BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF048L23

Length=433
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57279.1|  alpha-expansin                                         227   2e-71   Ipomoea nil [qian niu]
ref|NP_001234081.1|  expansin A4 precursor                              188   3e-56   Solanum lycopersicum
ref|XP_006341021.1|  PREDICTED: expansin-A3                             187   5e-56   Solanum tuberosum [potatoes]
ref|XP_009788740.1|  PREDICTED: expansin-A3-like                        187   7e-56   Nicotiana sylvestris
gb|AEQ55271.1|  expansin                                                186   1e-55   Breonia chinensis
ref|XP_008387765.1|  PREDICTED: expansin-A4-like                        186   1e-55   
ref|XP_009587747.1|  PREDICTED: expansin-A3-like                        185   3e-55   Nicotiana tomentosiformis
ref|XP_009772489.1|  PREDICTED: expansin-A3-like                        183   2e-54   Nicotiana sylvestris
dbj|BAC67193.1|  expansin                                               181   1e-53   Pyrus communis
gb|KJB76740.1|  hypothetical protein B456_012G104400                    181   2e-53   Gossypium raimondii
emb|CDP06606.1|  unnamed protein product                                181   2e-53   Coffea canephora [robusta coffee]
ref|XP_003537990.1|  PREDICTED: expansin-A4-like                        180   3e-53   
gb|KHG12430.1|  Expansin-A4 -like protein                               180   4e-53   Gossypium arboreum [tree cotton]
ref|XP_007016396.1|  Expansin A4, ALPHA 1.6,EXPA4                       179   5e-53   Theobroma cacao [chocolate]
ref|XP_004505858.1|  PREDICTED: expansin-A6-like                        179   5e-53   Cicer arietinum [garbanzo]
gb|KHN21950.1|  Expansin-A4                                             181   5e-53   Glycine soja [wild soybean]
ref|XP_011019858.1|  PREDICTED: expansin-A6                             179   5e-53   Populus euphratica
ref|XP_007027012.1|  Expansin A4, ALPHA 1.6,EXPA4                       179   5e-53   
gb|AIE54285.1|  expansin                                                179   6e-53   Nicotiana tabacum [American tobacco]
ref|XP_004249634.1|  PREDICTED: expansin-A3                             179   6e-53   
ref|XP_009610453.1|  PREDICTED: expansin-A3-like                        179   6e-53   Nicotiana tomentosiformis
gb|ACU17873.1|  unknown                                                 176   6e-53   Glycine max [soybeans]
ref|XP_009341751.1|  PREDICTED: expansin-A4-like                        179   7e-53   Pyrus x bretschneideri [bai li]
gb|KDP35637.1|  hypothetical protein JCGZ_09075                         179   9e-53   Jatropha curcas
emb|CAH18933.1|  expansin                                               179   1e-52   Pyrus communis
ref|XP_007205748.1|  hypothetical protein PRUPE_ppa010226mg             178   1e-52   Prunus persica
ref|XP_004300427.1|  PREDICTED: expansin-A6                             177   2e-52   Fragaria vesca subsp. vesca
dbj|BAH36862.1|  alpha expansin                                         177   3e-52   Rosa hybrid cultivar
ref|XP_007140533.1|  hypothetical protein PHAVU_008G120700g             177   3e-52   Phaseolus vulgaris [French bean]
gb|ACU17612.1|  unknown                                                 174   5e-52   Glycine max [soybeans]
ref|XP_002315218.1|  alpha-expansin 9 precursor family protein          177   6e-52   
ref|XP_009787901.1|  PREDICTED: expansin-A3-like                        177   6e-52   Nicotiana sylvestris
ref|XP_006349505.1|  PREDICTED: expansin-A3-like                        177   6e-52   Solanum tuberosum [potatoes]
ref|XP_004492358.1|  PREDICTED: expansin-A6-like                        176   8e-52   Cicer arietinum [garbanzo]
gb|AFK34565.1|  unknown                                                 174   8e-52   Medicago truncatula
gb|EYU41729.1|  hypothetical protein MIMGU_mgv1a012073mg                176   9e-52   Erythranthe guttata [common monkey flower]
ref|XP_002309061.1|  expansin family protein                            176   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_006339024.1|  PREDICTED: expansin-A3-like                        176   1e-51   Solanum tuberosum [potatoes]
gb|AFB77223.1|  expansin 1                                              176   1e-51   Betula platyphylla [Asian white birch]
ref|XP_009364387.1|  PREDICTED: expansin-A4                             176   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_003597354.1|  Cell wall protein Exp5                             173   1e-51   
gb|KHG30766.1|  Expansin-A4 -like protein                               176   2e-51   Gossypium arboreum [tree cotton]
ref|XP_003552923.2|  PREDICTED: expansin-A3-like                        176   2e-51   Glycine max [soybeans]
gb|KJB16930.1|  hypothetical protein B456_002G257400                    176   2e-51   Gossypium raimondii
ref|XP_007132063.1|  hypothetical protein PHAVU_011G063800g             176   2e-51   Phaseolus vulgaris [French bean]
gb|AFK40565.1|  unknown                                                 174   2e-51   Medicago truncatula
ref|XP_003538409.1|  PREDICTED: expansin-A6                             175   2e-51   Glycine max [soybeans]
ref|XP_007133996.1|  hypothetical protein PHAVU_010G010200g             175   2e-51   Phaseolus vulgaris [French bean]
ref|XP_003552173.1|  PREDICTED: expansin-A4                             175   2e-51   Glycine max [soybeans]
gb|KJB46592.1|  hypothetical protein B456_007G376300                    175   2e-51   Gossypium raimondii
ref|XP_009607348.1|  PREDICTED: expansin-A3-like                        176   2e-51   Nicotiana tomentosiformis
gb|KEH39447.1|  expansin A10                                            175   3e-51   Medicago truncatula
gb|KHG15821.1|  Expansin-A4 -like protein                               175   3e-51   Gossypium arboreum [tree cotton]
ref|XP_003616412.1|  Expansin                                           175   3e-51   Medicago truncatula
gb|KJB36710.1|  hypothetical protein B456_006G172400                    175   3e-51   Gossypium raimondii
gb|KHN07218.1|  Expansin-A4                                             174   3e-51   Glycine soja [wild soybean]
gb|KDP20458.1|  hypothetical protein JCGZ_05303                         175   3e-51   Jatropha curcas
gb|AAF32410.1|AF230277_1  alpha-expansin 2                              175   4e-51   Triphysaria versicolor
ref|XP_003552064.1|  PREDICTED: expansin-A4                             174   4e-51   Glycine max [soybeans]
gb|AFK33369.1|  unknown                                                 172   4e-51   Lotus japonicus
gb|KHN17924.1|  Expansin-A3                                             176   4e-51   Glycine soja [wild soybean]
ref|NP_001242978.1|  expansin-A4-like precursor                         174   4e-51   Glycine max [soybeans]
ref|XP_011094866.1|  PREDICTED: expansin-A6                             174   5e-51   Sesamum indicum [beniseed]
ref|XP_004249536.1|  PREDICTED: expansin-A6-like                        174   5e-51   Solanum lycopersicum
ref|XP_006288496.1|  hypothetical protein CARUB_v10001761mg             174   5e-51   Capsella rubella
ref|XP_004302749.1|  PREDICTED: expansin-A6                             174   6e-51   Fragaria vesca subsp. vesca
ref|XP_004173681.1|  PREDICTED: expansin-A4-like                        170   6e-51   
gb|KEH22886.1|  expansin-A1-like protein                                174   6e-51   Medicago truncatula
ref|XP_008233635.1|  PREDICTED: expansin-A4-like                        174   6e-51   Prunus mume [ume]
gb|AAR82850.1|  expansin-2                                              174   7e-51   Petunia x hybrida [garden petunia]
gb|AFK44569.1|  unknown                                                 174   7e-51   Medicago truncatula
gb|KEH30169.1|  expansin A10                                            174   9e-51   Medicago truncatula
ref|XP_003519349.1|  PREDICTED: expansin-A4-like                        174   9e-51   Glycine max [soybeans]
ref|XP_011027216.1|  PREDICTED: expansin-A4                             174   9e-51   Populus euphratica
ref|NP_001236550.1|  expansin precursor                                 174   1e-50   
gb|AAT11859.2|  expansin 1                                              174   1e-50   Mangifera indica
gb|AAM22624.1|AF428177_1  expansin 10 precursor                         174   1e-50   Rumex palustris
ref|XP_008357089.1|  PREDICTED: expansin-A6                             173   1e-50   
ref|XP_009757427.1|  PREDICTED: expansin-A4-like                        173   1e-50   Nicotiana sylvestris
ref|XP_009343581.1|  PREDICTED: expansin-A4-like                        173   1e-50   Pyrus x bretschneideri [bai li]
ref|XP_008457477.1|  PREDICTED: expansin-A4-like                        173   2e-50   Cucumis melo [Oriental melon]
ref|XP_010509297.1|  PREDICTED: expansin-A3-like                        170   2e-50   Camelina sativa [gold-of-pleasure]
emb|CAA59470.1|  orf                                                    173   2e-50   Pisum sativum [garden pea]
ref|XP_008464122.1|  PREDICTED: expansin-A4                             173   2e-50   Cucumis melo [Oriental melon]
ref|XP_008343537.1|  PREDICTED: expansin-A4-like                        173   2e-50   Malus domestica [apple tree]
gb|ACJ48968.2|  expansin                                                172   2e-50   Breonia chinensis
ref|XP_010256907.1|  PREDICTED: expansin-A4                             173   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_003544219.1|  PREDICTED: expansin-A6-like                        172   2e-50   Glycine max [soybeans]
gb|AAR82849.1|  expansin-1                                              172   3e-50   Petunia x hybrida [garden petunia]
gb|AAM22626.1|AF428179_1  expansin 12 precursor                         172   3e-50   Rumex palustris
ref|XP_004154408.1|  PREDICTED: expansin-A4-like                        172   3e-50   
gb|AAM22625.1|AF428178_1  expansin 11 precursor                         172   3e-50   Rumex palustris
ref|XP_007205739.1|  hypothetical protein PRUPE_ppa010180mg             170   3e-50   
ref|XP_006410954.1|  hypothetical protein EUTSA_v10017095mg             172   3e-50   Eutrema salsugineum [saltwater cress]
gb|AAL31477.1|AF319472_1  alpha-expansin 6 precursor                    172   3e-50   Cucumis sativus [cucumbers]
gb|AEN70914.1|  expansin                                                172   4e-50   Gossypium trilobum
ref|XP_002298353.1|  alpha-expansin 1 family protein                    172   4e-50   Populus trichocarpa [western balsam poplar]
ref|XP_007009225.1|  Expansin A4, ALPHA 1.6,EXPA4                       172   4e-50   
ref|XP_007150329.1|  hypothetical protein PHAVU_005G144500g             172   4e-50   Phaseolus vulgaris [French bean]
ref|XP_010517036.1|  PREDICTED: expansin-A3                             172   4e-50   Camelina sativa [gold-of-pleasure]
gb|AEE69071.1|  expansin-4                                              172   4e-50   Petunia hybrid cultivar [hybrid petunia]
gb|ACO07292.1|  expansin 10                                             172   4e-50   Cucumis sativus [cucumbers]
ref|XP_004142066.1|  PREDICTED: expansin-A4-like                        172   4e-50   
ref|XP_007218834.1|  hypothetical protein PRUPE_ppa010198mg             172   5e-50   Prunus persica
ref|XP_011035307.1|  PREDICTED: expansin-A6                             172   5e-50   Populus euphratica
gb|KJB20063.1|  hypothetical protein B456_003G131000                    169   5e-50   Gossypium raimondii
ref|XP_008802710.1|  PREDICTED: expansin-A4                             172   5e-50   Phoenix dactylifera
gb|AEQ55290.1|  expansin                                                172   5e-50   Breonia chinensis
ref|NP_001284471.1|  expansin-A4 precursor                              172   5e-50   Cucumis melo [Oriental melon]
ref|XP_009589397.1|  PREDICTED: expansin-A4-like                        172   5e-50   Nicotiana tomentosiformis
ref|XP_009768238.1|  PREDICTED: expansin-A6-like                        171   7e-50   Nicotiana sylvestris
ref|NP_001234881.1|  expansin9 precursor                                171   7e-50   Solanum lycopersicum
gb|AEQ55275.1|  expansin                                                171   7e-50   Breonia chinensis
gb|AFZ78606.1|  expansin protein                                        171   7e-50   Populus tomentosa [Chinese white poplar]
