BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF048M07

Length=447
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002515516.1|  grr1, plant, putative                              117   1e-27   Ricinus communis
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                      108   2e-24   Gossypium arboreum [tree cotton]
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             108   2e-24   Populus trichocarpa [western balsam poplar]
gb|KDP33594.1|  hypothetical protein JCGZ_07165                         108   2e-24   Jatropha curcas
gb|KJB55011.1|  hypothetical protein B456_009G058000                    108   2e-24   Gossypium raimondii
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       107   5e-24   Populus euphratica
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       106   1e-23   Populus euphratica
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             106   1e-23   Phaseolus vulgaris [French bean]
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    105   2e-23   Glycine max [soybeans]
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     103   1e-22   Eucalyptus grandis [rose gum]
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    103   1e-22   Eucalyptus grandis [rose gum]
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  103   2e-22   Cucumis sativus [cucumbers]
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    103   2e-22   
emb|CBI21043.3|  unnamed protein product                                102   5e-22   Vitis vinifera
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       102   5e-22   Vitis vinifera
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       102   5e-22   Populus euphratica
gb|KHN33913.1|  EIN3-binding F-box protein 1                            100   1e-21   Glycine soja [wild soybean]
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       100   1e-21   
ref|XP_002308665.2|  grr1 family protein                              99.8    3e-21   
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like     99.4    4e-21   Nelumbo nucifera [Indian lotus]
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like     98.6    8e-21   
ref|XP_004173614.1|  PREDICTED: EIN3-binding F-box protein 1-like     95.9    8e-20   
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like     95.5    1e-19   
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like     94.0    3e-19   Pyrus x bretschneideri [bai li]
gb|AFT92041.1|  EIN3 binding F-box 1                                  94.0    3e-19   Malus domestica [apple tree]
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...  94.0    4e-19   
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...  94.0    4e-19   
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg           93.2    6e-19   Prunus persica
ref|XP_008347724.1|  PREDICTED: EIN3-binding F-box protein 1-like     88.6    6e-19   
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like     91.3    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like     90.5    5e-18   Sesamum indicum [beniseed]
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like     90.5    6e-18   Nelumbo nucifera [Indian lotus]
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like     90.5    6e-18   Cicer arietinum [garbanzo]
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...  90.5    6e-18   
ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1          90.1    7e-18   Nicotiana sylvestris
gb|KJB82811.1|  hypothetical protein B456_013G215000                  89.4    1e-17   Gossypium raimondii
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...  89.4    2e-17   Prunus mume [ume]
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like     89.0    2e-17   Citrus sinensis [apfelsine]
ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like     89.0    2e-17   Nicotiana tomentosiformis
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg           88.6    3e-17   Citrus clementina [clementine]
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1-like     88.2    3e-17   Cucumis sativus [cucumbers]
ref|XP_007011864.1|  EIN3-binding F box protein 1                     87.8    5e-17   
gb|AES73649.2|  EIN3-binding F-box-like protein                       87.0    8e-17   Medicago truncatula
ref|XP_003603398.1|  Ein3-binding f-box protein                       87.0    9e-17   
emb|CBI28209.3|  unnamed protein product                              86.3    1e-16   Vitis vinifera
emb|CAN82790.1|  hypothetical protein VITISV_030601                   87.0    1e-16   Vitis vinifera
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like     86.3    1e-16   Vitis vinifera
ref|XP_003588766.1|  Ein3-binding f-box protein                       85.9    2e-16   Medicago truncatula
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like     85.5    3e-16   Fragaria vesca subsp. vesca
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1          84.7    5e-16   Cucumis melo [Oriental melon]
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like     84.0    1e-15   Solanum tuberosum [potatoes]
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like     83.2    2e-15   Pyrus x bretschneideri [bai li]
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg              82.0    4e-15   Erythranthe guttata [common monkey flower]
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...  80.9    1e-14   
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...  80.9    1e-14   Glycine max [soybeans]
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...  80.9    1e-14   
ref|NP_001234864.1|  EIN3-binding F-box protein 2                     80.1    2e-14   
gb|KHN07078.1|  EIN3-binding F-box protein 1                          79.7    3e-14   Glycine soja [wild soybean]
ref|XP_002524506.1|  grr1, plant, putative                            78.6    8e-14   Ricinus communis
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like     77.8    1e-13   Tarenaya hassleriana [spider flower]
ref|NP_565597.1|  EIN3-binding F-box protein 1                        75.5    8e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g           75.1    1e-12   Phaseolus vulgaris [French bean]
ref|XP_002880682.1|  ein3-binding F box protein 1                     74.3    2e-12   
gb|KJB65824.1|  hypothetical protein B456_010G114900                  74.3    2e-12   Gossypium raimondii
gb|KJB65823.1|  hypothetical protein B456_010G114900                  74.3    2e-12   Gossypium raimondii
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1          73.9    3e-12   Sesamum indicum [beniseed]
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg              73.6    4e-12   Erythranthe guttata [common monkey flower]
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1          73.2    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g           72.4    8e-12   Phaseolus vulgaris [French bean]
gb|KJB27084.1|  hypothetical protein B456_004G276800                  72.0    1e-11   Gossypium raimondii
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2          71.6    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like     71.6    2e-11   
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like     71.2    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                    70.9    3e-11   Gossypium arboreum [tree cotton]
gb|KJB54023.1|  hypothetical protein B456_009G017100                  70.9    3e-11   Gossypium raimondii
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                    70.5    4e-11   Gossypium arboreum [tree cotton]
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like     70.1    5e-11   Elaeis guineensis
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1          70.1    5e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg           70.1    6e-11   Capsella rubella
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1          70.1    6e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like     70.1    6e-11   Elaeis guineensis
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like     69.7    7e-11   
ref|XP_006842065.1|  hypothetical protein AMTR_s00078p00046140        69.3    9e-11   Amborella trichopoda
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like     69.3    1e-10   Cucumis melo [Oriental melon]
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like     68.9    1e-10   Phoenix dactylifera
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like     68.6    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1-like     68.2    3e-10   Cucumis sativus [cucumbers]
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like     67.8    3e-10   Pyrus x bretschneideri [bai li]
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                  67.8    4e-10   Arabis alpina [alpine rockcress]
emb|CAN83761.1|  hypothetical protein VITISV_043743                   67.4    4e-10   Vitis vinifera
ref|NP_001234858.1|  EIN3-binding F-box protein 1                     67.4    5e-10   Solanum lycopersicum
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like     67.0    5e-10   
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like     67.0    7e-10   Phoenix dactylifera
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like     66.6    8e-10   Solanum tuberosum [potatoes]
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg           66.2    9e-10   Capsella rubella
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g           66.2    1e-09   
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like     65.9    1e-09   Populus euphratica
ref|XP_007013466.1|  Ein3-binding f-box protein 4                     65.9    2e-09   
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg           65.1    2e-09   Eutrema salsugineum [saltwater cress]
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like     65.1    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like     65.1    3e-09   Pyrus x bretschneideri [bai li]
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like     64.7    4e-09   Camelina sativa [gold-of-pleasure]
gb|KDP32417.1|  hypothetical protein JCGZ_13342                       64.3    4e-09   Jatropha curcas
ref|XP_002874252.1|  ein3-binding F box protein 2                     63.9    6e-09   
dbj|BAH20224.1|  AT2G25490                                            62.8    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like     62.0    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2          62.0    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like     62.0    3e-08   Tarenaya hassleriana [spider flower]
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like     61.2    4e-08   Populus euphratica
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like     61.2    5e-08   Eucalyptus grandis [rose gum]
gb|AFU61111.1|  F-box protein                                         61.2    5e-08   Capsicum annuum
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g           60.8    7e-08   
ref|XP_010086585.1|  hypothetical protein L484_002248                 60.5    8e-08   Morus notabilis
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like     60.5    9e-08   Nicotiana sylvestris
emb|CDP10419.1|  unnamed protein product                              60.1    1e-07   Coffea canephora [robusta coffee]
ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like     59.3    2e-07   Nicotiana tomentosiformis
gb|ACB59221.1|  F-box protein                                         59.3    2e-07   Brassica oleracea
emb|CDX76980.1|  BnaC04g37750D                                        58.9    3e-07   
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg              58.9    3e-07   Erythranthe guttata [common monkey flower]
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g           58.5    3e-07   Phaseolus vulgaris [French bean]
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like     58.5    3e-07   Sesamum indicum [beniseed]
gb|AEK81539.1|  EIN3 binding F-box 1                                  58.5    4e-07   Dianthus caryophyllus [carnation]
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like     58.5    4e-07   Tarenaya hassleriana [spider flower]
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like     58.2    5e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like     58.2    5e-07   Solanum tuberosum [potatoes]
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like     58.2    5e-07   Fragaria vesca subsp. vesca
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like     58.2    5e-07   Brassica rapa
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like     57.8    6e-07   Eucalyptus grandis [rose gum]
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                   57.8    7e-07   Eucalyptus grandis [rose gum]
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg           57.0    1e-06   Eutrema salsugineum [saltwater cress]
emb|CDX87090.1|  BnaC09g04050D                                        56.6    2e-06   
ref|NP_197917.1|  EIN3-binding F-box protein 2                        56.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2          56.2    2e-06   Brassica rapa
emb|CDX88173.1|  BnaA06g27640D                                        56.2    2e-06   
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like     55.8    3e-06   Solanum lycopersicum
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like     55.8    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like     55.8    3e-06   Glycine max [soybeans]
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like     55.5    4e-06   Glycine max [soybeans]
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                    55.5    4e-06   Gossypium arboreum [tree cotton]
emb|CDY19807.1|  BnaA09g04600D                                        55.1    4e-06   Brassica napus [oilseed rape]
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like     54.7    7e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like     54.7    7e-06   Cicer arietinum [garbanzo]
gb|KJB07737.1|  hypothetical protein B456_001G042600                  53.9    1e-05   Gossypium raimondii
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like     53.5    2e-05   Glycine max [soybeans]
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg           53.5    2e-05   
emb|CDX80503.1|  BnaC07g29410D                                        53.5    2e-05   
ref|XP_002526343.1|  grr1, plant, putative                            49.3    5e-05   
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg           52.0    5e-05   
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like     52.0    5e-05   Nicotiana sylvestris
gb|KJB07621.1|  hypothetical protein B456_001G033400                  51.6    6e-05   Gossypium raimondii
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g           51.6    6e-05   Phaseolus vulgaris [French bean]
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                 51.6    7e-05   Citrus sinensis [apfelsine]
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like     51.2    9e-05   Nicotiana tomentosiformis
emb|CDP13515.1|  unnamed protein product                              48.5    1e-04   Coffea canephora [robusta coffee]
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1          50.1    2e-04   Brassica rapa
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like     50.1    2e-04   
emb|CDY35358.1|  BnaA04g14890D                                        50.1    2e-04   Brassica napus [oilseed rape]
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like     50.1    2e-04   Cucumis sativus [cucumbers]
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like     49.3    4e-04   Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   117 bits (294),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 62/76 (82%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL  F+G DDFCP      +P +  LFLSLGH VDVYFPSRKRSRINAPFVFSGE+ +
Sbjct  1    MSKLCGFAGDDDFCPGGSIYTNPKELGLFLSLGHHVDVYFPSRKRSRINAPFVFSGERFE  60

