A DT+ WDDR++AQ+TL  L
Sbjct  1    MQDFYTLRKDVEIASARVEEIRDSAGLQQLEQEIANLESKATDTSFWDDRSKAQETLSAL  60

Query  482  TDAKEKLKLLNDFMTQV  532
             D K++++LL+DF + V
Sbjct  61   NDLKDRMRLLSDFKSMV  77



>ref|XP_010436685.1| PREDICTED: probable peptide chain release factor 1, mitochondrial 
[Camelina sativa]
Length=186

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  500  LKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAAGIIKE  622
            ++LL+DF + V DAETI+ LTEEMDS D  LLEEA GIIKE
Sbjct  1    MRLLSDFKSMVEDAETIVKLTEEMDSTDVSLLEEAMGIIKE  41



>gb|EYU39728.1| hypothetical protein MIMGU_mgv1a016376mg [Erythranthe guttata]
Length=124

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 4/41 (10%)
 Frame = +2

Query  245  ATPEVDAVSSSETGTREWAMQDFYILRKDVEVVSQRVEEIR  367
            ATPE        T T EWAMQDFY LRK+VE +S RVEEIR
Sbjct  81   ATPEAGV----STETSEWAMQDFYTLRKEVETISIRVEEIR  117



>ref|XP_002992014.1| hypothetical protein SELMODRAFT_134701 [Selaginella moellendorffii]
 gb|EFJ06863.1| hypothetical protein SELMODRAFT_134701 [Selaginella moellendorffii]
Length=382

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 65/100 (65%), Gaps = 0/100 (0%)
 Frame = +2

Query  308  DFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTLQGLTD  487
            +FY LRKDVE V+ RV ++  +A L+Q E  +A LE  A+D A W++R++AQ+ L  L +
Sbjct  8    EFYSLRKDVENVAARVRQLLDSADLEQQEAVLADLENQASDPAFWEERSKAQKILSELNE  67

Query  488  AKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAA  607
             K+++ L   F  +V DA+ I+ L EEM+S D  L  EAA
Sbjct  68   IKDRVNLYKTFRAKVDDAQCIVELLEEMESPDAALKLEAA  107



>ref|XP_002964513.1| hypothetical protein SELMODRAFT_64370, partial [Selaginella moellendorffii]
 gb|EFJ34846.1| hypothetical protein SELMODRAFT_64370, partial [Selaginella moellendorffii]
Length=366

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 65/100 (65%), Gaps = 0/100 (0%)
 Frame = +2

Query  308  DFYILRKDVEVVSQRVEEIRAAAGLQQleediaaleaaaadtalwddraraQQTLQGLTD  487
            +FY LRKDVE V+ RV ++  +A L+Q E  +A LE  A+D A W++R++AQ+ L  L +
Sbjct  1    EFYSLRKDVENVAARVRQLLDSADLEQQEAVLADLENQASDPAFWEERSKAQKILSELNE  60

Query  488  AKEKLKLLNDFMTQVGDAETIINLTEEMDSIDTGLLEEAA  607
             K+++ L   F  +V DA+ I+ L EEM+S D  L  EAA
Sbjct  61   IKDRVNLYKTFRAKVDDAQCIVELLEEMESPDAALKLEAA  100



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380