ref|NP_181300.1|  expansin-A3                                           171   8e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009761115.1|  PREDICTED: expansin-A6-like                        171   8e-50   Nicotiana sylvestris
ref|XP_010505357.1|  PREDICTED: expansin-A3-like                        171   8e-50   Camelina sativa [gold-of-pleasure]
gb|AEN70895.1|  expansin                                                171   8e-50   Gossypium mustelinum
gb|ADY68817.1|  expansin                                                171   9e-50   Gossypium raimondii
gb|ADY68814.1|  expansin                                                171   9e-50   Gossypium barbadense [Egyptian cotton]
ref|XP_009357738.1|  PREDICTED: expansin-A4-like                        171   9e-50   Pyrus x bretschneideri [bai li]
gb|AEN70901.1|  expansin                                                171   1e-49   Gossypium barbadense var. brasiliense
ref|NP_001288899.1|  expansin-A6 precursor                              171   1e-49   Brassica rapa
ref|XP_006409928.1|  hypothetical protein EUTSA_v10017116mg             171   1e-49   Eutrema salsugineum [saltwater cress]
emb|CDY31742.1|  BnaA04g16780D                                          171   1e-49   Brassica napus [oilseed rape]
ref|XP_002283530.1|  PREDICTED: expansin-A4                             171   1e-49   Vitis vinifera
gb|AEN70891.1|  expansin                                                171   1e-49   Gossypium thurberi
gb|AHL25255.1|  expansin                                                171   1e-49   Boehmeria nivea [Chinese silk-plant]
ref|XP_009349313.1|  PREDICTED: expansin-A6-like                        171   1e-49   Pyrus x bretschneideri [bai li]
emb|CBI16120.3|  unnamed protein product                                171   1e-49   Vitis vinifera
ref|XP_009353647.1|  PREDICTED: expansin-A6-like                        171   1e-49   Pyrus x bretschneideri [bai li]
ref|XP_002533097.1|  Alpha-expansin 4 precursor, putative               171   1e-49   Ricinus communis
ref|XP_007205740.1|  hypothetical protein PRUPE_ppa010180mg             171   2e-49   Prunus persica
ref|XP_010106493.1|  hypothetical protein L484_025251                   171   2e-49   Morus notabilis
gb|KFK36651.1|  alpha-expansin 4                                        171   2e-49   Arabis alpina [alpine rockcress]
gb|AEU08407.1|  expansin 2                                              171   2e-49   Prunus salicina [Japanese plum]
gb|AEN70907.1|  expansin                                                170   2e-49   Gossypium armourianum
gb|ADY68815.1|  expansin                                                170   2e-49   Gossypium barbadense [Egyptian cotton]
ref|XP_009597793.1|  PREDICTED: expansin-A6-like                        170   2e-49   Nicotiana tomentosiformis
ref|XP_008223717.1|  PREDICTED: expansin-A4                             170   2e-49   Prunus mume [ume]
emb|CDX77222.1|  BnaC04g40170D                                          170   2e-49   
gb|AEN70893.1|  expansin                                                170   2e-49   Gossypium schwendimanii
gb|AAR09168.1|  alpha-expansin 1                                        170   2e-49   Populus tremula x Populus tremuloides
ref|XP_010528418.1|  PREDICTED: expansin-A3                             170   2e-49   Tarenaya hassleriana [spider flower]
ref|XP_008240857.1|  PREDICTED: expansin-A6-like                        170   3e-49   Prunus mume [ume]
ref|XP_007163413.1|  hypothetical protein PHAVU_001G232600g             170   3e-49   Phaseolus vulgaris [French bean]
ref|XP_004143121.1|  PREDICTED: expansin-A4-like                        170   3e-49   Cucumis sativus [cucumbers]
gb|KJB55836.1|  hypothetical protein B456_009G098800                    170   3e-49   Gossypium raimondii
ref|XP_010920576.1|  PREDICTED: expansin-A4-like                        170   3e-49   Elaeis guineensis
gb|ACK36943.1|  expansin                                                169   4e-49   Annona cherimola [cherimoya]
ref|XP_003547326.1|  PREDICTED: expansin-A4-like                        169   4e-49   Glycine max [soybeans]
gb|AAM47000.1|AF512542_1  alpha-expansin precursor                      169   4e-49   Gossypium hirsutum [American cotton]
gb|KJB73995.1|  hypothetical protein B456_011G266000                    169   4e-49   Gossypium raimondii
gb|ADY68818.1|  expansin                                                169   5e-49   Gossypium hirsutum [American cotton]
ref|XP_006435550.1|  hypothetical protein CICLE_v10032484mg             169   5e-49   Citrus clementina [clementine]
ref|XP_009130690.1|  PREDICTED: expansin-A9-like                        169   5e-49   Brassica rapa
emb|CDX80810.1|  BnaC03g00640D                                          169   5e-49   
ref|XP_011042710.1|  PREDICTED: expansin-A4-like                        169   5e-49   Populus euphratica
ref|XP_008371813.1|  PREDICTED: expansin-A4-like                        169   6e-49   Malus domestica [apple tree]
dbj|BAC67194.1|  expansin                                               169   6e-49   Pyrus communis
gb|AAL31480.1|AF319475_1  alpha-expansin 9 precursor                    169   6e-49   Cucumis sativus [cucumbers]
ref|XP_010423881.1|  PREDICTED: expansin-A9-like                        169   7e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002881524.1|  ATEXPA3                                            169   7e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_010452058.1|  PREDICTED: expansin-A9-like                        169   8e-49   Camelina sativa [gold-of-pleasure]
ref|XP_003543517.1|  PREDICTED: expansin-A4                             169   8e-49   Glycine max [soybeans]
ref|XP_010685747.1|  PREDICTED: expansin-A4                             169   8e-49   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP09064.1|  unnamed protein product                                169   8e-49   Coffea canephora [robusta coffee]
ref|XP_008461679.1|  PREDICTED: expansin-A4                             169   8e-49   Cucumis melo [Oriental melon]
gb|ADC35365.1|  alpha-expansin 2                                        169   9e-49   Coffea arabica [arabica coffee]
ref|XP_010033123.1|  PREDICTED: expansin-A4                             169   9e-49   Eucalyptus grandis [rose gum]
ref|XP_004147685.1|  PREDICTED: expansin-A4-like                        169   9e-49   Cucumis sativus [cucumbers]
gb|AEN70900.1|  expansin                                                168   1e-48   Gossypium tomentosum
gb|ABO32367.1|  expansin                                                168   1e-48   Litchi
gb|KHG20113.1|  Expansin-A4 -like protein                               168   1e-48   Gossypium arboreum [tree cotton]
ref|XP_006429095.1|  hypothetical protein CICLE_v10012518mg             168   1e-48   Citrus clementina [clementine]
gb|AEQ55274.1|  expansin                                                168   1e-48   Breonia chinensis
ref|NP_001288852.1|  expansin-A3 precursor                              168   1e-48   Brassica rapa
emb|CDX74942.1|  BnaA05g06880D                                          168   1e-48   
ref|XP_008384848.1|  PREDICTED: expansin-A4                             168   2e-48   Malus domestica [apple tree]
ref|XP_010922313.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A4-...    168   2e-48   
emb|CDY47883.1|  BnaA07g14280D                                          168   2e-48   Brassica napus [oilseed rape]
ref|XP_002283358.1|  PREDICTED: expansin-A4                             168   2e-48   Vitis vinifera
ref|XP_010043542.1|  PREDICTED: expansin-A4-like                        168   2e-48   Eucalyptus grandis [rose gum]
ref|XP_010521846.1|  PREDICTED: expansin-A6                             167   2e-48   Tarenaya hassleriana [spider flower]
ref|XP_010414459.1|  PREDICTED: expansin-A6-like                        167   2e-48   Camelina sativa [gold-of-pleasure]
gb|ABK93258.1|  unknown                                                 165   2e-48   Populus trichocarpa [western balsam poplar]
gb|KJB78839.1|  hypothetical protein B456_013G022200                    167   3e-48   Gossypium raimondii
ref|XP_010534508.1|  PREDICTED: expansin-A4                             167   3e-48   Tarenaya hassleriana [spider flower]
gb|EYU26594.1|  hypothetical protein MIMGU_mgv1a012061mg                167   3e-48   Erythranthe guttata [common monkey flower]
gb|KJB08889.1|  hypothetical protein B456_001G111100                    167   3e-48   Gossypium raimondii
dbj|BAN09210.1|  alpha expansin                                         167   3e-48   Eustoma exaltatum subsp. russellianum [bluebells]
emb|CDY07642.1|  BnaA03g18690D                                          167   4e-48   Brassica napus [oilseed rape]
ref|XP_006294816.1|  hypothetical protein CARUB_v10023867mg             167   4e-48   Capsella rubella
ref|XP_010690765.1|  PREDICTED: expansin-A4                             167   4e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006480833.1|  PREDICTED: expansin-A4-like                        167   4e-48   Citrus sinensis [apfelsine]
ref|XP_011089478.1|  PREDICTED: expansin-A6                             167   4e-48   Sesamum indicum [beniseed]
gb|KDP44940.1|  hypothetical protein JCGZ_01440                         167   5e-48   Jatropha curcas
ref|XP_002881024.1|  ATEXPA6                                            166   5e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_006411198.1|  hypothetical protein EUTSA_v10017119mg             166   5e-48   Eutrema salsugineum [saltwater cress]
ref|XP_002313434.1|  alpha-expansin 1 family protein                    166   7e-48   Populus trichocarpa [western balsam poplar]
gb|KHG24991.1|  Expansin-A4 -like protein                               166   7e-48   Gossypium arboreum [tree cotton]
ref|XP_010264435.1|  PREDICTED: expansin-A4                             166   7e-48   Nelumbo nucifera [Indian lotus]
ref|XP_006366490.1|  PREDICTED: expansin-A6                             166   7e-48   Solanum tuberosum [potatoes]
ref|XP_010490643.1|  PREDICTED: expansin-A9                             166   7e-48   Camelina sativa [gold-of-pleasure]
gb|AAK48848.1|AF350939_1  expansin                                      166   8e-48   Prunus cerasus [pie cherry]
gb|ACN94264.1|  expansin                                                166   9e-48   Rehmannia glutinosa [Chinese foxglove]
ref|XP_007141864.1|  hypothetical protein PHAVU_008G232200g             166   9e-48   Phaseolus vulgaris [French bean]
ref|XP_004486999.1|  PREDICTED: expansin-A6-like                        166   1e-47   Cicer arietinum [garbanzo]
emb|CAA04385.1|  Expansin                                               166   1e-47   Brassica napus [oilseed rape]
gb|ABO30976.2|  alpha expansin protein 1                                166   1e-47   Calotropis procera
ref|XP_010510558.1|  PREDICTED: expansin-A6                             166   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_002870966.1|  ATEXPA9                                            166   1e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_009122794.1|  PREDICTED: expansin-A9                             166   1e-47   Brassica rapa
ref|XP_010558331.1|  PREDICTED: expansin-A9                             166   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_009124371.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A6        166   1e-47   Brassica rapa
ref|NP_001288961.1|  expansin-A4 precursor                              166   1e-47   Brassica rapa
gb|KFK32246.1|  hypothetical protein AALP_AA6G217100                    165   1e-47   Arabis alpina [alpine rockcress]
ref|NP_001234761.1|  expansin18 precursor                               166   1e-47   
gb|KHN30166.1|  Expansin-A4                                             166   2e-47   Glycine soja [wild soybean]
ref|XP_011077214.1|  PREDICTED: expansin-A6-like                        165   2e-47   Sesamum indicum [beniseed]
ref|XP_009613959.1|  PREDICTED: expansin-A6-like                        165   2e-47   Nicotiana tomentosiformis
emb|CDY10456.1|  BnaCnng03570D                                          165   2e-47   Brassica napus [oilseed rape]
gb|KHG29956.1|  Expansin-A4 -like protein                               165   2e-47   Gossypium arboreum [tree cotton]
gb|KCW65541.1|  hypothetical protein EUGRSUZ_G02938                     165   2e-47   Eucalyptus grandis [rose gum]
gb|AAM62987.1|  expansin AtEx6                                          165   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004145295.1|  PREDICTED: expansin-A4-like                        165   2e-47   