Query  398  EKKQASIEVLPDECLF  445
            +KKQASIEVLPDECLF
Sbjct  61   KKKQASIEVLPDECLF  76



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score =   108 bits (271),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 60/76 (79%), Gaps = 7/76 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL  FSG DDFCP      +P +S LFLSLG  VDVYFPSRKRSRI+APFVFSGE+ +
Sbjct  1    MSKLFSFSGTDDFCPGGSMYPNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  398  EKKQASIEVLPDECLF  445
            +KK  SIEVLPDECLF
Sbjct  61   QKK-PSIEVLPDECLF  75



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   108 bits (271),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSK+ EF+G +DFCP      +P +  LFLSLG  VDVYFPSRKRSRI+APFVFS E+ +
Sbjct  1    MSKVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  398  EKKQASIEVLPDECLF  445
            +KKQASIEVLPDECLF
Sbjct  61   QKKQASIEVLPDECLF  76



>gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   108 bits (271),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL  F+G DDFCP      +P ++ L LSLG  VDVYFPSRKRSRI+APFV  GE+ +
Sbjct  1    MSKLFGFAGDDDFCPGGPIYANPKEASLLLSLGRHVDVYFPSRKRSRISAPFVLVGERFE  60

Query  398  EKKQASIEVLPDECLF  445
            +KKQASIEVLPDECLF
Sbjct  61   QKKQASIEVLPDECLF  76



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score =   108 bits (271),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 60/76 (79%), Gaps = 7/76 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL  FSG DDFCP      +P +S LFLSLG  VDVYFPSRKRSRI+APFVFSGE+ +
Sbjct  1    MSKLFSFSGTDDFCPGGSIYTNPKESSLFLSLGRHVDVYFPSRKRSRISAPFVFSGERFE  60

Query  398  EKKQASIEVLPDECLF  445
            +KK  SIEVLPDECLF
Sbjct  61   QKK-PSIEVLPDECLF  75



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   107 bits (268),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS++ EF+G +DFCP      +P +  LFLSLG  VDVYFPSRKRSRI+APFVFS E+ +
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFSEERFE  60

Query  398  EKKQASIEVLPDECLF  445
            +KKQASIEVLPDECLF
Sbjct  61   QKKQASIEVLPDECLF  76



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   106 bits (265),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS++ EF+G +DFCP      +P +  LFLSLG  VDVYFPSRKRSRI+APFVF+ E+ +
Sbjct  1    MSQVFEFAGENDFCPGGPIYTNPKEPSLFLSLGLPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  398  EKKQASIEVLPDECLF  445
            +KKQASIEVLPDECLF
Sbjct  61   QKKQASIEVLPDECLF  76



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   106 bits (264),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSK+L FSGGDDFCP      +P ++  FL LG QVDVYFP RKRSR+NAPFVF GE  +
Sbjct  1    MSKVLGFSGGDDFCPGGSLYANPKEASFFLPLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  398  EKKQASIEVLPDECLF  445
            +K++ SIE LPDECLF
Sbjct  61   QKQKTSIESLPDECLF  76



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   105 bits (263),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSK+L FSG DDFCP      +P ++  FLSLG QVDVYFP RKRSR+NAPFVF GE  +
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLSLGPQVDVYFPPRKRSRVNAPFVFDGEWFE  60

Query  398  EKKQASIEVLPDECLF  445
            +K++ SIE LPDECLF
Sbjct  61   QKQKTSIEALPDECLF  76



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   103 bits (258),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 61/76 (80%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSK+ EF+G  DFCP      +P ++ LFLSLG  VD+YFP+ KRSRI+APFVFSG+++ 
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  398  EKKQASIEVLPDECLF  445
            +KK+ASI+VLPDECLF
Sbjct  61   QKKKASIDVLPDECLF  76



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   103 bits (258),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 61/76 (80%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSK+ EF+G  DFCP      +P ++ LFLSLG  VD+YFP+ KRSRI+APFVFSG+++ 
Sbjct  1    MSKVFEFTGDGDFCPGGSLYPNPKETSLFLSLGRHVDLYFPTCKRSRISAPFVFSGDQLK  60

Query  398  EKKQASIEVLPDECLF  445
            +KK+ASI+VLPDECLF
Sbjct  61   QKKKASIDVLPDECLF  76



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 56/76 (74%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL  FSG +DFC      P+P DS LFLSL H VDVYFP RKRSRI APFVF GE+V+
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  398  EKKQASIEVLPDECLF  445
             K   SIE+LPDECLF
Sbjct  61   SKANVSIEILPDECLF  76



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 56/76 (74%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL  FSG +DFC      P+P DS LFLSL H VDVYFP RKRSRI APFVF GE+V+
Sbjct  1    MSKLFAFSGSEDFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVE  60

Query  398  EKKQASIEVLPDECLF  445
             K   SIE+LPDECLF
Sbjct  61   SKANVSIEILPDECLF  76



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score =   102 bits (253),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL +++G D FCP      +  DS LFLSLG  VDVYFP RKRSRI+APFV SG+K +
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  398  EKKQASIEVLPDECLF  445
            +K+Q SI+VLPDECLF
Sbjct  61   QKEQVSIDVLPDECLF  76



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   102 bits (253),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL +++G D FCP      +  DS LFLSLG  VDVYFP RKRSRI+APFV SG+K +
Sbjct  1    MSKLFDYTGNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFE  60

Query  398  EKKQASIEVLPDECLF  445
            +K+Q SI+VLPDECLF
Sbjct  61   QKEQVSIDVLPDECLF  76



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   102 bits (253),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPS-PM-----DSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSK+  F+G +DFCP  P+     +  LFLS+G  VDVYFPSRKRSRI+APFVF+ E+ +
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  398  EKKQASIEVLPDECLF  445
            +KKQASIEVLPDECLF
Sbjct  61   QKKQASIEVLPDECLF  76



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   100 bits (250),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSK+L FSG DDFCP      +P ++  FL LG QVDVYFP RKRSR+N PFVF GE  +
Sbjct  1    MSKVLGFSGVDDFCPMGSIYANPKEASFFLPLGPQVDVYFPPRKRSRVNTPFVFDGEWFE  60

Query  398  EKKQASIEVLPDECLF  445
            +K + S+E LPDECLF
Sbjct  61   QKPKTSVEALPDECLF  76



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   100 bits (250),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 47/66 (71%), Positives = 55/66 (83%), Gaps = 6/66 (9%)
 Frame = +2

Query  266  DDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVL  427
            DDFCP      +P DS LFLSLG+ VDVYFPSRKRSRI+APFVFS E++ +KK+ASI+VL
Sbjct  60   DDFCPGGPIYSNPKDSSLFLSLGNHVDVYFPSRKRSRISAPFVFSEERLQKKKKASIDVL  119

Query  428  PDECLF  445
            PDECLF
Sbjct  120  PDECLF  125



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 59/76 (78%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPS-PM-----DSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSK+  F+G +DFCP  P+     +  LFLS+G  VDVYFPSRKRSRI+APFVF+ E+ +
Sbjct  1    MSKVFGFAGENDFCPGGPIYTNHKEQNLFLSIGRPVDVYFPSRKRSRISAPFVFTEERFE  60

Query  398  EKKQASIEVLPDECLF  445
            +KKQASIE LPDECLF
Sbjct  61   QKKQASIEFLPDECLF  76



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 56/76 (74%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            M  L+ ++G +DFC       +PMDS L LSLG  VDVY P RKRSRI APFVF G+K +
Sbjct  1    MRTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRITAPFVFRGDKFE  60

Query  398  EKKQASIEVLPDECLF  445
            +KKQ+SIEVLPDECLF
Sbjct  61   QKKQSSIEVLPDECLF  76



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 57/75 (76%), Gaps = 7/75 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            MSKLL FSG DDFCP     +P ++ LFLSLGH  DV FP RKRSRI+APFVFSG + + 
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGGRFE-  59

Query  401  KKQASIEVLPDECLF  445
             K+ SI+VLPDECLF
Sbjct  60   -KEVSIDVLPDECLF  73



>ref|XP_004173614.1| PREDICTED: EIN3-binding F-box protein 1-like, partial [Cucumis 
sativus]
Length=631

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  251  EFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLP  430
            +F  G    P+P DS LFLSL H VDVYFP RKRSRI APFVF GE+V+ K   SIE+LP
Sbjct  3    DFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVESKANVSIEILP  62

Query  431  DECLF  445
            DECLF
Sbjct  63   DECLF  67



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSK+L F+GG+DF        SP ++ LFLSLG+ VDVYFP  KRSRI+APFVFS +  +
Sbjct  1    MSKVLRFTGGEDFYSGRSIYQSPKEANLFLSLGNHVDVYFPPSKRSRISAPFVFSEDLFE  60

Query  398  EKKQASIEVLPDECLF  445
            +K+Q +IEVLPDECLF
Sbjct  61   QKRQDTIEVLPDECLF  76



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 57/75 (76%), Gaps = 7/75 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            MSKLL FSG DDFCP     +P ++ LFLSLGH  DV FP RKRSRI+APFVFSG + + 
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLFLSLGHHADVLFPPRKRSRISAPFVFSGGRFE-  59

Query  401  KKQASIEVLPDECLF  445
             K+ SI+VLPDECLF
Sbjct  60   -KEVSIDVLPDECLF  73



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 7/75 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            MSKLL FSG DDFCP     +P ++ L LSLGH  DV FP RKRSRI+APF+FSG   + 
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE-  59

Query  401  KKQASIEVLPDECLF  445
             K+ SI VLPDECLF
Sbjct  60   -KEVSINVLPDECLF  73



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 7/75 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            MSKLL FSG DDFCP     +P ++ L LSLGH  DV FP RKRSRI+APF+FSG   + 
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE-  59

Query  401  KKQASIEVLPDECLF  445
             K+ SI VLPDECLF
Sbjct  60   -KEVSINVLPDECLF  73



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 7/75 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            MSKLL FSG DDFCP     +P ++ L LSLGH  DV FP RKRSRI+APF+FSG   + 
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE-  59

Query  401  KKQASIEVLPDECLF  445
             K+ SI VLPDECLF
Sbjct  60   -KEVSINVLPDECLF  73



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKLL F+G DDFCP      +P +  LFLS G+  DV+F  RKRSRI+ PFVFS E  +
Sbjct  1    MSKLLGFAGNDDFCPGGSIYTNPKEPSLFLSRGNHADVFFTPRKRSRISGPFVFSEEGFE  60

Query  398  EKKQASIEVLPDECLF  445
            +KK  SI+VLPDECLF
Sbjct  61   QKKPVSIDVLPDECLF  76



>ref|XP_008347724.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=150

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 54/75 (72%), Gaps = 7/75 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            MSKLL FSG DDFCP     +P ++ L LSLGH  DV FP RKRSRI+APF+FSG   + 
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE-  59

Query  401  KKQASIEVLPDECLF  445
             K+ SI VLPDECLF
Sbjct  60   -KEVSINVLPDECLF  73



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 6/75 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPM-----DSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            MSKLL FSG DDFCP  +     ++ L LSLGH  DV FP RKRSRI+APF+FSG    E
Sbjct  1    MSKLLGFSGKDDFCPGGIYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-E  59

Query  401  KKQASIEVLPDECLF  445
            KK+ SI VLPDECLF
Sbjct  60   KKEVSINVLPDECLF  74



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 53/76 (70%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSK+ +F G  DFCP      +P ++ LFL LG  VDVYFP RKRSRI+APFV SG    
Sbjct  1    MSKVFDFGGDSDFCPGGFLYQNPKEAGLFLPLGSHVDVYFPPRKRSRISAPFVVSGVA--  58

Query  398  EKKQASIEVLPDECLF  445
             K+Q SIE+LPDECLF
Sbjct  59   -KQQPSIEILPDECLF  73



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            M  L+ ++G +DFC       +PMDS L LSLG  VDVY P RKRSRI+APFVF  +K +
Sbjct  1    MPTLVNYAGDEDFCSGGSLYANPMDSSLLLSLGPHVDVYCPPRKRSRISAPFVFRCDKFE  60

Query  398  EKKQASIEVLPDECLF  445
            ++KQ+SIEVLPDECLF
Sbjct  61   QQKQSSIEVLPDECLF  76



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 7/76 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPS------PMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS++  FSG D+FCPS      P ++  F SLGHQVD YFP +KRSR++ PFVF GE   
Sbjct  1    MSQVFGFSG-DNFCPSGSIYTNPKEASFFPSLGHQVDAYFPPQKRSRVSVPFVFDGEWFT  59

Query  398  EKKQASIEVLPDECLF  445
            +K++ SIE LPDECLF
Sbjct  60   QKQKTSIESLPDECLF  75



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  251  EFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLP  430
            +F  G    P+P DS LFLSL H VDVYFP RKRSRI APFVF GE+V+ K   SIE+LP
Sbjct  62   DFCTGGSIYPNPKDSSLFLSLPHHVDVYFPPRKRSRITAPFVFGGEEVESKANVSIEILP  121

Query  431  DECLF  445
            DECLF
Sbjct  122  DECLF  126



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score = 90.1 bits (222),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 54/76 (71%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSK+  FSG D FCP      SP +S LFLSLGH VDVYFP  KRSR+ AP +F+ EK  
Sbjct  1    MSKVFNFSGDDAFCPGGALYPSPKESSLFLSLGHHVDVYFPPCKRSRVTAPIIFT-EK--  57

Query  398  EKKQASIEVLPDECLF  445
            +KK  SI+VLPDECLF
Sbjct  58   QKKLPSIDVLPDECLF  73



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 54/76 (71%), Gaps = 7/76 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDF------CPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL  FSG D+F       P+P +S LF SLGH VDVYFP  KRSRI+ P V SGE+V 
Sbjct  1    MSKLFSFSGSDNFFPGGSIYPNPKESSLFFSLGHHVDVYFPHHKRSRISPPIVCSGERV-  59

Query  398  EKKQASIEVLPDECLF  445
            EKK  SIE+LPDECLF
Sbjct  60   EKKNPSIEILPDECLF  75



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 52/76 (68%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKLL   G DDFCP      +P +  LFLSLG+  DV+F  RKRSRI+  FVFS E  +
Sbjct  1    MSKLLGLPGNDDFCPGGSIYTNPKEPSLFLSLGNHADVFFTPRKRSRISGTFVFSEEGFE  60

Query  398  EKKQASIEVLPDECLF  445
            +KK  SI+VLPDECLF
Sbjct  61   QKKPVSIDVLPDECLF  76



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 55/76 (72%), Gaps = 7/76 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL   SG DDFCP      +P +S L L LG  VDVYF +RKRSRI+APFV+S E+  
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDVYFRARKRSRISAPFVYSEERF-  59

Query  398  EKKQASIEVLPDECLF  445
            E+KQ SIEVLPDECLF
Sbjct  60   EQKQVSIEVLPDECLF  75



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 54/76 (71%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSK+  FSG + FCP      SP +S LFLSLGH VDVYFP  KRSRI AP +F+ EK  
Sbjct  1    MSKVFNFSGDEAFCPGRALYPSPKESSLFLSLGHHVDVYFPPCKRSRITAPIIFT-EK--  57

Query  398  EKKQASIEVLPDECLF  445
            +KK  SI+VLPDECLF
Sbjct  58   QKKLPSIDVLPDECLF  73



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 7/76 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL   SG DDFCP      +P +S L L LG  VD+YF +RKRSRI+APFV+S E+  
Sbjct  1    MSKLFALSGSDDFCPGGPIYPNPKESGLLLPLGPNVDIYFRARKRSRISAPFVYSEERF-  59

Query  398  EKKQASIEVLPDECLF  445
            E+KQ SIEVLPDECLF
Sbjct  60   EQKQVSIEVLPDECLF  75



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004160764.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = +2

Query  251  EFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLP  430
            +F  G    P+P D+ LFLSLG QVDVY+P RKRSR++APFV SGE +  KK+ASIEVLP
Sbjct  14   DFFPGAPIYPNPKDTSLFLSLGRQVDVYYPLRKRSRVSAPFVPSGEIL--KKEASIEVLP  71

Query  431  DECLF  445
            DECLF
Sbjct  72   DECLF  76



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 7/68 (10%)
 Frame = +2

Query  260  GGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIE  421
            G DDFCP      +P +S  FLSLGH VDVYFP RK+SRI+APFVFSGE+ ++KK  SI+
Sbjct  56   GSDDFCPGGSIYPNPKESSHFLSLGHHVDVYFPLRKKSRISAPFVFSGERFEQKK-PSID  114

Query  422  VLPDECLF  445
            VLPDECLF
Sbjct  115  VLPDECLF  122



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 52/77 (68%), Gaps = 7/77 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEK-V  394
            MSK+L F+GGDDFC       +P ++ LFLSLG Q   Y P +KRSR N PF FSGEK  
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  395  DEKKQASIEVLPDECLF  445
            D K + SIE LPDECLF
Sbjct  61   DLKPETSIETLPDECLF  77



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 52/77 (68%), Gaps = 7/77 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEK-V  394
            MSK+L F+GGDDFC       +P ++ LFLSLG Q   Y P +KRSR N PF FSGEK  
Sbjct  1    MSKVLSFTGGDDFCTGRSMYLNPKEASLFLSLGRQEYAYRPLQKRSRFNVPFDFSGEKWF  60

Query  395  DEKKQASIEVLPDECLF  445
            D K + SIE LPDECLF
Sbjct  61   DLKPETSIETLPDECLF  77



>emb|CBI28209.3| unnamed protein product [Vitis vinifera]
Length=546

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 6/78 (8%)
 Frame = +2

Query  230  VPMSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEK  391
            +PMS L+ +SG DDF P      +PMDS L +S+G  +DVY P RKRSRI AP++F    
Sbjct  1    MPMSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENN  60

Query  392  VDEKKQASIEVLPDECLF  445
            ++ +K+ SI+VLPDECLF
Sbjct  61   LELEKRPSIDVLPDECLF  78



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 51/68 (75%), Gaps = 6/68 (9%)
 Frame = +2

Query  260  GGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIE  421
            G D FCP      +  DS LFLSLG  VDVYFP RKRSRI+APFV SG+K ++K+Q SI+
Sbjct  109  GNDAFCPGGSIYSNIKDSSLFLSLGRHVDVYFPPRKRSRISAPFVVSGDKFEQKEQVSID  168

Query  422  VLPDECLF  445
            VLPDECLF
Sbjct  169  VLPDECLF  176



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 6/78 (8%)
 Frame = +2

Query  230  VPMSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEK  391
            +PMS L+ +SG DDF P      +PMDS L +S+G  +DVY P RKRSRI AP++F    
Sbjct  1    MPMSTLVNYSGDDDFYPGGSFYINPMDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENN  60