ref|NP_001233958.1|  expansin precursor                                 165   2e-47   Solanum lycopersicum
gb|EYU18981.1|  hypothetical protein MIMGU_mgv1a012125mg                165   2e-47   Erythranthe guttata [common monkey flower]
ref|NP_180461.1|  expansin A6                                           165   2e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDY69611.1|  BnaCnng64440D                                          165   2e-47   Brassica napus [oilseed rape]
ref|XP_008777004.1|  PREDICTED: expansin-A4-like                        165   2e-47   Phoenix dactylifera
ref|NP_001150534.1|  alpha-expansin 6 precursor                         165   2e-47   
ref|XP_006350774.1|  PREDICTED: expansin-A6                             165   3e-47   Solanum tuberosum [potatoes]
ref|XP_009141827.1|  PREDICTED: expansin-A4-like                        165   3e-47   Brassica rapa
ref|XP_008784594.1|  PREDICTED: expansin-A4-like                        165   3e-47   Phoenix dactylifera
emb|CDY07024.1|  BnaA04g22910D                                          165   3e-47   
ref|XP_010532011.1|  PREDICTED: expansin-A4-like                        165   3e-47   Tarenaya hassleriana [spider flower]
ref|XP_010067412.1|  PREDICTED: expansin-A4                             166   4e-47   Eucalyptus grandis [rose gum]
emb|CDY24952.1|  BnaC03g22200D                                          164   4e-47   Brassica napus [oilseed rape]
ref|XP_006398690.1|  hypothetical protein EUTSA_v10014430mg             164   4e-47   Eutrema salsugineum [saltwater cress]
gb|ACT67493.1|  expansin A1                                             164   5e-47   Raphanus sativus
ref|NP_195846.1|  expansin A9                                           164   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006846223.1|  hypothetical protein AMTR_s00012p00230920          164   6e-47   Amborella trichopoda
ref|XP_009409516.1|  PREDICTED: expansin-A6-like                        164   6e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380637.1|  PREDICTED: expansin-A4                             164   7e-47   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP00110.1|  unnamed protein product                                164   7e-47   Coffea canephora [robusta coffee]
ref|XP_002878036.1|  ATEXPA16                                           164   8e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_002266625.1|  PREDICTED: expansin-A6                             163   8e-47   Vitis vinifera
gb|AFW67136.1|  hypothetical protein ZEAMMB73_591538                    160   1e-46   
gb|ACO52788.1|  EXP6                                                    160   1e-46   Brachypodium distachyon [annual false brome]
gb|ACO52804.1|  EXP6                                                    160   1e-46   Brachypodium distachyon [annual false brome]
gb|ACO57092.1|  EXP6                                                    159   1e-46   Brachypodium phoenicoides
ref|XP_010557251.1|  PREDICTED: expansin-A6-like                        163   1e-46   Tarenaya hassleriana [spider flower]
emb|CDY04847.1|  BnaAnng00290D                                          163   1e-46   
gb|ACO52755.1|  EXP6                                                    159   1e-46   Brachypodium distachyon [annual false brome]
gb|ACO52796.1|  EXP6                                                    159   2e-46   Brachypodium distachyon [annual false brome]
gb|ACO52791.1|  EXP6                                                    159   2e-46   Brachypodium distachyon [annual false brome]
emb|CDY48101.1|  BnaC02g03580D                                          163   2e-46   Brassica napus [oilseed rape]
ref|NP_001288956.1|  expansin-A9-like precursor                         162   2e-46   Brassica rapa
gb|AAP48989.1|  expansin                                                162   2e-46   Sambucus nigra
gb|ACA05164.1|  expansin 1                                              162   2e-46   Dimocarpus longan [longan]
ref|XP_004490888.1|  PREDICTED: expansin-A4-like                        162   2e-46   Cicer arietinum [garbanzo]
ref|XP_010111142.1|  hypothetical protein L484_010756                   162   2e-46   Morus notabilis
ref|XP_006424843.1|  hypothetical protein CICLE_v10029094mg             162   2e-46   Citrus clementina [clementine]
ref|XP_006488339.1|  PREDICTED: expansin-A4-like                        162   3e-46   Citrus sinensis [apfelsine]
gb|EPS67093.1|  hypothetical protein M569_07682                         162   3e-46   Genlisea aurea
ref|XP_011031225.1|  PREDICTED: expansin-A4-like                        162   3e-46   Populus euphratica
ref|NP_001288942.1|  expansin-A16 precursor                             162   4e-46   Brassica rapa
ref|XP_006294844.1|  hypothetical protein CARUB_v10023895mg             162   4e-46   Capsella rubella
ref|XP_006294843.1|  hypothetical protein CARUB_v10023894mg             162   4e-46   Capsella rubella
gb|ACO52763.1|  EXP6                                                    158   4e-46   Brachypodium distachyon [annual false brome]
gb|ACF87150.1|  unknown                                                 162   5e-46   Zea mays [maize]
gb|ACO52786.1|  EXP6                                                    158   5e-46   Brachypodium distachyon [annual false brome]
ref|XP_002463623.1|  hypothetical protein SORBIDRAFT_01g003120          161   6e-46   Sorghum bicolor [broomcorn]
emb|CDY20467.1|  BnaC04g05770D                                          161   6e-46   Brassica napus [oilseed rape]
ref|NP_181500.1|  expansin A4                                           161   6e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CAN73252.1|  hypothetical protein VITISV_027049                     160   7e-46   Vitis vinifera
gb|ACO52759.1|  EXP6                                                    157   7e-46   Brachypodium distachyon [annual false brome]
ref|XP_009143296.1|  PREDICTED: expansin-A4-like                        161   7e-46   Brassica rapa
gb|AAV85475.1|  expansin                                                161   7e-46   
gb|ABM66430.1|  expansin 3                                              160   9e-46   
ref|XP_002312101.1|  alpha-expansin 9 precursor family protein          160   1e-45   
gb|ABK93541.1|  unknown                                                 160   1e-45   
gb|KHN33378.1|  Expansin-A4                                             160   1e-45   
gb|ACO52757.1|  EXP6                                                    156   2e-45   
ref|XP_006291698.1|  hypothetical protein CARUB_v10017862mg             160   2e-45   
ref|XP_010427324.1|  PREDICTED: expansin-A16-like                       160   2e-45   
ref|XP_004981242.1|  PREDICTED: expansin-A7-like                        160   2e-45   
ref|XP_010931278.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A7        159   3e-45   
ref|XP_002881669.1|  ATEXPA4                                            159   3e-45   
emb|CDY41218.1|  BnaC08g26400D                                          160   3e-45   
ref|XP_010516124.1|  PREDICTED: expansin-A16                            159   5e-45   
emb|CDY40233.1|  BnaA09g35150D                                          159   5e-45   
gb|AAM62937.1|  Alpha-expansin 4 precursor (At-EXP4) (AtEx4) (Ath...    159   5e-45   
gb|KFK24708.1|  hypothetical protein AALP_AA8G014300                    159   5e-45   
ref|XP_008799850.1|  PREDICTED: expansin-A6-like                        159   5e-45   
ref|XP_009381075.1|  PREDICTED: expansin-A7-like                        159   6e-45   
ref|XP_010505648.1|  PREDICTED: expansin-A4                             158   7e-45   
gb|KJB46593.1|  hypothetical protein B456_007G376300                    159   7e-45   
ref|XP_009409019.1|  PREDICTED: expansin-A4-like                        158   7e-45   
ref|NP_191109.1|  expansin A16                                          158   8e-45   
gb|AAN60246.1|  unknown                                                 156   9e-45   
gb|KFK34799.1|  hypothetical protein AALP_AA5G194700                    158   1e-44   
ref|XP_010937609.1|  PREDICTED: expansin-A4                             158   1e-44   
gb|ABM54492.1|  expansin 2                                              158   1e-44   
ref|XP_010517323.1|  PREDICTED: expansin-A4-like                        158   1e-44   
ref|XP_010508990.1|  PREDICTED: expansin-A4-like                        158   1e-44   
dbj|BAE06067.1|  expansin                                               158   1e-44   
ref|XP_003563572.1|  PREDICTED: expansin-A7                             157   2e-44   
gb|ACO52765.1|  EXP6                                                    154   2e-44   
ref|XP_010504408.1|  PREDICTED: expansin-A16-like                       157   3e-44   
ref|XP_010677870.1|  PREDICTED: expansin-A4-like                        157   3e-44   
gb|ABK24904.1|  unknown                                                 157   4e-44   
ref|XP_011077647.1|  PREDICTED: expansin-A6-like                        156   5e-44   
ref|XP_010554612.1|  PREDICTED: expansin-A4                             156   8e-44   
ref|XP_009388613.1|  PREDICTED: expansin-A7                             155   1e-43   
ref|XP_010111457.1|  hypothetical protein L484_021280                   155   2e-43   
gb|ACO52767.1|  EXP6                                                    151   2e-43   
ref|XP_009139160.1|  PREDICTED: expansin-A16-like                       155   2e-43   
gb|EPS64820.1|  hypothetical protein M569_09956                         155   2e-43   
gb|AAS48878.1|  expansin EXPA9                                          155   2e-43   
gb|ACO52773.1|  EXP6                                                    150   2e-43   
ref|XP_006403453.1|  hypothetical protein EUTSA_v10010989mg             155   2e-43   
ref|XP_009398502.1|  PREDICTED: expansin-A7-like                        154   3e-43   
emb|CDX76090.1|  BnaA04g03540D                                          154   3e-43   
gb|ABN09939.1|  expansin A4                                             154   3e-43   
ref|NP_001051731.1|  Os03g0822000                                       154   5e-43   
ref|XP_006650810.1|  PREDICTED: expansin-A7-like                        154   6e-43   
ref|XP_009419260.1|  PREDICTED: expansin-A7-like                        153   1e-42   
gb|AAQ08016.1|  expansin                                                152   1e-42   
gb|ABN09942.1|  expansin A5                                             152   1e-42   
gb|KJB08890.1|  hypothetical protein B456_001G111100                    153   2e-42   
emb|CDY02943.1|  BnaC04g25430D                                          152   2e-42   
gb|AAL87021.1|  cell wall protein EXP2 precursor                        151   4e-42   
gb|KFK36856.1|  hypothetical protein AALP_AA4G180600                    150   8e-42   
gb|KFK34800.1|  hypothetical protein AALP_AA5G194900                    149   8e-42   
gb|ABN09940.1|  expansin A5                                             150   9e-42   
gb|ACO52780.1|  EXP6                                                    146   1e-41   
ref|XP_004307494.1|  PREDICTED: expansin-A4-like                        149   2e-41   
gb|ACO52764.1|  EXP6                                                    145   4e-41   
gb|ACG46282.1|  alpha-expansin 6 precursor                              149   6e-41   
ref|XP_008458865.1|  PREDICTED: expansin-A4                             148   6e-41   
gb|ABR57427.1|  alpha-expansin 4                                        140   9e-40   
gb|ABR57431.1|  alpha-expansin 4                                        140   1e-39   
ref|XP_004171211.1|  PREDICTED: expansin-A16-like                       144   2e-39   
tpg|DAA52222.1|  TPA: hypothetical protein ZEAMMB73_487280              141   4e-39   
gb|AAN60340.1|  unknown                                                 139   1e-38   
ref|NP_001267685.1|  expansin-A16-like                                  142   1e-38   
gb|ABR57424.1|  alpha-expansin 4                                        137   1e-38   
ref|NP_001185357.1|  expansin A1                                        141   2e-38   
gb|ACO52768.1|  EXP6                                                    138   2e-38   
gb|ACF84785.1|  unknown                                                 142   2e-38   
ref|NP_001117573.1|  expansin A1                                        142   2e-38   
ref|NP_849869.1|  expansin A1                                           142   2e-38   
gb|AAL01624.1|  expansin                                                139   3e-38   