Query  392  VDEKKQASIEVLPDECLF  445
            ++ +K+ SI+VLPDECLF
Sbjct  61   LELEKRPSIDVLPDECLF  78



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 55/75 (73%), Gaps = 6/75 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC-----PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            MS++  FSG D+FC      +P ++  FLSLG QVDVY+P +KRSR++ PFVF GE  ++
Sbjct  1    MSQVFGFSG-DNFCHGGLYTNPKEANFFLSLGPQVDVYYPPQKRSRVSVPFVFDGEWFEQ  59

Query  401  KKQASIEVLPDECLF  445
            K++ SIE LPDECLF
Sbjct  60   KQKTSIESLPDECLF  74



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL  F+G DDFCP      +P ++  FLSLG +VD+Y+P  KRSR +APFVF+ E  +
Sbjct  1    MSKLFGFAGSDDFCPGGSIYENPKEAGRFLSLGRRVDLYYPPSKRSRNSAPFVFNQESFE  60

Query  398  EKKQASIEVLPDECLF  445
            + KQ SI+VLP+ECLF
Sbjct  61   QNKQVSIDVLPEECLF  76



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 8/77 (10%)
 Frame = +2

Query  236  MSKLLEFS--GGDDFCPSPM-----DSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKV  394
            M+K+  F+    +DF P+P+     D+ LFLSLG  VDVY+P RKRSR++AP+V SGE +
Sbjct  1    MAKIFGFTLKESEDFFPAPIYPNPKDTSLFLSLGPHVDVYYPLRKRSRVSAPYVPSGE-I  59

Query  395  DEKKQASIEVLPDECLF  445
             +KK+ASIEVLPDECLF
Sbjct  60   LKKKEASIEVLPDECLF  76



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSK+  FSG D F       PSP +S LFLSLG+ VDVYFP  KRSR+  PFVF+ +K  
Sbjct  1    MSKVFNFSGDDAFYHGGAVYPSPKESSLFLSLGNHVDVYFPPCKRSRVAVPFVFTEKK--  58

Query  398  EKKQASIEVLPDECLF  445
             +K +SI+VLPDECLF
Sbjct  59   -QKLSSIDVLPDECLF  73



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 48/69 (70%), Gaps = 6/69 (9%)
 Frame = +2

Query  254  FSGGDDFCPSPM-----DSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASI  418
             +G DDFCP  +     ++ L LSLGH  DV FP RKRSRI+APF+FSG    EKK+ SI
Sbjct  11   LAGKDDFCPGGIYTNLKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYF-EKKEVSI  69

Query  419  EVLPDECLF  445
             VLPDECLF
Sbjct  70   NVLPDECLF  78



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPS------PMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS++++FSG + FCPS      P +S  FLSLG  V+VYF  RKRSRI APF+ SGE   
Sbjct  1    MSQVVDFSGDNSFCPSAFLYQNPKESSQFLSLGSHVNVYFTPRKRSRITAPFIVSGE---  57

Query  398  EKKQASIEVLPDECLF  445
             K++ SIE+LPDECLF
Sbjct  58   PKQKPSIEILPDECLF  73



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 7/65 (11%)
 Frame = +2

Query  266  DDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLP  430
            DDFCP     +P ++ L LSLGH  DV FP RKRSRI+APF+FSG   +  K+ SI VLP
Sbjct  59   DDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE--KEVSINVLP  116

Query  431  DECLF  445
            DECLF
Sbjct  117  DECLF  121



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSK+  F+G DDF       P+P +  LFLSLG QVDVY P +KRSR + PF  SGE  +
Sbjct  1    MSKVFSFTGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFE  60

Query  398  EKKQASIEVLPDECLF  445
            +K + SIE LPDECLF
Sbjct  61   QKPKTSIESLPDECLF  76



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 46/65 (71%), Gaps = 7/65 (11%)
 Frame = +2

Query  266  DDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLP  430
            DDFCP     +P ++ L LSLGH  DV FP RKRSRI+APF+FSG   +  K+ SI VLP
Sbjct  59   DDFCPGGIYTNPKEAGLLLSLGHHADVLFPPRKRSRISAPFIFSGGYFE--KEVSINVLP  116

Query  431  DECLF  445
            DECLF
Sbjct  117  DECLF  121



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 43/72 (60%), Positives = 50/72 (69%), Gaps = 5/72 (7%)
 Frame = +2

Query  236  MSKLLEFSG--GDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQ  409
            MSK+  FSG  G    PSP +S LFLSL + VDVYFP  KRSR+  PFVFS +K    K 
Sbjct  1    MSKVFNFSGDHGGTVYPSPKESSLFLSLRNHVDVYFPPCKRSRVAVPFVFSEKK---HKL  57

Query  410  ASIEVLPDECLF  445
            +SI+VLPDECLF
Sbjct  58   SSIDVLPDECLF  69



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 50/75 (67%), Gaps = 8/75 (11%)
 Frame = +2

Query  245  LLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKK  406
            +L FSG DDF       P+P +  LFLSLG QVDVY P +KRSR + PF  SGE  ++K+
Sbjct  1    MLGFSGNDDFYHGGPIYPNPKEPCLFLSLGRQVDVYLPLQKRSRFSVPFDISGEWFEQKQ  60

Query  407  --QASIEVLPDECLF  445
              + SIE LPDECLF
Sbjct  61   KPKTSIESLPDECLF  75



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            PA+V  S   EF  G   C +PMD   + S+G  VD Y P  KR+RI++PF+F   + ++
Sbjct  2    PALVNYSGDDEFYSGGSLCANPMDLGRYYSIGSHVDAYSPPCKRARISSPFLFGSSEFEQ  61

Query  401  KKQASIEVLPDECLF  445
             KQ SI+VLPDECLF
Sbjct  62   NKQPSIDVLPDECLF  76



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 48/70 (69%), Gaps = 6/70 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS L  FSG +DF P      L+LS G Q+DVY+P+ KRSRI AP +FSG    E+ Q S
Sbjct  1    MSGLFRFSGDEDFFPG---GSLYLSPGSQIDVYYPAHKRSRIAAPAIFSGF---EQNQVS  54

Query  416  IEVLPDECLF  445
            I+VLPDECLF
Sbjct  55   IDVLPDECLF  64



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 49/76 (64%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS++  F+G +DF       P+P D+ L LSLG   DVYFP  KRSR+ AP +FS     
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKDASLLLSLGSFADVYFPPSKRSRVVAPTIFSAF---  57

Query  398  EKKQASIEVLPDECLF  445
            EKK  SI+VLPDECLF
Sbjct  58   EKKPVSIDVLPDECLF  73



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/77 (53%), Positives = 50/77 (65%), Gaps = 8/77 (10%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS++  FSG DDFCP      +P +  LFLSLG  VD YF  +KRSR++  F  + E  D
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVD-YFSLQKRSRVSVSFDINREWFD  59

Query  398  EKKQA-SIEVLPDECLF  445
            E+KQ  SIE LPDECLF
Sbjct  60   EQKQEISIESLPDECLF  76



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS++  F+G +DF       P+P D+ L LSLG  VDVYFP  KRSR+ AP VFSG    
Sbjct  1    MSQIYSFAGENDFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSGF---  57

Query  398  EKKQASIEVLPDECLF  445
            EKK  SI+VLPDECLF
Sbjct  58   EKKPVSIDVLPDECLF  73



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 50/76 (66%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSP------MDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL  FSG DDFCP         +S LFL      DVYFP  KR RI+APFVF+G K +
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFLYPNQ--DVYFPPCKRYRISAPFVFAGGKFE  58

Query  398  EKKQASIEVLPDECLF  445
            +KK  SIEVLPDECLF
Sbjct  59   QKK-PSIEVLPDECLF  73



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 50/76 (66%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSP------MDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL  FSG DDFCP         +S LFL      DVYFP  KR RI+APFVF+G K +
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNLKESSLFLYPNQ--DVYFPPCKRYRISAPFVFAGGKFE  58

Query  398  EKKQASIEVLPDECLF  445
            +KK  SIEVLPDECLF
Sbjct  59   QKK-PSIEVLPDECLF  73



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 8/75 (11%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP-----SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            MS++ +F     FCP     +P  S LFL LG+ VDVYF  RKRSRI+APFV SGE    
Sbjct  1    MSEVFDFKAVGKFCPGGFLTNPKVSSLFLPLGNHVDVYFLPRKRSRISAPFVVSGEP---  57

Query  401  KKQASIEVLPDECLF  445
            ++Q SI+VLPDECLF
Sbjct  58   EQQPSIDVLPDECLF  72



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 51/70 (73%), Gaps = 3/70 (4%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS++ +FS    FCP+  DS L  +LG +VD+YF  RKRSRI+APF+ +G+K   K Q+S
Sbjct  1    MSEVFDFSDVHTFCPNSKDSNLSFTLGSRVDMYFLQRKRSRISAPFI-AGKK--SKMQSS  57

Query  416  IEVLPDECLF  445
            IE LPDECLF
Sbjct  58   IEALPDECLF  67



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS++  F+G ++F       P+P D+ L LSLG  VDVYFP  KRSR+ AP VFS     
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAF---  57

Query  398  EKKQASIEVLPDECLF  445
            E+KQ SI+VLPDECLF
Sbjct  58   EEKQVSIDVLPDECLF  73



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 50/77 (65%), Gaps = 8/77 (10%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS++  FSG DDFCP      +P +  LFLSLG  VD YFP +KRSR++  F  + E  D
Sbjct  1    MSQVFSFSGNDDFCPGGRIYPNPKEPCLFLSLGRSVD-YFPLQKRSRVSVSFDINREWFD  59

Query  398  EKKQ-ASIEVLPDECLF  445
            E KQ  SIE LPDECLF
Sbjct  60   EPKQKTSIESLPDECLF  76



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            PA+V      +F  G  F  +  D     S+  QVDVY+P RKR+RI APFV      ++
Sbjct  2    PALVNYGGDDDFYSGGSFYTNSTDLGRLCSISSQVDVYYPPRKRARITAPFVVGETLFEQ  61

Query  401  KKQASIEVLPDECLF  445
             KQASI+VLPDECLF
Sbjct  62   SKQASIDVLPDECLF  76



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 47/70 (67%), Gaps = 6/70 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS L  FSG + + P      + LS G  + VY+P+RKRSRI+AP +FSG    E+ QAS
Sbjct  1    MSGLFRFSGDEGYFPG---GSMCLSPGSNIGVYYPARKRSRISAPSLFSGF---ERNQAS  54

Query  416  IEVLPDECLF  445
            IEVLPDECLF
Sbjct  55   IEVLPDECLF  64



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 46/72 (64%), Gaps = 10/72 (14%)
 Frame = +2

Query  260  GGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFS-GEKVDEKKQ---  409
            G DD C       + MDS   LS+   VDV+FP RKRSRI APF+F  GEK  EK++   
Sbjct  21   GTDDLCSVGPLISNLMDSSCLLSIASNVDVFFPPRKRSRITAPFIFKGGEKGAEKQKQQP  80

Query  410  ASIEVLPDECLF  445
             SI+VLPDECLF
Sbjct  81   CSIDVLPDECLF  92



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 48/75 (64%), Gaps = 5/75 (7%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAP--FVFSG-EKVDEKK  406
            M+ L+ + GGDD CP    S  FLS G  VDVY P RKR+R+ AP  F F G E+V  +K
Sbjct  1    MAALVNYGGGDDLCPLFPGSSRFLSPGRNVDVYCPPRKRARVIAPLGFSFRGREEVAAEK  60

Query  407  QA--SIEVLPDECLF  445
            Q   SI+ LPDECLF
Sbjct  61   QQPRSIDTLPDECLF  75



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            PA+V  S   +F  G  F  +  D     S+  QVDVY P RKR+RI+APF F   +V++
Sbjct  2    PALVNYSGDDDFYNGGSFYTNSTDLGRLCSISSQVDVYCPPRKRTRISAPFHFGEAEVEQ  61

Query  401  KKQASIEVLPDECL  442
             KQ SI+VLPDECL
Sbjct  62   NKQPSIDVLPDECL  75



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            PA+V  S   +F  G  F  +  D     S+  QVDVY P RKR+RI+APF F   +V++
Sbjct  2    PALVNYSGDDDFYNGGSFYTNSTDLGRLCSISFQVDVYCPPRKRTRISAPFHFGEAEVEQ  61

Query  401  KKQASIEVLPDECL  442
             KQ SI+VLPDECL
Sbjct  62   NKQPSIDVLPDECL  75



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 50/76 (66%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MSKL  FSG DDFCP      +  +S LF       DVYFP  KR R+++PFVF+G K +
Sbjct  1    MSKLFAFSGSDDFCPGGSIYPNRKESSLFFYPNQ--DVYFPPCKRCRVSSPFVFAGGKFE  58

Query  398  EKKQASIEVLPDECLF  445
            +KK  SIE+LPDECLF
Sbjct  59   QKK-PSIEILPDECLF  73



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 48/81 (59%), Gaps = 11/81 (14%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFS-GEKV  394
            M  L+ + G DD C       + MDS   LSL   VDV+ P RKRSR+ APF+F  GEK 
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKQ  60

Query  395  DEKKQ----ASIEVLPDECLF  445
              +KQ     SI+VLPDECLF
Sbjct  61   GAEKQKQQSCSIDVLPDECLF  81



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 56/78 (72%), Gaps = 9/78 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLG--HQVDVYFPSRKRSRINAPFVFSGEK  391
            MS++ +FSG ++F        +P ++  FLSLG  + VDVYFP+ KR+RI+AP V  GE 
Sbjct  1    MSQIFDFSGNEEFYHGGSIYSNPKEAGSFLSLGIVNHVDVYFPN-KRARISAPLVPGGES  59

Query  392  VDEKKQASIEVLPDECLF  445
            +++KKQ S++VLPDECL+
Sbjct  60   LEQKKQVSLDVLPDECLY  77



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 50/76 (66%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS++  F+G ++F       P+P D+ L LSLG  VDVYFP  KRSR+ AP VFS     
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSFVDVYFPPSKRSRVVAPTVFSSF---  57

Query  398  EKKQASIEVLPDECLF  445
            EKK  SI+VLPDECLF
Sbjct  58   EKKPVSIDVLPDECLF  73



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS++  F+G ++F       P+P D+ L LSLG  VDVYFP  KRSR+ AP VFS     
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTVFSAF---  57

Query  398  EKKQASIEVLPDECLF  445
            E+K  SI+VLPDECLF
Sbjct  58   EEKPVSIDVLPDECLF  73



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 48/81 (59%), Gaps = 11/81 (14%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFS-GEKV  394
            M  L+ + G DD C       + MDS   LSL   VDV+ P RKRSR+ APF+F  GEK 
Sbjct  1    MPALVNYGGTDDLCSVGPLISNLMDSSRLLSLTPNVDVFCPPRKRSRVTAPFIFKGGEKK  60

Query  395  DEKKQ----ASIEVLPDECLF  445
              +KQ     SI+VLPDECLF
Sbjct  61   GAEKQKQQPCSIDVLPDECLF  81



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            M  L+ +SG DDF P      +PMD    LS+G  VDVY P  KR+RI++ F       +
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQFASGRSDFE  60

Query  398  EKKQASIEVLPDECLF  445
            + K+ SI+VLPDECLF
Sbjct  61   QVKKPSIDVLPDECLF  76



>ref|XP_006842065.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 47/75 (63%), Gaps = 5/75 (7%)
 Frame = +2

Query  236  MSKLLEFSGGDD-----FCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            MS L+++SG D      +    MDS LFLSL   +DVY P RKRSR+ APFV      + 
Sbjct  1    MSTLVKYSGDDRHGGPLYSSGLMDSSLFLSLAPNLDVYCPPRKRSRVTAPFVLWENNTNF  60

Query  401  KKQASIEVLPDECLF  445
            +++ S++ LPDECLF
Sbjct  61   QRKPSLDNLPDECLF  75



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 44/76 (58%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            M  L+ + G D++ P      SPMD   FL     VD+YF   KR+RI AP VF G + +
Sbjct  1    MPALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFRPSKRARIGAPVVFGGREFE  60

Query  398  EKKQASIEVLPDECLF  445
            ++   SIE LPDECLF
Sbjct  61   QECTPSIEALPDECLF  76



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 44/80 (55%), Positives = 51/80 (64%), Gaps = 10/80 (13%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSP------MDSILFLSLGHQVDVYFPSRKRSRINAPFVFS-GEKV  394
            M  L+++ G DD CP+       MDS L LSL   VDV+ P RKRSR+ APFVF  GEK 
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFVFKGGEKG  60

Query  395  DEK---KQASIEVLPDECLF  445
             EK   K  SI+VLPDECLF
Sbjct  61   AEKPKQKLCSIDVLPDECLF  80



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 52/78 (67%), Gaps = 8/78 (10%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPM-----DSILFLSLGHQVDVYFPSRKRSRINAPFVF-SGEKV-  394
            M+ L+++ G DD CP P      DS L LSLG + DVY P  KR R+ AP +F +GEKV 
Sbjct  1    MAALVKYGGNDDICPGPFYSNLTDSSLLLSLGQKADVYGPPCKRYRVTAPLIFRAGEKVI  60

Query  395  DEKKQA-SIEVLPDECLF  445
            DE+KQ  SI+ LPDECLF
Sbjct  61   DEEKQPRSIDTLPDECLF  78



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004169733.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            PA+V      E+  G  F  SPMD   FL     VD+YF   KR+RI +P VF G + ++
Sbjct  2    PALVNYGGDDEYYPGGSFYSSPMDLDAFLPTSSHVDLYFHPSKRARIGSPVVFGGREFEQ  61

Query  401  KKQASIEVLPDECLF  445
            +   SIE LPDECLF
Sbjct  62   ECTPSIEALPDECLF  76



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            M  L+ + G DDF P      +PMD    LS+G  VDVY P  KR+RI++ F   G   +
Sbjct  1    MPALVNYCGDDDFYPGGSFYSNPMDLGCLLSMGAHVDVYCPPSKRARISSQFASGGSDFE  60

Query  398  EKKQASIEVLPDECLF  445
            + K+ SI+ LPDECLF
Sbjct  61   QVKKPSIDDLPDECLF  76



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 47/76 (62%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS++  FSG +DF       P+P D  L LSLG  VD YFP  KRSR+ AP  +S     
Sbjct  1    MSQIFSFSGENDFYRRGVTYPNPKDVNLLLSLGSLVDCYFPPCKRSRVVAPSRYSAF---  57

Query  398  EKKQASIEVLPDECLF  445
            E+K  SI+VLP+ECLF
Sbjct  58   EEKPVSIDVLPEECLF  73



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  287  MDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLF  445
            MDS L +S+G  +DVY P RKRSRI AP++F    ++ +K+ SI+VLPDECLF
Sbjct  1    MDSGLLVSIGSCMDVYCPPRKRSRITAPYIFRENNLELEKRPSIDVLPDECLF  53



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            P +V  S   EF  G  FC +  D  L LSLGH  DVY P RKR+RI+ PFV      D 
Sbjct  2    PTLVNYSGDDEFYSGGSFCSA--DLGLMLSLGH-ADVYCPPRKRARISGPFVVE----DR  54

Query  401  KKQASIEVLPDECLF  445
             K  S+EVLPDECLF
Sbjct  55   SKDPSLEVLPDECLF  69



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 44/76 (58%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            M  L+ +SG DDF P      +PMD    LS+G  VDVY P  KR+RI++ +       +
Sbjct  1    MPALVNYSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  398  EKKQASIEVLPDECLF  445
            + K  SI VLPDECLF
Sbjct  61   QIKNPSINVLPDECLF  76



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 39/80 (49%), Positives = 51/80 (64%), Gaps = 10/80 (13%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSP------MDSILFLSLGHQVDVYFPSRKRSRINAPFVF----SG  385
            M  L+++ G DD CP+       MDS L LSL   VDV+ P RKRSR+ APF+F    +G
Sbjct  1    MPALVKYGGSDDLCPAGPLFSNLMDSSLLLSLAPNVDVFCPPRKRSRVTAPFIFKGGENG  60

Query  386  EKVDEKKQASIEVLPDECLF  445
             +  ++K  SI+VLPDECLF
Sbjct  61   AEKPKQKLCSIDVLPDECLF  80



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            P +V  S   EF  G  FC +  D  L LSLGH  DVY P RKR+RI+ PFV      D 
Sbjct  2    PTLVNYSGDDEFYSGGSFCSA--DLGLMLSLGH-ADVYCPPRKRARISGPFVVE----DR  54