ref|XP_010921302.1|  PREDICTED: expansin-A10-like                       141   3e-38   
ref|NP_177112.1|  expansin A1                                           141   3e-38   
ref|XP_002887242.1|  ATEXPA1                                            141   3e-38   
gb|EPS68567.1|  hypothetical protein M569_06200                         141   3e-38   
ref|XP_010257816.1|  PREDICTED: expansin-A1                             140   4e-38   
ref|XP_010415602.1|  PREDICTED: expansin-A1-like                        140   6e-38   
ref|XP_010470942.1|  PREDICTED: expansin-A1-like                        140   7e-38   
gb|AJR32958.1|  expansin                                                140   7e-38   
ref|XP_010931357.1|  PREDICTED: expansin-A4-like                        140   1e-37   
gb|EYU19913.1|  hypothetical protein MIMGU_mgv1a012177mg                140   1e-37   
gb|KDP27163.1|  hypothetical protein JCGZ_19862                         139   1e-37   
gb|ACZ57921.1|  expansin protein 1                                      139   2e-37   
ref|XP_010044491.1|  PREDICTED: expansin-A1-like                        139   2e-37   
gb|KDP20276.1|  hypothetical protein JCGZ_06862                         139   2e-37   
emb|CDY71146.1|  BnaCnng71550D                                          139   2e-37   
ref|XP_008354429.1|  PREDICTED: expansin-A4-like                        139   3e-37   
emb|CDY44069.1|  BnaA02g14330D                                          136   3e-37   
ref|XP_010258310.1|  PREDICTED: expansin-A1 isoform X1                  138   3e-37   
gb|AFK34543.1|  unknown                                                 138   4e-37   
ref|XP_010257730.1|  PREDICTED: expansin-A15-like                       138   5e-37   
ref|XP_003607738.1|  Expansin                                           139   5e-37   
ref|XP_010258311.1|  PREDICTED: expansin-A1 isoform X2                  138   5e-37   
ref|XP_009376282.1|  PREDICTED: expansin-A10-like isoform X2            138   6e-37   
ref|NP_001289251.1|  expansin-A4-like precursor                         138   6e-37   
ref|XP_010108480.1|  hypothetical protein L484_010673                   138   6e-37   
gb|AAB38070.1|  expansin At-EXPA1                                       137   7e-37   
emb|CAH18934.1|  expansin                                               137   7e-37   
gb|ACO52766.1|  EXP6                                                    134   8e-37   
ref|XP_006302737.1|  hypothetical protein CARUB_v10020849mg             137   1e-36   
ref|XP_009376281.1|  PREDICTED: expansin-A10-like isoform X1            138   1e-36   
ref|XP_002525458.1|  Alpha-expansin 15 precursor, putative              137   1e-36   
ref|XP_010511994.1|  PREDICTED: expansin-A1                             137   1e-36   
ref|XP_008391992.1|  PREDICTED: expansin-A6-like                        134   2e-36   
gb|AAL87023.1|  cell wall protein Exp4 precursor                        137   2e-36   
gb|KEH35550.1|  expansin A10                                            137   2e-36   
gb|AAO49058.1|  alpha-expansin                                          133   2e-36   
emb|CDY44070.1|  BnaA02g14340D                                          136   2e-36   
ref|XP_008221599.1|  PREDICTED: expansin-A1                             136   2e-36   
ref|XP_007046062.1|  Expansin A1, ALPHA 1.2,EXPA1                       140   2e-36   
ref|XP_004135171.1|  PREDICTED: expansin-A1-like                        136   3e-36   
ref|XP_006435913.1|  hypothetical protein CICLE_v10032524mg             136   3e-36   
ref|XP_004155305.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A1-...    136   3e-36   
ref|NP_001275780.1|  expansin 2 precursor                               136   3e-36   
gb|KHG18125.1|  Expansin-A10 -like protein                              136   3e-36   
gb|KEH35551.1|  expansin A10                                            136   3e-36   
gb|AFK38068.1|  unknown                                                 136   3e-36   
emb|CDP00351.1|  unnamed protein product                                137   4e-36   
gb|EYU28773.1|  hypothetical protein MIMGU_mgv1a012521mg                135   4e-36   
ref|XP_006291657.1|  hypothetical protein CARUB_v10017813mg             136   4e-36   
ref|XP_008446373.1|  PREDICTED: expansin-A1                             135   4e-36   
ref|XP_010502317.1|  PREDICTED: expansin-A15                            135   4e-36   
gb|ADN03964.1|  EXP1                                                    135   4e-36   
ref|XP_004294932.1|  PREDICTED: expansin-A1-like                        135   4e-36   
gb|ABR17119.1|  unknown                                                 135   5e-36   
ref|XP_006429564.1|  hypothetical protein CICLE_v10013804mg             135   5e-36   
gb|KJB80218.1|  hypothetical protein B456_013G086900                    135   5e-36   
dbj|BAJ10397.1|  alpha-expansin                                         135   6e-36   
ref|XP_010910535.1|  PREDICTED: expansin-A1-like                        135   6e-36   
ref|XP_010651411.1|  PREDICTED: expansin-A10                            135   6e-36   
gb|ABO32366.1|  expansin                                                135   6e-36   
gb|AAG13983.1|AF297522_1  expansin 2                                    135   7e-36   
ref|NP_001288866.1|  expansin-A1 precursor                              135   7e-36   
gb|KDO49685.1|  hypothetical protein CISIN_1g025193mg                   135   7e-36   
ref|XP_002514740.1|  Alpha-expansin 15 precursor, putative              135   8e-36   
emb|CDY40938.1|  BnaC06g30760D                                          135   8e-36   
ref|XP_006391003.1|  hypothetical protein EUTSA_v10019043mg             135   8e-36   
gb|AGR44460.1|  expansin 8                                              133   9e-36   
ref|XP_002963702.1|  hypothetical protein SELMODRAFT_230202             135   9e-36   
ref|XP_010425091.1|  PREDICTED: expansin-A15-like                       135   9e-36   
gb|AEQ28765.1|  expansin 3                                              135   9e-36   
ref|XP_010276443.1|  PREDICTED: expansin-A15-like                       134   9e-36   
gb|ABR57477.1|  alpha-expansin 6                                        131   1e-35   
gb|AAY59532.1|  expansin                                                134   1e-35   
gb|AAL40354.1|AF448467_1  alpha-expansin                                134   1e-35   
ref|XP_010103644.1|  hypothetical protein L484_011237                   134   1e-35   
gb|AEQ55281.1|  expansin                                                134   1e-35   
gb|KCW65774.1|  hypothetical protein EUGRSUZ_G03134                     134   1e-35   
gb|ABM66452.1|  expansin                                                134   1e-35   
ref|XP_006477470.1|  PREDICTED: expansin-A1-like                        135   1e-35   
gb|ABR57472.1|  alpha-expansin 6                                        131   1e-35   
ref|XP_007037392.1|  Expansin A1, ALPHA 1.2,EXPA1                       135   1e-35   
ref|XP_006440617.1|  hypothetical protein CICLE_v10021897mg             134   2e-35   
emb|CDY24897.1|  BnaC03g22750D                                          134   2e-35   
gb|ABR57476.1|  alpha-expansin 6                                        131   2e-35   
ref|XP_007158645.1|  hypothetical protein PHAVU_002G170300g             135   2e-35   
ref|XP_003529476.1|  PREDICTED: expansin-A15-like                       134   2e-35   
gb|AAL87024.1|  cell wall protein Exp5                                  132   2e-35   
ref|XP_010917068.1|  PREDICTED: expansin-A10-like                       134   2e-35   
ref|XP_008242138.1|  PREDICTED: expansin-A8-like                        134   2e-35   
ref|XP_003544930.1|  PREDICTED: expansin-A8                             134   2e-35   
ref|XP_007205762.1|  hypothetical protein PRUPE_ppa010314mg             134   2e-35   
gb|AAG13982.1|AF297521_1  expansin 1                                    134   2e-35   
gb|AAC33529.1|  expansin                                                134   2e-35   
ref|XP_001761996.1|  predicted protein                                  134   3e-35   
gb|KJB30414.1|  hypothetical protein B456_005G142200                    133   3e-35   
gb|ABR57473.1|  alpha-expansin 6                                        130   3e-35   
gb|ABR57471.1|  alpha-expansin 6                                        130   3e-35   
gb|AAM08930.1|  expansin 1                                              133   3e-35   
emb|CAC18802.1|  expansin                                               131   3e-35   
ref|NP_001281040.1|  expansin-A4-like precursor                         133   3e-35   
gb|KJB50945.1|  hypothetical protein B456_008G194200                    133   3e-35   
ref|NP_178409.2|  expansin A15                                          133   3e-35   
ref|XP_007209512.1|  hypothetical protein PRUPE_ppa010443mg             133   3e-35   
gb|KFK33492.1|  hypothetical protein AALP_AA5G020100                    133   3e-35   
ref|XP_011013147.1|  PREDICTED: expansin-A1                             133   3e-35   
ref|XP_011075523.1|  PREDICTED: expansin-A10                            133   4e-35   
emb|CDP12277.1|  unnamed protein product                                133   4e-35   
ref|XP_009374380.1|  PREDICTED: expansin-A4-like                        133   4e-35   
gb|ACM90161.1|  expansin 3                                              133   4e-35   
gb|EAY89910.1|  hypothetical protein OsI_11459                          133   4e-35   
ref|XP_007209805.1|  hypothetical protein PRUPE_ppa014051mg             128   4e-35   
ref|XP_004307732.1|  PREDICTED: expansin-A10                            133   4e-35   
ref|XP_008239926.1|  PREDICTED: expansin-A1-like                        133   4e-35   
ref|XP_002319704.2|  expansin S1 precursor family protein               132   4e-35   
gb|ACK43222.1|  expansin 2                                              133   4e-35   
ref|XP_007030212.1|  Alpha-expansin 1 precursor                         134   4e-35   
ref|XP_007215892.1|  hypothetical protein PRUPE_ppa010654mg             132   4e-35   
ref|XP_006829796.1|  hypothetical protein AMTR_s00119p00058870          133   4e-35   
ref|NP_001240136.1|  expansin-A1-like precursor                         133   5e-35   
ref|XP_007226005.1|  hypothetical protein PRUPE_ppa010379mg             133   5e-35   
ref|XP_002523388.1|  Alpha-expansin 1 precursor, putative               132   5e-35   
gb|KDP41217.1|  hypothetical protein JCGZ_15624                         133   5e-35   
emb|CBI15823.3|  unnamed protein product                                132   5e-35   
gb|AAL87020.1|  cell wall protein EXP6 precursor                        129   5e-35   
gb|AFK36148.1|  unknown                                                 132   5e-35   
gb|AHL25252.1|  expansin                                                133   5e-35   
gb|ABA62612.1|  expansin                                                133   5e-35   
gb|AEQ55273.1|  expansin                                                132   5e-35   
gb|AFQ21787.1|  EXP4 protein                                            133   5e-35   
ref|XP_002974792.1|  hypothetical protein SELMODRAFT_102164             133   5e-35   
gb|KHG01029.1|  Expansin-A15 -like protein                              132   5e-35   
ref|XP_004297292.1|  PREDICTED: expansin-A1                             132   5e-35   
ref|XP_008792215.1|  PREDICTED: expansin-A8-like                        133   5e-35   
gb|ABR57478.1|  alpha-expansin 6                                        130   5e-35   
emb|CDY03019.1|  BnaC07g22080D                                          132   5e-35   
ref|XP_008230781.1|  PREDICTED: expansin-A15                            132   6e-35   
gb|AFK24458.1|  expansin 5                                              132   6e-35   
gb|KHG28809.1|  Expansin-A5 -like protein                               132   6e-35   
ref|XP_009360325.1|  PREDICTED: expansin-A1                             132   6e-35   
gb|AAC32927.1|  putative expansin                                       132   6e-35   
dbj|BAC67192.1|  expansin                                               132   7e-35   
gb|KFK42332.1|  hypothetical protein AALP_AA2G242600                    132   7e-35   
ref|XP_007142047.1|  hypothetical protein PHAVU_008G248000g             132   7e-35   
ref|XP_008797331.1|  PREDICTED: expansin-A15-like                       132   7e-35   
ref|XP_002276565.3|  PREDICTED: expansin-A4                             132   7e-35   