Query  401  KKQASIEVLPDECLF  445
             K  S+E+LPDECLF
Sbjct  55   SKDPSLEILPDECLF  69



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 37/70 (53%), Positives = 45/70 (64%), Gaps = 6/70 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS +  FSG +DF    +   ++LS G    VYFP+ KR RI AP VFSG    E+KQ S
Sbjct  1    MSGIFGFSGDEDFF---LGGSMYLSPGSCPGVYFPAHKRLRIAAPSVFSGF---EQKQTS  54

Query  416  IEVLPDECLF  445
            I+VLPDECLF
Sbjct  55   IDVLPDECLF  64



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            PA+V  S   E   G     +  D     S+G +VDVY P+ KR+RI+APF+F     ++
Sbjct  2    PALVNYSGDDEIYSGGSLYANSSDLGRLYSIGSRVDVYSPACKRARISAPFLFGSSGFEQ  61

Query  401  KKQASIEVLPDECLF  445
             K+ SIEVLPDECLF
Sbjct  62   NKRPSIEVLPDECLF  76



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            PA+V  S   E   G  F  +  D     S+G +VDVY P+ KR+RI+APF+F     ++
Sbjct  2    PALVNYSGDDEIYSGGSFYANSSDLGRLYSIGPRVDVYSPACKRARISAPFLFGSSGFEQ  61

Query  401  KKQASIEVLPDECLF  445
              + SIEVLPDECLF
Sbjct  62   NTRPSIEVLPDECLF  76



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  251  EFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLP  430
            +F  G  F  +  D     S+  QVDVY P RKR+RI APF+F   + ++ KQ SI+VLP
Sbjct  59   DFYSGGSFYTNSTDLGRLCSISSQVDVYCPPRKRARICAPFLFGETEFEQNKQPSIDVLP  118

Query  431  DECLF  445
            +ECLF
Sbjct  119  EECLF  123



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 43/70 (61%), Gaps = 6/70 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS +  FSG +DF P      + LS G    VYFP+RKR RI AP V  G    E+KQ S
Sbjct  1    MSGIFRFSGDEDFFPG---GSMHLSPGSCPGVYFPARKRLRIAAPSVQIGF---EQKQTS  54

Query  416  IEVLPDECLF  445
            IEVLPDECLF
Sbjct  55   IEVLPDECLF  64



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 41/78 (53%), Positives = 50/78 (64%), Gaps = 8/78 (10%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPS-PM-----DSILFLSLGHQVDVYFPSRKRSRINAPFVF-SGEKV  394
            M+ L+   G DD CP  P+     DS L LSL   VDVY P RKR R+ AP +F +GEK+
Sbjct  1    MAALVNRRGNDDICPGGPLFSNLVDSSLLLSLTRNVDVYCPPRKRPRVTAPLIFRAGEKI  60

Query  395  -DEKKQASIEVLPDECLF  445
             DEK Q SI+ LP+ECLF
Sbjct  61   ADEKLQRSIDTLPEECLF  78



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 43/76 (57%), Gaps = 6/76 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            M  L+  SG DDF P      +PMD    LS+G  VDVY P  KR+RI++ +       +
Sbjct  1    MPALVNSSGDDDFYPGGSFYSNPMDLGCLLSMGSHVDVYCPPSKRARISSQYASGRSDFE  60

Query  398  EKKQASIEVLPDECLF  445
            + K  SI VLPDECLF
Sbjct  61   QVKNPSINVLPDECLF  76



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 49/77 (64%), Gaps = 10/77 (13%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAP-FVFSGEKV  394
            MS++  F+G ++F       P+P D+ L LSLG  VDVYFP  KRSR+ AP  VFS    
Sbjct  1    MSQIYSFAGENEFYRRGAIYPNPKDASLLLSLGSYVDVYFPPSKRSRVVAPTTVFSAF--  58

Query  395  DEKKQASIEVLPDECLF  445
             EKK  S +VLPDECLF
Sbjct  59   -EKKPVSFDVLPDECLF  74



>gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 4/75 (5%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            P +V  S   EF  G   C + M      S+G  VD+Y P  KR+R ++PF+F     ++
Sbjct  2    PTLVNYSGDDEFYAGGSLCTNSM----LYSIGSLVDIYSPPCKRARTSSPFLFGSSDFEQ  57

Query  401  KKQASIEVLPDECLF  445
             KQ SI+VLPDECLF
Sbjct  58   NKQPSIDVLPDECLF  72



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 46/70 (66%), Gaps = 5/70 (7%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS +  FSG +DF      S ++LS G    VYFP+RKR RI AP VFSG    E+KQ S
Sbjct  1    MSGIFRFSGDEDFFLG--GSSMYLSPGSCPGVYFPARKRLRIAAPSVFSGF---EEKQTS  55

Query  416  IEVLPDECLF  445
            I+VLPDECLF
Sbjct  56   IDVLPDECLF  65



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/52 (62%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +2

Query  290  DSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLF  445
            D+ L LSLG   DVYFP  KRSR+ AP +FS     EKK  SI+VLPDECLF
Sbjct  1    DASLLLSLGSFADVYFPPSKRSRVVAPTIFSAF---EKKPVSIDVLPDECLF  49



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 5/70 (7%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS +  FSG +DF      S+  LS G    VYFP+RKR RI A  VFSG    E+KQ S
Sbjct  1    MSGIFGFSGDEDFFLG--GSMHNLSPGSCPGVYFPARKRLRIAATSVFSGF---EQKQTS  55

Query  416  IEVLPDECLF  445
            I+VLPDECLF
Sbjct  56   IDVLPDECLF  65



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 44/70 (63%), Gaps = 5/70 (7%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS +  FSG +DF      S+  LS G    VYFP+RKR RI A  VFSG    E+KQ S
Sbjct  1    MSGIFGFSGDEDFFLG--GSMHNLSPGSCPGVYFPARKRLRIAATSVFSGF---EEKQTS  55

Query  416  IEVLPDECLF  445
            I+VLPDECLF
Sbjct  56   IDVLPDECLF  65



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS++  F+G  DFCP      +P ++ L LSLG  VDVYFP RK+SR++AP V    +  
Sbjct  1    MSEIFSFAGESDFCPRGSIYPNPKETSLLLSLGSLVDVYFPPRKKSRVSAPLV---ARAF  57

Query  398  EKKQASIEVLPDECLF  445
            E++  SI+VLPDECLF
Sbjct  58   EQEPVSIDVLPDECLF  73



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = +2

Query  218  FPAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
             P +V  S   E   G  F  +P D     S+   VDVY P+ KR+RI+ PF+F     +
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISTPFLFESSGFE  60

Query  398  EKKQASIEVLPDECLF  445
            + K+ SIEVLPDECLF
Sbjct  61   QNKRPSIEVLPDECLF  76



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            P +V      +F GG   C S +D     S+G  +D+Y+P  KR+RI  P+  S  + + 
Sbjct  2    PTLVNYGGEDQFFGGGSLCTSSIDLDRLYSMGSSMDIYYPPHKRARICGPYAVSSYEYEG  61

Query  401  KKQASIEVLPDECLF  445
            ++ +SI  LPDECLF
Sbjct  62   ERPSSIGELPDECLF  76



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 37/75 (49%), Positives = 43/75 (57%), Gaps = 7/75 (9%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            PA+V  S   E   G  FC +  D  L LSLGH  +VY P RKRSRI+ PFV      D 
Sbjct  2    PALVNYSGDDELYSGGSFCSA--DLGLMLSLGH-AEVYCPPRKRSRISGPFVVE----DR  54

Query  401  KKQASIEVLPDECLF  445
             K  S++ LPDECLF
Sbjct  55   SKGPSLDDLPDECLF  69



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = +2

Query  218  FPAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
             P +V  S   E   G  F  +P D     S+   VDVY P+ KR+RI+APF+F     +
Sbjct  1    MPTLVNYSGDDEIYSGGSFYTNPSDLGRLYSIVSNVDVYSPACKRARISAPFLFESSGFE  60

Query  398  EKKQASIEVLPDECLF  445
            +  + SIEVLPDECLF
Sbjct  61   QNMRPSIEVLPDECLF  76



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 2/70 (3%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            M  L+ +SG D+F      S    S+   VD+Y P  KR+RI+APF   G   ++ ++ S
Sbjct  1    MPTLVNYSGDDEFYSG--GSCSPYSIASHVDLYCPPSKRARISAPFALEGSFFEQAEKPS  58

Query  416  IEVLPDECLF  445
            I+VLPDECLF
Sbjct  59   IDVLPDECLF  68



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 35/75 (47%), Positives = 42/75 (56%), Gaps = 7/75 (9%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            P +V  S   EF  G   C +  D  L LSLGH   VY P RKR+RI+ PF+      + 
Sbjct  2    PTLVNYSGDDEFYSGGSLCSA--DLGLMLSLGH-AQVYCPLRKRARISGPFIIE----ER  54

Query  401  KKQASIEVLPDECLF  445
             K  SIE+LPDECLF
Sbjct  55   TKNPSIEILPDECLF  69



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/76 (43%), Positives = 44/76 (58%), Gaps = 11/76 (14%)
 Frame = +2

Query  236  MSKLLEFSGGDDF------CPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            M  L+ + G DDF      C +  DS L LS+    DVY P RKRSR++AP+       +
Sbjct  1    MPALVNYGGDDDFYTGRSICSA--DSGLVLSIA---DVYCPPRKRSRVSAPYAVDSRLFN  55

Query  398  EKKQASIEVLPDECLF  445
            +++  SIE LPDECLF
Sbjct  56   KERNPSIETLPDECLF  71



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/76 (49%), Positives = 45/76 (59%), Gaps = 9/76 (12%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            P +V  S   EF  G   C +  D  L LSLGH   VY P RK++RI+ PFV     V+E
Sbjct  2    PTLVNYSGDDEFYSGGSLCSA--DLGLMLSLGH-AQVYCPLRKKARISGPFV-----VEE  53

Query  401  K-KQASIEVLPDECLF  445
            + K  SIE+LPDECLF
Sbjct  54   RTKNPSIEILPDECLF  69



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +2

Query  254  FSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPD  433
            F+ G  +  +P D+ L LSL    DVYFP  KR R+  P +FS     EKK  SI+VLPD
Sbjct  13   FTVGAQYTRNPKDASLLLSLISFGDVYFPPSKRQRVVLPTLFSAF---EKKPVSIDVLPD  69

Query  434  ECLF  445
            ECLF
Sbjct  70   ECLF  73



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 6/74 (8%)
 Frame = +2

Query  236  MSKLLEFSGGDDF---CPSPMDSILFLSLGHQVDVYFPSRKRSR-INAPFVFSGEKVDEK  403
            MS++  F+G  +F     +P ++ +FLSLG  VD Y+P  KRSR + AP +FS    +E+
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANIFLSLGSLVDCYYPPCKRSRVVAAPSLFSA--FEEE  58

Query  404  KQASIEVLPDECLF  445
            K  SI+VLPDECLF
Sbjct  59   KPVSIDVLPDECLF  72



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 38/74 (51%), Gaps = 4/74 (5%)
 Frame = +2

Query  236  MSKLLEFSGGDDF----CPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEK  403
            M  L+ + G DDF         DS L  S+G   +VY P RKRSRI  P       + + 
Sbjct  1    MPALVNYRGDDDFNSIRSSCSGDSGLVFSIGSHAEVYCPPRKRSRIAGPCTLGATLLADD  60

Query  404  KQASIEVLPDECLF  445
            K  SI+ LPDECLF
Sbjct  61   KTPSIDTLPDECLF  74



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 32/76 (42%), Positives = 44/76 (58%), Gaps = 4/76 (5%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMD-SILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            PA+V  S   E   G  FCPSPM+   L+ ++G  +D+Y+P  KRSR     + + E   
Sbjct  2    PALVNYSGDDELYPGGSFCPSPMELGRLYSTIGSNLDLYYPPNKRSR---SILEAIEGEQ  58

Query  398  EKKQASIEVLPDECLF  445
              ++  IEVLPDECLF
Sbjct  59   HYQEPGIEVLPDECLF  74



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 10/77 (13%)
 Frame = +2

Query  236  MSKLLEFSGGDDF-------CPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKV  394
            M  L+   G DDF       C    DS +  S+   V++Y P RKRSRI+ P++ S   +
Sbjct  1    MPALVNIRGDDDFYSEGGSLCSG--DSGVVFSISSHVEIYCPPRKRSRISGPYIVS-RNL  57

Query  395  DEKKQASIEVLPDECLF  445
             E K+ SI+VLPDECLF
Sbjct  58   FEDKRPSIDVLPDECLF  74



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 29/65 (45%), Positives = 35/65 (54%), Gaps = 9/65 (14%)
 Frame = +2

Query  251  EFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLP  430
            E  GG    PS M           VDVY P  KR R+NAPFV  G   ++  ++SI VLP
Sbjct  13   ELYGGRSSNPSAMS---------HVDVYGPPNKRQRVNAPFVLWGSNPEQNTRSSINVLP  63

Query  431  DECLF  445
            DEC+F
Sbjct  64   DECMF  68



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 9/76 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS++   +G + FCP      +P ++ L LSLG  VD YFP  KR+R++AP  FS   V 
Sbjct  1    MSEIFSIAGENGFCPRGSIYPNPKEASLLLSLGSLVDAYFPPCKRTRVSAPTAFS---VF  57

Query  398  EKKQASIEVLPDECLF  445
            E+   SI+VLPDECLF
Sbjct  58   EQDPVSIDVLPDECLF  73



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 14/70 (20%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            M  L+ +SG D+               +    ++PS KR+RINAPFV  G++ +++K++S
Sbjct  1    MPTLINYSGKDEL--------------YNERSFYPSCKRARINAPFVLWGQESEQEKRSS  46

Query  416  IEVLPDECLF  445
            I VLPDECLF
Sbjct  47   INVLPDECLF  56



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 15/77 (19%)
 Frame = +2

Query  236  MSKLLEFSGGDDF------CPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS L+ +SG ++F      C +  D  L L+LGH  D+Y P  KR+RI+ PFV     V+
Sbjct  1    MSTLVNYSGDNEFYSGGSLCSA--DLGLMLALGH-ADIYCPVSKRARISGPFV-----VE  52

Query  398  EK-KQASIEVLPDECLF  445
            E+ K  SIEVLP+ECLF
Sbjct  53   ERTKNPSIEVLPNECLF  69



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 10/77 (13%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPS-------PMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKV  394
            M  L+ +SG D+F          PMD    LS+G      +P  KR+RI++ F   G   
Sbjct  1    MPTLVNYSGDDEFYSGGSCYSSSPMDLGCLLSVGSNA---YPPSKRARISSQFDIRGSSF  57

Query  395  DEKKQASIEVLPDECLF  445
            +++K+ASIEVLP+ECLF
Sbjct  58   EQEKKASIEVLPEECLF  74



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 6/70 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS +  FSG ++F        ++LS G    VY P RKR R+ AP ++S      +KQ S
Sbjct  1    MSGIFSFSGDEEFFNG---GSMYLSTGSCSGVYLPPRKRLRVAAPSLYSSFN---QKQTS  54

Query  416  IEVLPDECLF  445
            IEVLPDECLF
Sbjct  55   IEVLPDECLF  64



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 3/75 (4%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            P +V      +F GG   C S +D     S+G  +D+Y+P  KR+RI  P+  S  + + 
Sbjct  2    PTLVNYGGEDQFFGGGSLCTSSID---LYSMGSSMDIYYPPHKRARICGPYAVSSYEYEG  58

Query  401  KKQASIEVLPDECLF  445
            +  +SI  LPDECLF
Sbjct  59   EHPSSIGELPDECLF  73



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 3/75 (4%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            P +V      +F GG   C S +D     S+G  +D+Y+P  KR+RI  P+  S  + + 
Sbjct  2    PTLVNYGGEDQFFGGGSLCTSSID---LYSMGSSMDIYYPPHKRARICGPYAVSSYEYEG  58

Query  401  KKQASIEVLPDECLF  445
            +  +SI  LPDECLF
Sbjct  59   EHPSSIGELPDECLF  73



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 47/79 (59%), Gaps = 12/79 (15%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDV-YFPSRKRSRI--NAPFVFSGE  388
            MS++  F+G +DF       P+P ++ L LSL   VD  Y+P  KRSR+   AP +FS  
Sbjct  1    MSQIFSFAGENDFYRRGAIYPNPKEANLLLSLTSLVDCCYYPPCKRSRVVATAPSLFSAF  60

Query  389  KVDEKKQASIEVLPDECLF  445
               E K  SI+VLPDECLF
Sbjct  61   ---EAKPVSIDVLPDECLF  76



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 39/70 (56%), Gaps = 6/70 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS +  FSG +DF        + LS G    VY P RKR R+ AP  +S      +KQ S
Sbjct  1    MSGIFSFSGDEDFFNG---GTMHLSPGSCPGVYLPPRKRLRVAAPSPYSAFN---QKQTS  54

Query  416  IEVLPDECLF  445
            IEVLPDECLF
Sbjct  55   IEVLPDECLF  64



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 6/70 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS +  FSG +D     +   ++LS G    VY+P+RKR R+ A   +SG    E+KQ S
Sbjct  1    MSGIFRFSGDEDCL---LGGSMYLSPGSCPGVYYPARKRLRVAATSFYSGF---EEKQTS  54

Query  416  IEVLPDECLF  445
            I+VLP+ECLF
Sbjct  55   IDVLPEECLF  64



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS +   SG D+F      S + LS G    VY P+RKR R+ A    S     E+KQAS
Sbjct  1    MSGIFRVSGDDEFFTGGGGSSMHLSPGSCPGVYLPARKRLRVTAAAT-SFYSSFEEKQAS  59

Query  416  IEVLPDECLF  445
            I+VLPDECLF
Sbjct  60   IQVLPDECLF  69



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/70 (47%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS +   SG D+F      S + LS G    VY P+RKR R+ A    S     E+KQAS
Sbjct  1    MSGIFRVSGDDEFFTGGGGSSMHLSPGSCPGVYLPARKRLRVTAAAT-SFYSSFEEKQAS  59

Query  416  IEVLPDECLF  445
            I+VLPDECLF
Sbjct  60   IQVLPDECLF  69



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 15/77 (19%)
 Frame = +2

Query  236  MSKLLEFSGGDDF------CPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD  397
            MS L+ +SG ++F      C +  D  L L+LGH  D+Y P  KR+RI+ PF+     V+
Sbjct  1    MSTLVNYSGDNEFYSGGSLCSA--DLGLILALGH-ADIYCPVSKRARISGPFI-----VE  52

Query  398  EK-KQASIEVLPDECLF  445
            E+ K  SIE+LP+ECLF
Sbjct  53   ERTKNPSIELLPNECLF  69



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +2

Query  305  LSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLF  445
            LS G    VYFP+RKR RI A  VFSG    E+KQ SI+VLPDECLF
Sbjct  18   LSPGSCPGVYFPARKRLRIAATSVFSGF---EQKQTSIDVLPDECLF  61



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 6/77 (8%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMD-SILFLSLGHQVDVYFPSRKRSRINAPFVFSG-EKV  394
            PA+V  S   E   G  FCP+P++   L+ ++G  +DVY+P  KR R     +F   E+ 
Sbjct  2    PALVNYSGDDELYPGGSFCPNPVELGRLYTTIGSNLDVYYPPTKRPRS----IFEAIERE  57

Query  395  DEKKQASIEVLPDECLF  445
               ++  IEVLPDECLF
Sbjct  58   QYYQEPGIEVLPDECLF  74



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 31/77 (40%), Positives = 43/77 (56%), Gaps = 6/77 (8%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMD-SILFLSLGHQVDVYFPSRKRSRINAPFVFSG-EKV  394
            PA+V  S   E   G  FCP+PM+   L+ ++G  +D+Y+P  KR R     +F   E+ 
Sbjct  2    PALVNYSGDDELYPGGSFCPNPMELGRLYTTIGSNLDMYYPPTKRPRS----IFEAIERE  57