>dbj|BAO57279.1| alpha-expansin [Ipomoea nil]
Length=257

 Score =   227 bits (578),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/114 (99%), Positives = 113/114 (99%), Gaps = 0/114 (0%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGA GYGNLYS
Sbjct  1    MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNF  433
            QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNF
Sbjct  61   QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNF  114



>ref|NP_001234081.1| expansin A4 precursor [Solanum lycopersicum]
 gb|AAD13632.1| expansin precursor [Solanum lycopersicum]
Length=263

 Score =   188 bits (477),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 104/118 (88%), Gaps = 3/118 (3%)
 Frame = +2

Query  89   KMAAVRVL--CIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGN  262
            KMAA  +L   I +LLC LTAV+ARIPGVY+GG WQTAHATFYGG+DASGTMGGA GYGN
Sbjct  3    KMAANMMLYITITVLLCFLTAVNARIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGN  62

Query  263  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            LYSQGYGVNNAALST LFNNGLSCGACFE+KC ND + C PGNPSIFVTATNFCPPNF
Sbjct  63   LYSQGYGVNNAALSTVLFNNGLSCGACFELKCDNDGKWCLPGNPSIFVTATNFCPPNF  120



>ref|XP_006341021.1| PREDICTED: expansin-A3 [Solanum tuberosum]
Length=263

 Score =   187 bits (476),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 104/118 (88%), Gaps = 3/118 (3%)
 Frame = +2

Query  89   KMAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGN  262
            KMAA  +L I   +LLC LTAV+ARIPGVY+GG WQ+AHATFYGG+DASGTMGGA GYGN
Sbjct  3    KMAATMMLYITTTILLCFLTAVNARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGN  62

Query  263  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            LYSQGYGVNNAALST LFNNGLSCGACFE+KC ND + C PGNPSIFVTATNFCPPNF
Sbjct  63   LYSQGYGVNNAALSTVLFNNGLSCGACFELKCDNDGKWCLPGNPSIFVTATNFCPPNF  120



>ref|XP_009788740.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=259

 Score =   187 bits (474),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIA-LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA  ++LCIA  LLC LTAV+A+IPGVY+GG WQ AHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MAVTKILCIAATLLCFLTAVNAKIPGVYTGGPWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVNNAALST LFNNGLSCGACFEIKC +D + C PGNPSIFVTATNFCPPNF
Sbjct  61   SQGYGVNNAALSTVLFNNGLSCGACFEIKCVDDGKWCLPGNPSIFVTATNFCPPNF  116



>gb|AEQ55271.1| expansin [Breonia chinensis]
 gb|AEQ55286.1| expansin [Breonia chinensis]
Length=258

 Score =   186 bits (473),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 102/115 (89%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA V +LCIA LLC LT V+ARIPGVYSGG WQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAQVGLLCIATLLCFLTVVNARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN  ALSTALFNNGLSCGACFE+KC+N  + C PGNPSIF+TATNFCPPNF
Sbjct  61   QGYGVNTGALSTALFNNGLSCGACFELKCANAPKWCLPGNPSIFITATNFCPPNF  115



>ref|XP_008387765.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=258

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 100/115 (87%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA +R+LCIA LL    A  ARIPGVY+GGAW+ AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAFLRMLCIASLLSLFMAABARIPGVYTGGAWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC +D R C PGNPSIFVTATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSIFVTATNFCPPNF  115



>ref|XP_009587747.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=259

 Score =   185 bits (470),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            M   ++LCI   LLC LTAV+A+IPGVY+GG WQ AHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MVVTKILCITTTLLCFLTAVNAKIPGVYTGGPWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKC-SNDRSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVNNAALST LFNNGLSCGACFEIKC  +D+ C PGNPSIFVTATNFCPPNF
Sbjct  61   SQGYGVNNAALSTVLFNNGLSCGACFEIKCVDDDKWCLPGNPSIFVTATNFCPPNF  116



>ref|XP_009772489.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=257

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA +  LCIA LL  LTA +A++PGVY+GG WQ+AHATFYGG DASGTMGGA GYGNLYS
Sbjct  1    MAIIWTLCIASLLSLLTAANAKVPGVYTGGPWQSAHATFYGGEDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNF  433
             GYGVNNAALSTALFNNGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNY  114



>dbj|BAC67193.1| expansin [Pyrus communis]
Length=258

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 99/115 (86%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA++RVL IA +L    A +ARIPGVY+GG+W+ AHATFYGG DASGTMGGA GYGNLYS
Sbjct  1    MASLRVLYIAFMLSLFMAANARIPGVYTGGSWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC +D R C PGNPSI VTATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNF  115



>gb|KJB76740.1| hypothetical protein B456_012G104400 [Gossypium raimondii]
Length=264

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  95   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQ  274
            +++ +LC A L+C    V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGA GYGNLYSQ
Sbjct  8    SSLTLLCFASLMCLFGMVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  67

Query  275  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            GYGVN AALSTALFNNGLSCGACFEIKC++D R C PGNPSIF+TATNFCPPN+
Sbjct  68   GYGVNTAALSTALFNNGLSCGACFEIKCTDDPRWCHPGNPSIFITATNFCPPNY  121



>emb|CDP06606.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA +  LCIA LLC LT V+AR+PG YSGG WQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAQMCPLCIAALLCFLTVVNARLPGAYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFN+GLSCGACFE+KC++D + C PG+PSIF+TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNDGLSCGACFELKCADDPKWCLPGSPSIFITATNFCPPNF  115



>ref|XP_003537990.1| PREDICTED: expansin-A4-like [Glycine max]
Length=259

 Score =   180 bits (457),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +2

Query  98   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQG  277
            A  VLCIA ++    AV ARIPG+YSGGAWQ+AHATFYGG+DASGTMGGA GYGNLYSQG
Sbjct  4    ANNVLCIAFIITLTWAVEARIPGIYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQG  63

Query  278  YGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            YGVN AALSTALFN+GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNF
Sbjct  64   YGVNTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNF  116



>gb|KHG12430.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 102/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  95   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQ  274
            +++ +LC A L+C    V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGA GYGNLYSQ
Sbjct  8    SSLTLLCFASLMCLFGMVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  67

Query  275  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            GYGVN AALSTA+FNNGLSCGACFEIKC++D R C PGNPSIF+TATNFCPPN+
Sbjct  68   GYGVNTAALSTAIFNNGLSCGACFEIKCTDDPRWCHPGNPSIFITATNFCPPNY  121



>ref|XP_007016396.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY34015.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=258

 Score =   179 bits (455),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA V V+C+ L + S+    A+IPGVYSGGAWQ AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAVVSVVCVLLFISSMWMAEAKIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G PSIF+TATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANDPKWCHSGGPSIFITATNFCPPNY  115



>ref|XP_004505858.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   179 bits (455),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 98/111 (88%), Gaps = 1/111 (1%)
 Frame = +2

Query  104  RVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            ++L IA ++ S+  V ARIPG+YSGG WQTAHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  4    KILYIAFIISSMWIVEARIPGLYSGGQWQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  63

Query  284  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            VN AALSTALFNNGLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNF
Sbjct  64   VNTAALSTALFNNGLSCGACFEIKCANDREWCHSGSPSIFITATNFCPPNF  114



>gb|KHN21950.1| Expansin-A4 [Glycine soja]
Length=299

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +2

Query  95   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQ  274
             A  VLCIA ++    AV ARIPG+YSGGAWQ+AHATFYGG+DASGTMGGA GYGNLYSQ
Sbjct  3    VANNVLCIAFIITLTWAVEARIPGIYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQ  62

Query  275  GYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            GYGVN AALSTALFN+GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNF
Sbjct  63   GYGVNTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNF  116



>ref|XP_011019858.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=260

 Score =   179 bits (455),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 1/110 (1%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            +LCI  L+      HARIPGV++GG W++AHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  8    LLCIVFLISVFVLAHARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  287  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            N AALSTALFNNGLSCGACFEIKC++D R C+PGNPSIFVTATNFCPPNF
Sbjct  68   NTAALSTALFNNGLSCGACFEIKCADDPRWCNPGNPSIFVTATNFCPPNF  117



>ref|XP_007027012.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY07514.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=263

 Score =   179 bits (455),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 101/114 (89%), Gaps = 1/114 (1%)
 Frame = +2

Query  95   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQ  274
            +++ VLC A LL     V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGA GYGNLYSQ
Sbjct  7    SSLTVLCFASLLSFSVVVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  66

Query  275  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            GYGVN AALSTALFNNGLSCGACFEIKC+ND R C PG+PSIFVTATNFCPPN+
Sbjct  67   GYGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHPGSPSIFVTATNFCPPNY  120



>gb|AIE54285.1| expansin [Nicotiana tabacum]
Length=257

 Score =   179 bits (455),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA +  LCIA LL  LT  +A++PGVY+ G W++AHATFYGGADASGTMGGA GYGNLYS
Sbjct  1    MAIIWTLCIASLLSFLTGANAKVPGVYTSGPWESAHATFYGGADASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNF  433
             GYGVNNAALSTALFNNGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNY  114



>ref|XP_004249634.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
Length=259

 Score =   179 bits (455),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA    LCIA LLC LT V+A+I GVY+GG W +AHATFYGGADASGTMGGA GYGNLYS
Sbjct  1    MAVNWALCIATLLCFLTVVNAKIAGVYTGGPWTSAHATFYGGADASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS--CSPGNPSIFVTATNFCPPNF  433
            QGYGVNNAALSTALFNNGLSCGACFEIKC++ +   C+PGNPSI VT TNFCPPN+
Sbjct  61   QGYGVNNAALSTALFNNGLSCGACFEIKCTDSKKEYCNPGNPSILVTGTNFCPPNY  116



>ref|XP_009610453.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=257

 Score =   179 bits (454),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA +  LCIA LL  LT  +A++PGVY+ G W++AHATFYGGADASGTMGGA GYGNLYS
Sbjct  1    MAIIWTLCIASLLSFLTGANAKVPGVYTSGPWESAHATFYGGADASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNF  433
             GYGVNNAALSTALFNNGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNY  114



>gb|ACU17873.1| unknown [Glycine max]
Length=160

 Score =   176 bits (446),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA+  + IA L+    A  ARIPGVY+GG WQ+ HATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAAIVFIHIASLVSLFVATSARIPGVYTGGPWQSVHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PGNPSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGNPSILITATNFCPPNF  115



>ref|XP_009341751.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=258

 Score =   179 bits (454),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA++RVL IA +L    A +ARIPGVY+GG W+ AHATFYGG DASGTMGGA GYGNLYS
Sbjct  1    MASLRVLYIAFMLSLFMAANARIPGVYTGGPWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFE+KC +D R C PGNPSI VTATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCGDDPRWCHPGNPSILVTATNFCPPNF  115



>gb|KDP35637.1| hypothetical protein JCGZ_09075 [Jatropha curcas]
Length=258

 Score =   179 bits (453),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA + VLCI  L      V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MANLDVLCIISLFSLFWVVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC++D + C+PG+PSIF+TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPKWCNPGSPSIFITATNFCPPNF  115



>emb|CAH18933.1| expansin [Pyrus communis]
Length=258

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA++RVL IA +L      +ARIPGVY+GG W+ AHATFYGG DASGTMGGA GYGNLYS
Sbjct  1    MASLRVLYIAFMLSLFMEANARIPGVYTGGPWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC +D R C PGNPSI VTATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNF  115



>ref|XP_007205748.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
 gb|EMJ06947.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
Length=258

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 99/115 (86%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA V +LCIA LL    A +ARIPGVY+GG W+ AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAFVHMLCIASLLSLFMAANARIPGVYTGGPWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            +GYGVN AALSTALFNNGLSCGACFEIKC +D + C PGNPSIF+TATNFCPPN+
Sbjct  61   EGYGVNTAALSTALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNY  115



>ref|XP_004300427.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=259

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA   + CIA LL SLT++  ARIPGVYSGGAWQ AHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MAMASLACIAALLISLTSITEARIPGVYSGGAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            SQGYGV+ AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNF
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNF  116



>dbj|BAH36862.1| alpha expansin [Rosa hybrid cultivar]
Length=258

 Score =   177 bits (450),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA++ +LCIA L   L   +ARIPG Y+GG WQ AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MASLHLLCIASLASLLILANARIPGPYTGGPWQDAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEI+C +D R C+PG PSIFVTATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIRCGDDPRWCTPGKPSIFVTATNFCPPNF  115



>ref|XP_007140533.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
 gb|ESW12527.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
Length=258

 Score =   177 bits (449),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA+  L IA L     +  ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAAIVFLYIASLASLFVSTSARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PGNPSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGNPSILITATNFCPPNF  115



>gb|ACU17612.1| unknown [Glycine max]
Length=165

 Score =   174 bits (441),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA+  L IA L     A  ARIPGVY+GG WQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAAIVFLHIASLASLFVATSARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG+PSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSILITATNFCPPNF  115



>ref|XP_002315218.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEF01389.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   177 bits (448),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA    +C+A L+  LT V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAIRATICVASLVLFLTLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC ND + C  G+PSI +TATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNY  115



>ref|XP_009787901.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=293

 Score =   177 bits (450),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
             LCIA +LC LT+V+A+I G Y+GG W TAHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  7    TLCIASVLCFLTSVNAKISGNYAGGPWTTAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  287  NNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNF  433
            NNAALST LFNNGLSCGACFE+KC++ + C+PGNPSI VTATNFCPPN+
Sbjct  67   NNAALSTVLFNNGLSCGACFELKCTDQKWCTPGNPSILVTATNFCPPNY  115



>ref|XP_006349505.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=259

 Score =   177 bits (448),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA    LCIA LLC LT V+A+I GVY+GG+W +AHATFYGGADASGTMGGA GYGNLYS
Sbjct  1    MAVNWALCIASLLCFLTVVNAKIVGVYTGGSWTSAHATFYGGADASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS--CSPGNPSIFVTATNFCPPNF  433
            QGYGVNNAALSTALFN+GLSCG+CFEIKC++ +   C+PGNPSI VT TNFCPPN+
Sbjct  61   QGYGVNNAALSTALFNSGLSCGSCFEIKCTDSKKEYCNPGNPSILVTGTNFCPPNY  116



>ref|XP_004492358.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=258

 Score =   176 bits (447),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA  +L IA L     A  ARIPG YSGG WQTAHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAATVLLSIASLASLFVATTARIPGFYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCG+CFEIKC  D R C+PGNPSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFEIKCDQDPRWCNPGNPSILITATNFCPPNF  115



>gb|AFK34565.1| unknown [Medicago truncatula]
Length=191

 Score =   174 bits (441),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNF
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNF  117



>gb|EYU41729.1| hypothetical protein MIMGU_mgv1a012073mg [Erythranthe guttata]
Length=262

 Score =   176 bits (447),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 97/112 (87%), Gaps = 3/112 (3%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            +LC A +LC LT+  ARIPGVY+GG W+TAHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  8    LLCFATVLCFLTSAQARIPGVYAGGPWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  287  NNAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPNF  433
            N AALSTALFNNGLSCGACFEIKC    + + C+PG+PSI VTATNFCPPNF
Sbjct  68   NTAALSTALFNNGLSCGACFEIKCDAAQDSKWCNPGSPSILVTATNFCPPNF  119



>ref|XP_002309061.1| expansin family protein [Populus trichocarpa]
 gb|ABK94860.1| unknown [Populus trichocarpa]
 gb|EEE92584.1| expansin family protein [Populus trichocarpa]
Length=260

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            +LCI  L       HARIPGV++GG W++AHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  8    LLCIVFLTSVFVLAHARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  287  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            N AALSTALFNNGLSCGACFEIKC++D R C+PGNPSI VTATNFCPPNF
Sbjct  68   NTAALSTALFNNGLSCGACFEIKCADDPRWCNPGNPSILVTATNFCPPNF  117



>ref|XP_006339024.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=257

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA   +LCIA LL  LT V +++ GVY+ G WQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAITWMLCIASLLSFLTTVDSKVRGVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNF  433
             GYGVNNAALST LFN+GLSCGACFEIKC++++ C+PGNPSIFVT TNFCPPN+
Sbjct  61   TGYGVNNAALSTVLFNSGLSCGACFEIKCTDEKWCNPGNPSIFVTGTNFCPPNY  114



>gb|AFB77223.1| expansin 1 [Betula platyphylla]
Length=258

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 99/115 (86%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA+ V CI  L+  LT V A+IPGVYSGGAWQ+AHATFYGG DASGTMGGA GYGNLYS
Sbjct  1    MAALCVACIVSLMALLTLVDAKIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSI +TATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSILITATNFCPPNY  115



>ref|XP_009364387.1| PREDICTED: expansin-A4 [Pyrus x bretschneideri]
Length=260

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 98/117 (84%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            M  V V  CIA LL SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MGVVSVSTCIATLLISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN  ALSTALFNNGLSCGACFEIKCSND R C  G+PSIF+TATNFCPPNF
Sbjct  61   YSQGYGVNTGALSTALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNF  117



>ref|XP_003597354.1| Cell wall protein Exp5 [Medicago truncatula]
Length=180

 Score =   173 bits (439),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNF
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNF  117



>gb|KHG30766.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=262

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +2

Query  98   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQG  277
            ++ +LC   LL   T+V+ARIPGV+S G+W+TAHATFYGG+DASGTMGGA GYGNLYSQG
Sbjct  7    SLTLLCFTSLLPFFTSVNARIPGVFSTGSWETAHATFYGGSDASGTMGGACGYGNLYSQG  66

Query  278  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSIFVTATNFCPPNF
Sbjct  67   YGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNF  119



>ref|XP_003552923.2| PREDICTED: expansin-A3-like [Glycine max]
Length=262

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 99/115 (86%), Gaps = 3/115 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA + ++ I  LL  LT  HA+IPGVYSGG WQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  7    MAMLNIISILSLL--LTQSHAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  64

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C+PGNPSI VTATNFCPPN+
Sbjct  65   QGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCNPGNPSILVTATNFCPPNY  119



>gb|KJB16930.1| hypothetical protein B456_002G257400 [Gossypium raimondii]
Length=264

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 97/110 (88%), Gaps = 1/110 (1%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            +L +A L      V+ARIPGVY+GG+W+TAHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  12   MLHLASLFSIFVLVNARIPGVYTGGSWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  71

Query  287  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            N AALSTALFNNGLSCGACFEIKC+ND R C PG+PSIF+TATNFCPPNF
Sbjct  72   NTAALSTALFNNGLSCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNF  121



>ref|XP_007132063.1| hypothetical protein PHAVU_011G063800g [Phaseolus vulgaris]
 gb|ESW04057.1| hypothetical protein PHAVU_011G063800g [Phaseolus vulgaris]
Length=259

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = +2

Query  110  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVN  289
            LCIA ++     V ARIPG+YSGGAW++AHATFYGG+DASGTMGGA GYGNLYSQGYGVN
Sbjct  8    LCIAFVISLTWMVEARIPGIYSGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  67

Query  290  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
             AALSTALFNNGLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPN+
Sbjct  68   TAALSTALFNNGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNY  116



>gb|AFK40565.1| unknown [Medicago truncatula]
Length=231

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNF
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNF  117



>ref|XP_003538409.1| PREDICTED: expansin-A6 [Glycine max]
Length=258

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA + ++ I  LL  +    A+IPGVYSGG WQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAMLNIIAIVSLLLLMIPSQAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C PGNPSIFVTATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNY  115



>ref|XP_007133996.1| hypothetical protein PHAVU_010G010200g [Phaseolus vulgaris]
 gb|ESW05990.1| hypothetical protein PHAVU_010G010200g [Phaseolus vulgaris]
Length=258