Query  395  DEKKQASIEVLPDECLF  445
               +   IEVLPDECLF
Sbjct  58   QYYQDPGIEVLPDECLF  74



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  236  MSKLLEFSGGDDF--CPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQ  409
            M  L+ +SG DDF    + ++     S+  Q DVY+P  KR RI+APF+F     ++ KQ
Sbjct  1    MPALVNYSGDDDFFIRKNSIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFEQNKQ  60

Query  410  ASIEVLPDECLF  445
             SI  LP EC+F
Sbjct  61   PSINDLPGECIF  72



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/70 (43%), Positives = 41/70 (59%), Gaps = 6/70 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS +  F+G ++F        ++LS G    VY P RKR R++ P ++S      +KQ S
Sbjct  1    MSGIFSFNGDEEFFNG---GSMYLSPGSCSGVYLPPRKRLRVSTPSLYSSFN---QKQTS  54

Query  416  IEVLPDECLF  445
            IEVLPDECLF
Sbjct  55   IEVLPDECLF  64



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 45/79 (57%), Gaps = 9/79 (11%)
 Frame = +2

Query  236  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGE-KV  394
            M+ L+   G DD C       + +DS L LSL   VDVY  SRKR R+ AP  F  E KV
Sbjct  1    MAALVNRGGSDDICHGGSLFSNLVDSSLLLSLSRNVDVYCSSRKRPRVTAPLAFRAEKKV  60

Query  395  DEKKQA--SIEVLPDECLF  445
              KKQ   SI+ LPDECLF
Sbjct  61   AYKKQQPRSIDSLPDECLF  79



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 40/72 (56%), Gaps = 2/72 (3%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPS-PMD-SILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQ  409
            M  L+  SG D+  P   MD      ++   VDVY    KR+RI+APF F   +  +  +
Sbjct  1    MPALVNSSGDDEMYPGGSMDLGGCLYTISSNVDVYCSPTKRARISAPFTFGAVEHKQDHK  60

Query  410  ASIEVLPDECLF  445
             S+E+LPDECLF
Sbjct  61   PSVEILPDECLF  72



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +2

Query  236  MSKLLEFSGGDDF--CPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQ  409
            M  L+ +SG D+F    + ++     S+  Q DVY+P  KR RI+APF+F     ++ KQ
Sbjct  1    MPALVNYSGDDEFFIRKNSIELGRLCSISSQADVYWPPHKRVRISAPFLFRETDFEQNKQ  60

Query  410  ASIEVLPDECLF  445
             SI  LP EC+F
Sbjct  61   PSINDLPGECIF  72



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 13/80 (16%)
 Frame = +2

Query  236  MSKLLEFSGGDD------FCPSPMDSILFLSLGHQVDVYF--PSRKRSRINA--PFVFSG  385
            M  L+ +SG D+      FC +P+D     + G  VD Y+  PS KR+RINA   F F G
Sbjct  1    MPTLVNYSGDDELYHGGSFCQNPIDLGRLCTYGSIVDEYYYTPS-KRARINALDAFEFLG  59

Query  386  EKVDEKKQASIEVLPDECLF  445
             + D+K   +I+VLPDECLF
Sbjct  60   REQDQK--PTIDVLPDECLF  77



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 3/53 (6%)
 Frame = +2

Query  287  MDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLF  445
            MD    LS+G    VY+P  KR+R ++ F F G   ++ ++ SIEVLPDECLF
Sbjct  1    MDLGCLLSIG---SVYYPPSKRARKDSQFAFEGSDFEQVRKPSIEVLPDECLF  50



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 39/70 (56%), Gaps = 1/70 (1%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            MS +   SG D+F      S + LS G    VY P+RKR R+ +    S     E+KQ S
Sbjct  1    MSGIFRISGDDEFFTGGGSS-MHLSPGSCPGVYLPARKRLRVASAAATSFYSSFEEKQTS  59

Query  416  IEVLPDECLF  445
            I+VLPDECLF
Sbjct  60   IQVLPDECLF  69



>ref|XP_002526343.1| grr1, plant, putative [Ricinus communis]
 gb|EEF36014.1| grr1, plant, putative [Ricinus communis]
Length=127

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +2

Query  317  HQVDVYFPSRKRSRINAPFVFSGEKVDEK  403
            HQVDVY PSRKRSRINAPFVF+G+    +
Sbjct  14   HQVDVYSPSRKRSRINAPFVFNGKSYSRR  42



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 27/70 (39%), Positives = 38/70 (54%), Gaps = 11/70 (16%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS  415
            M  L+ + G D F           S+G  VD Y P RKR+R++A F     + + + Q S
Sbjct  1    MPALVNYRGDDLF-----------SIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPS  49

Query  416  IEVLPDECLF  445
            I+VLPDECL+
Sbjct  50   IDVLPDECLY  59



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 37/75 (49%), Gaps = 18/75 (24%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            P +V  S   EF  G  FC +              +VY P RKR RI++PFV      D 
Sbjct  2    PTLVNHSGDDEFYSGGPFCSA--------------EVYCPPRKRVRISSPFVVE----DR  43

Query  401  KKQASIEVLPDECLF  445
             K  S+E+LPDECLF
Sbjct  44   SKDPSLEILPDECLF  58



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 5/41 (12%)
 Frame = +2

Query  323  VDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLF  445
            +DVYFP  KRSR +A    SGEK ++KK  SIEVLPDECLF
Sbjct  1    MDVYFPLSKRSRTSA----SGEKFEQKK-PSIEVLPDECLF  36



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 7/77 (9%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSP------MDSILFLSLGHQVDVYFPS-RKRSRINAPFVFSGEKV  394
            M  L+ +SG D+  P        +D     +LG  V+ Y+ +  KR+RINAP +F   ++
Sbjct  1    MPALVNYSGDDELYPGASFGQNLIDLGRMCTLGSSVEGYYCTPNKRARINAPDIFETLRL  60

Query  395  DEKKQASIEVLPDECLF  445
             + ++ +IEVLP+ECLF
Sbjct  61   RKDQKPAIEVLPNECLF  77



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  302  FLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLF  445
              S+G  VD Y P RKR+R++A F     + + + Q SI+VLPDECL+
Sbjct  11   LFSIGSHVDAYCPPRKRARLSAQFASGETEFEFENQPSIDVLPDECLY  58



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 36/75 (48%), Gaps = 18/75 (24%)
 Frame = +2

Query  221  PAVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDE  400
            P +V  S   EF  G  FC +              +VY P RKR RI+ PFV      D 
Sbjct  2    PTLVNYSGDDEFYSGGPFCSA--------------EVYCPPRKRVRISGPFVVE----DR  43

Query  401  KKQASIEVLPDECLF  445
             K  S+E+LPDECLF
Sbjct  44   SKDPSLEILPDECLF  58



>emb|CDP13515.1| unnamed protein product [Coffea canephora]
Length=143

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 34/57 (60%), Gaps = 6/57 (11%)
 Frame = +3

Query  237  CLSSLNSVVVMIFAL------VPWTQFSFCPLAIKWMCIFLLARGLASMLPLYLVEK  389
            CL  L SVV   F+L      +P +Q  F PL + WMC F LARGL SM  ++LVEK
Sbjct  44   CLKCLISVVTRTFSLGGRYTQIPRSQICFYPLDLMWMCFFHLARGLVSMPHMFLVEK  100



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 9/75 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDF---CPSPMDSILFLSLGHQVDVYFPSRKRSRI--NAPFVFSGEKVDE  400
            MS++  F+G  +F     +P ++ +FLSL   VD Y+P  KRSR+   AP +FS  + +E
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANIFLSL---VDCYYPPCKRSRVVAAAPSLFSAFE-EE  56

Query  401  KKQASIEVLPDECLF  445
            +K  SI++LPDECLF
Sbjct  57   EKPVSIDLLPDECLF  71



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = +2

Query  224  AVVPMSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEK  403
            A   M  L+ + G D F           S+G  VD Y P RKR+R++A F     + + +
Sbjct  94   ASATMPALVNYRGDDLF-----------SIGSHVDAYCPPRKRARLSAQFASGETEFEFE  142

Query  404  KQASIEVLPDECLF  445
             Q SI+VLPDECL+
Sbjct  143  NQPSIDVLPDECLY  156



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 49/75 (65%), Gaps = 9/75 (12%)
 Frame = +2

Query  236  MSKLLEFSGGDDF---CPSPMDSILFLSLGHQVDVYFPSRKRSRI--NAPFVFSGEKVDE  400
            MS++  F+G  +F     +P ++ +FLSL   VD Y+P  KRSR+   AP +FS  + +E
Sbjct  1    MSQIYSFAGESEFYRRGSNPKEANIFLSL---VDCYYPPCKRSRVVAAAPSLFSAFE-EE  56

Query  401  KKQASIEVLPDECLF  445
            +K  SI++LPDECLF
Sbjct  57   EKPVSIDLLPDECLF  71



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 39/71 (55%), Gaps = 5/71 (7%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCPSPMDSI-LFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQA  412
            M  LL ++G D+F P+ M+    FL +  +++V F   KR R N    F G+      + 
Sbjct  1    MPTLLNYTGDDEFHPTSMEDFPCFLPISSRINVCFQPNKRFRTNLKIPFLGDDT----KP  56

Query  413  SIEVLPDECLF  445
            SI+ LPDECLF
Sbjct  57   SIDDLPDECLF  67



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 45/78 (58%), Gaps = 8/78 (10%)
 Frame = +2

Query  236  MSKLLEFSGGDDFCP------SPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKV-  394
            M+ L+  +G DD  P      + MDS L LSL +  D Y P  KR RI +    +GEK  
Sbjct  1    MAALVNCAGNDDIGPGGPLFSNLMDSSLLLSLTYNFDAYCPPSKRYRITSLICKAGEKTA  60

Query  395  DEKKQA-SIEVLPDECLF  445
            DEK+Q  SI+ LPDECLF
Sbjct  61   DEKQQPRSIDTLPDECLF  78



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555551523900