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA +  LCIA  +    A +ARIPGVY+GGAWQ AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAEMLSLCIASFVTLFVATNARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG PSI +TATNFCPPN 
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGRPSIIITATNFCPPNL  115



>ref|XP_003552173.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA+  L IA L     A  ARIPGVY+GG WQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAAIVFLHIASLASLFVATSARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG+PSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSILITATNFCPPNF  115



>gb|KJB46592.1| hypothetical protein B456_007G376300 [Gossypium raimondii]
Length=262

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +2

Query  98   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQG  277
            ++ +LC   LL   T+V+A+IPGVYS G+W+TAHATFYGG+DASGTMGGA GYGNLYSQG
Sbjct  7    SLALLCFTSLLPFFTSVNAKIPGVYSTGSWETAHATFYGGSDASGTMGGACGYGNLYSQG  66

Query  278  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSIFVTATNFCPPNF
Sbjct  67   YGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNF  119



>ref|XP_009607348.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=293

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
             L IA +LC LTAV+A+I G Y+GG W TAHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  7    TLYIASVLCFLTAVNAKISGNYAGGPWTTAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  287  NNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNF  433
            NNAALST LFNNGLSCGACFE+KC++ + C+PGNPSI VTATNFCPPNF
Sbjct  67   NNAALSTVLFNNGLSCGACFELKCTDQKWCTPGNPSILVTATNFCPPNF  115



>gb|KEH39447.1| expansin A10 [Medicago truncatula]
Length=260

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNF
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNF  117



>gb|KHG15821.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 99/113 (88%), Gaps = 1/113 (1%)
 Frame = +2

Query  98   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQG  277
            ++ VLC A LL  L  V+ARIPGV++GGAW++AHATFYGG+DASGTMGGA GYGNLYSQG
Sbjct  9    SLSVLCFASLLSFLAVVNARIPGVFTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  278  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YGVN AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPN+
Sbjct  69   YGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNY  121



>ref|XP_003616412.1| Expansin [Medicago truncatula]
 gb|AES99370.1| expansin A10 [Medicago truncatula]
Length=259

 Score =   175 bits (443),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            M  + +  I + L   LT+  AR+PGVYSGGAWQTAHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MTKLNITTIFSFLALLLTSTEARLPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNGLSCG+CFE+KCSND S C PG+PSI VTATNFCPPNF
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGSCFELKCSNDPSWCHPGSPSILVTATNFCPPNF  116



>gb|KJB36710.1| hypothetical protein B456_006G172400 [Gossypium raimondii]
Length=264

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 1/113 (1%)
 Frame = +2

Query  98   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQG  277
            ++ VLC A LL  L  V+ARIPGVY+GGAW++AHATFYGG+DASGTMGGA GYGNLYSQG
Sbjct  9    SLSVLCFASLLSFLAVVNARIPGVYTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  278  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YGVN AALSTALFNNGLSCG CFEIKC+ND R C  G+PSI +TATNFCPPN+
Sbjct  69   YGVNTAALSTALFNNGLSCGGCFEIKCANDPRWCHSGSPSIIITATNFCPPNY  121



>gb|KHN07218.1| Expansin-A4 [Glycine soja]
Length=246

 Score =   174 bits (442),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA +  LCIA L+    A  ARIPGV++GGAWQ AHATFYGG DASGTMGGA GYGNLYS
Sbjct  1    MAGMVPLCIASLVTLFVATSARIPGVFNGGAWQGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG+PSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSIVITATNFCPPNF  115



>gb|KDP20458.1| hypothetical protein JCGZ_05303 [Jatropha curcas]
Length=260

 Score =   175 bits (443),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV--HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            MA VR+L +A ++ SL  V   ARIPG Y GGAWQTAHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MAMVRMLSVASVVMSLMWVVAEARIPGNYMGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNY  117



>gb|AAF32410.1|AF230277_1 alpha-expansin 2 [Triphysaria versicolor]
Length=262

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 95/112 (85%), Gaps = 3/112 (3%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            +LCIA  +C LT+  ARIPG+YSGG WQ AHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  8    LLCIATFICFLTSAQARIPGIYSGGPWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  287  NNAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPNF  433
            N AALSTALFNNGLSCGACFEI+C    + + C+PG PSI VTATNFCPPNF
Sbjct  68   NTAALSTALFNNGLSCGACFEIRCDMAQDGKWCNPGTPSILVTATNFCPPNF  119



>ref|XP_003552064.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   174 bits (442),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA +  LCIA L+    A  ARIPGV++GGAWQ AHATFYGG DASGTMGGA GYGNLYS
Sbjct  1    MAGMVPLCIASLVTLFVATSARIPGVFNGGAWQGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG+PSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSIVITATNFCPPNF  115



>gb|AFK33369.1| unknown [Lotus japonicus]
Length=180

 Score =   172 bits (436),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 3/113 (3%)
 Frame = +2

Query  104  RVLCI--ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQG  277
            RVLC+  A L+  +  V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGA GYGNLYSQG
Sbjct  7    RVLCLYMASLISLMWMVQARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQG  66

Query  278  YGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            YGVN AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+
Sbjct  67   YGVNTAALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNY  119



>gb|KHN17924.1| Expansin-A3 [Glycine soja]
Length=307

 Score =   176 bits (446),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA + ++ I  LL  +    A+IPGVYSGG WQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAMLNIIAIVSLLLLIIPSQAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C PGNPSIFVTATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNY  115



>ref|NP_001242978.1| expansin-A4-like precursor [Glycine max]
 gb|AEV43316.1| expansin A5a [Glycine max]
Length=259

 Score =   174 bits (442),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 96/114 (84%), Gaps = 1/114 (1%)
 Frame = +2

Query  95   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQ  274
             A  VLCI  ++     V ARIPGVYS GAWQ+AHATFYGG+DASGTMGGA GYGNLYSQ
Sbjct  3    VANNVLCIFFIISLTCMVQARIPGVYSAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQ  62

Query  275  GYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            GYGVN AALSTALFN+GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNF
Sbjct  63   GYGVNTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNF  116



>ref|XP_011094866.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=262

 Score =   174 bits (442),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 102/118 (86%), Gaps = 4/118 (3%)
 Frame = +2

Query  92   MAAVRVL-CIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            +AA+++L CI+ +LC LT   ARIPGVYSGG WQ+AHATFYGG+DASGTMGGA GYGNLY
Sbjct  2    LAAMKLLLCISSILCFLTCSDARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLY  61

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNGLSCGACFEIKC    + + C+PG+PSI VTATNFCPPN+
Sbjct  62   SQGYGVNTAALSTALFNNGLSCGACFEIKCDAAQDPKWCNPGSPSILVTATNFCPPNY  119



>ref|XP_004249536.1| PREDICTED: expansin-A6-like [Solanum lycopersicum]
Length=257

 Score =   174 bits (442),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA   + CIA LL  LT V +++ GVY+ G WQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAITWMFCIASLLSFLTIVESKVRGVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNF  433
             GYGVNNAALST LFN+GLSCGACFEIKC++++ C+PGNPSIFVT TNFCPPN+
Sbjct  61   TGYGVNNAALSTVLFNSGLSCGACFEIKCTDEKWCNPGNPSIFVTGTNFCPPNY  114



>ref|XP_006288496.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
 gb|EOA21394.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
Length=258

 Score =   174 bits (441),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA  +  +A++L +   VHARIPGVY+GG W  AHATFYGGADASGTMGGA GYGNLYS
Sbjct  1    MAAKVITLMAVMLATAFTVHARIPGVYTGGPWVNAHATFYGGADASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNF  115



>ref|XP_004302749.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=260

 Score =   174 bits (441),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +2

Query  101  VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGY  280
            +R+LCIA L   L   +ARIPG Y+GG WQ AHATFYGG+DASGTMGGA GYGNLYSQGY
Sbjct  6    LRLLCIASLASLLMVANARIPGPYTGGPWQEAHATFYGGSDASGTMGGACGYGNLYSQGY  65

Query  281  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            GVN AALSTALFNNGLSCGACFEIKC +D R C+ G PSIFVTATNFCPPNF
Sbjct  66   GVNTAALSTALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNF  117



>ref|XP_004173681.1| PREDICTED: expansin-A4-like, partial [Cucumis sativus]
Length=119

 Score =   170 bits (430),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 1/96 (1%)
 Frame = +2

Query  149  HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALFNNGL  328
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGA GYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  329  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNF  116



>gb|KEH22886.1| expansin-A1-like protein [Medicago truncatula]
Length=258

 Score =   174 bits (441),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA + +L IA L     A  ARIPGVYSGG W +AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAGILLLTIASLASLFAATTARIPGVYSGGPWTSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFE+KC  D R C+PGNPSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCDQDPRWCNPGNPSILITATNFCPPNF  115



>ref|XP_008233635.1| PREDICTED: expansin-A4-like [Prunus mume]
Length=259

 Score =   174 bits (441),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA + +LCI +L+  + T V ARIPGVYSGGAWQ AHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MATMTLLCIVSLIALASTIVEARIPGVYSGGAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPN+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNY  116



>gb|AAR82850.1| expansin-2 [Petunia x hybrida]
Length=262

 Score =   174 bits (441),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 101/119 (85%), Gaps = 5/119 (4%)
 Frame = +2

Query  92   MAAVRVLC--IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            MA++ V+   I  LL  ++ V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MASMGVMATYILALLFLISLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALFNNGLSCGACFE+KC+ND   + C PGNPSI +TATNFCPPN+
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFELKCTNDPHWKWCLPGNPSILITATNFCPPNY  119



>gb|AFK44569.1| unknown [Medicago truncatula]
Length=258

 Score =   174 bits (441),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            M A  +    +++ S+  V ARIPGVYSGG WQ AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MVAKMLYIAFIIITSMYIVQARIPGVYSGGQWQDAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANDKEWCRSGSPSIFITATNFCPPNF  115



>gb|KEH30169.1| expansin A10 [Medicago truncatula]
Length=258

 Score =   174 bits (440),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            M A  +    +++ S+  V ARIPGVYSGG WQ AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MVAKMLYIAFIIITSMYIVQARIPGVYSGGQWQDAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNF  115



>ref|XP_003519349.1| PREDICTED: expansin-A4-like [Glycine max]
Length=257

 Score =   174 bits (440),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            +  + L+   LT+  ARIPG YSGGAW+TAHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  5    IAIVTLIAVVLTSTEARIPGAYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  64

Query  287  NNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            N AALSTALFNNGLSCGACFEIKC+ND S C  G+PSIFVTATNFCPPN+
Sbjct  65   NTAALSTALFNNGLSCGACFEIKCANDPSWCHAGSPSIFVTATNFCPPNY  114



>ref|XP_011027216.1| PREDICTED: expansin-A4 [Populus euphratica]
Length=258

 Score =   174 bits (440),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA     C+A L+  LT V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAIRATTCVASLVLFLTLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFN+GLSCGACFEIKC ND + C  G+PSI +TATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNSGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNY  115



>ref|NP_001236550.1| expansin precursor [Glycine max]
 gb|AAO15999.1|AF516880_1 expansin [Glycine max]
Length=258

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA+  + IA L+    A  ARIPGVY+GG WQ+AHATFYG +DASGTMGG  GYGNLYS
Sbjct  1    MAAIVFIHIASLVSLFVATSARIPGVYTGGPWQSAHATFYGASDASGTMGGRCGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PGNPSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGNPSILITATNFCPPNF  115



>gb|AAT11859.2| expansin 1 [Mangifera indica]
Length=260

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            M  + + CI  L C +  V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  3    MVGLSMACILSLRCLMWMVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  62

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  63   QGYGVNTAALSTALFNNGFSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  117



>gb|AAM22624.1|AF428177_1 expansin 10 precursor [Rumex palustris]
Length=258

 Score =   174 bits (440),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA+  L   + + S  +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGA G+GNLYS
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNG+SCGACFEIKC++D R C PGNPSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGMSCGACFEIKCADDPRWCHPGNPSILITATNFCPPNF  115



>ref|XP_008357089.1| PREDICTED: expansin-A6 [Malus domestica]
Length=260

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 97/117 (83%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            M  V V  CIA LL SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTM GA GYGNL
Sbjct  1    MGVVSVSTCIATLLISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMXGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN  ALSTALFNNGLSCGACFEIKCSND R C  G+PSIF+TATNFCPPNF
Sbjct  61   YSQGYGVNTGALSTALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNF  117



>ref|XP_009757427.1| PREDICTED: expansin-A4-like [Nicotiana sylvestris]
Length=261

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 98/119 (82%), Gaps = 5/119 (4%)
 Frame = +2

Query  86   GKMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            G M  +  +   + L SL  V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGA GYGNL
Sbjct  2    GSMGVITSIVGLIFLVSL--VEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNL  59

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALFNNGLSCGACFEIKC+ND   + C PG+PSI +TATNFCPPN+
Sbjct  60   YSQGYGVNTAALSTALFNNGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNY  118



>ref|XP_009343581.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = +2

Query  92   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGN  262
            MAA+  +LCIA L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGA GYGN
Sbjct  1    MAAMAPLLCIASLMALASTIVVEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGN  60

Query  263  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            LYSQGYGVN AALSTALFNNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPNF
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCKSGSPSIFVTATNFCPPNF  118



>ref|XP_008457477.1| PREDICTED: expansin-A4-like [Cucumis melo]
Length=259

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            +LCIA L+ ++    ARIPGVYSGG W++AHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPATARIPGVYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  287  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNF
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNF  116



>ref|XP_010509297.1| PREDICTED: expansin-A3-like [Camelina sativa]
Length=164

 Score =   170 bits (430),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 90/100 (90%), Gaps = 1/100 (1%)
 Frame = +2

Query  137  LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALF  316
            LTA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGA GYGNLYSQGYGVN AALSTALF
Sbjct  20   LTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  79

Query  317  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            NNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNF
Sbjct  80   NNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNF  119



>emb|CAA59470.1| orf [Pisum sativum]
Length=258

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA+ +L IA L        ARIPGVY+GG W +AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAAILLLTIASLTSLFAPTTARIPGVYTGGPWTSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFE+KC  D R C+PGNPSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCDQDPRWCNPGNPSILITATNFCPPNF  115



>ref|XP_008464122.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=258

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA    LCIALLL     + ARIPGVYSGG WQ+AHATFYGGADASGTMGGA GYGNLYS
Sbjct  1    MATPISLCIALLLSFSLLIDARIPGVYSGGPWQSAHATFYGGADASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFN G SCGACFEIKC+ND R C  G+PSI +TATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNY  115



>ref|XP_008343537.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = +2

Query  92   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGN  262
            MAA+  +LCIA L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGA GYGN
Sbjct  1    MAAMAPLLCIASLMALASTIVVEARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  263  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            LYSQGYGVN AALSTALFNNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNF
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNF  118



>gb|ACJ48968.2| expansin [Breonia chinensis]
 gb|ACT10284.2| expansin [Breonia chinensis]
Length=258

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA+ +  I  L   LT   ARIPGVYSGG+WQ AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAAMCLTSIVALSLLLTLAEARIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFE+KC++D + C PG+PSIF+TATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCADDPQWCHPGSPSIFITATNFCPPNY  115



>ref|XP_010256907.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   173 bits (438),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +2

Query  95   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQ  274
            A V V+   LL+  LT V ARIPGVY+GG WQ+AHATFYGG+DASGTMGGA GYGNLYSQ
Sbjct  4    ATVNVVSAVLLISFLTLVDARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  275  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            GYGVN AALSTALFN GLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+
Sbjct  64   GYGVNTAALSTALFNAGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNY  117



>ref|XP_003544219.1| PREDICTED: expansin-A6-like [Glycine max]
Length=260

 Score =   172 bits (437),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 94/107 (88%), Gaps = 1/107 (1%)
 Frame = +2

Query  116  IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNA  295
            I  L+  L +  AR+PGVYSGGAW+TAHATFYGG+DASGTMGGA GYGNLYSQGYGVN A
Sbjct  11   IVTLITLLASTEARVPGVYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTA  70

Query  296  ALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            ALSTALFNNGLSCGACFEIKC+ND S C  G+PSIFVTATNFCPPN+
Sbjct  71   ALSTALFNNGLSCGACFEIKCANDPSWCHAGSPSIFVTATNFCPPNY  117



>gb|AAR82849.1| expansin-1 [Petunia x hybrida]
Length=260

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 96/111 (86%), Gaps = 2/111 (2%)
 Frame = +2

Query  107  VLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            V C+ +L+L  L  V ARIPGVYSGGAWQ+AHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  7    VACVTSLVLLMLLTVEARIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  284  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            VNN ALSTALFNNGLSCGACFEIKC  D + C  G+PSIF+TATNFCPPN+
Sbjct  67   VNNGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNY  117



>gb|AAM22626.1|AF428179_1 expansin 12 precursor [Rumex palustris]
Length=258

 Score =   172 bits (436),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA+  L   + + S  +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGA G+GNLYS
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNF  115



>ref|XP_004154408.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004173564.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN65728.1| hypothetical protein Csa_1G522540 [Cucumis sativus]
Length=259

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            +LCIA L+ ++    ARIPG+YSGG W++AHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  287  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNF
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNF  116



>gb|AAM22625.1|AF428178_1 expansin 11 precursor [Rumex palustris]
Length=258

 Score =   172 bits (436),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA+  L   + + S  +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGA G+GNLYS
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNF  115



>ref|XP_007205739.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
 gb|EMJ06938.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
Length=187

 Score =   170 bits (431),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 96/109 (88%), Gaps = 2/109 (2%)
 Frame = +2

Query  113  CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVN  289
            C+A LL SL  V  ARIPGVYSGGAW+ AHATFYGG+DASGTMGGA GYGNLYSQGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  290  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNF
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNF  117



>ref|XP_006410954.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
 dbj|BAJ34443.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52407.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
Length=263

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 97/113 (86%), Gaps = 2/113 (2%)
 Frame = +2

Query  101  VRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQG  277
            +R L +A+ +   L A +A+IPGVY+GG WQ AHATFYGG+DASGTMGGA GYGNLYSQG
Sbjct  8    IRFLWLAVTISFLLAATNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQG  67

Query  278  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YGVN AALSTALFNNG SCGACFEIKC++D R C PGNPSIFVTATNFCPPNF
Sbjct  68   YGVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSIFVTATNFCPPNF  120



>gb|AAL31477.1|AF319472_1 alpha-expansin 6 precursor [Cucumis sativus]
Length=259

 Score =   172 bits (436),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            +LCIA L+ ++    ARIPG+YSGG W++AHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  287  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNF
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNF  116



>gb|AEN70914.1| expansin [Gossypium trilobum]
Length=259

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGA GYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPNF
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNF  116



>ref|XP_002298353.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|ABK92494.1| unknown [Populus trichocarpa]
 gb|EEE83158.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 100/119 (84%), Gaps = 5/119 (4%)
 Frame = +2

Query  92   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYG  259
            MA   ++CIA    +++ SL    ARIPGVYSGGAWQ AHATFYGGADASGTMGGA GYG
Sbjct  1    MAMSSLICIATSLLIIMSSLWMAEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYG  60

Query  260  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            NLYSQGYGV+ AALSTALFNNGL+CG+CFEIKC++D R C  G+PSIF+TATNFCPPN+
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLTCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNY  119



>ref|XP_007009225.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY18035.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=259

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            V C+  L   L AV ARIPGVYSG  WQTAHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  7    VACLVALNLILVAVEARIPGVYSGAEWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  287  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            N AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSIFVTATNFCPPN+
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANEPQWCHAGSPSIFVTATNFCPPNY  116



>ref|XP_007150329.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
 gb|ESW22323.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
Length=256

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 97/111 (87%), Gaps = 2/111 (2%)
 Frame = +2

Query  107  VLCIALLLCSLT-AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            VL IAL   S+   V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  3    VLGIALCFASIMWMVDARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  62

Query  284  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            VN AALSTALFNNGLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+
Sbjct  63   VNTAALSTALFNNGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNY  113



>ref|XP_010517036.1| PREDICTED: expansin-A3 [Camelina sativa]
Length=262

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 98/118 (83%), Gaps = 4/118 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCS---LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGN  262
            MA    +C+ L + +   LTA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGA GYGN
Sbjct  2    MATAFGICLWLAVTASFLLTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGN  61

Query  263  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            LYSQGYGVN AALSTALFNNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNF
Sbjct  62   LYSQGYGVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNF  119



>gb|AEE69071.1| expansin-4 [Petunia hybrid cultivar]
Length=248

 Score =   172 bits (435),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 93/102 (91%), Gaps = 1/102 (1%)
 Frame = +2

Query  131  CSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTA  310
            C LTAV+A+IPGVY GG WQ+AHATFYGG+DASGTMGGA GYGNLYSQGYGVNNAALST 
Sbjct  4    CFLTAVYAKIPGVYIGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTV  63

Query  311  LFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            LFN+GLSCGACFE+KC+ND   C PGNPSIFVTATNFCPPN+
Sbjct  64   LFNSGLSCGACFELKCTNDEPWCLPGNPSIFVTATNFCPPNY  105



>gb|ACO07292.1| expansin 10 [Cucumis sativus]
Length=259

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 1/96 (1%)
 Frame = +2

Query  149  HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALFNNGL  328
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGA GYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  329  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNF  116



>ref|XP_004142066.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN54256.1| hypothetical protein Csa_4G296100 [Cucumis sativus]
Length=259

 Score =   172 bits (436),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 1/96 (1%)
 Frame = +2

Query  149  HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALFNNGL  328
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGA GYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  329  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNF  116



>ref|XP_007218834.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
 gb|EMJ20033.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
Length=259

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA + +LCI +L+  + T V ARIPGVYSG AWQ AHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MATMALLCIVSLIALASTIVEARIPGVYSGEAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPN+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNY  116



>ref|XP_011035307.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=262

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 100/119 (84%), Gaps = 5/119 (4%)
 Frame = +2

Query  92   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYG  259
            MA   ++CIA    +++ SL    ARIPGVYSGGAWQ AHATFYGGADASGTMGGA GYG
Sbjct  1    MAMSSLICIATSLLIIMSSLWMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYG  60

Query  260  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            NLYSQGYGV+ AALSTALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNY  119



>gb|KJB20063.1| hypothetical protein B456_003G131000 [Gossypium raimondii]
Length=190

 Score =   169 bits (429),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGA GYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  116



>ref|XP_008802710.1| PREDICTED: expansin-A4 [Phoenix dactylifera]
Length=258

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 100/115 (87%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA +R++ +A LL  L    ARIPGVYSGGAWQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAILRLVALASLLAFLVPAAARIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGV+ AALSTALFN+GLSCGACFEIKC+++ + C  G+PSIF+TATNFCPPN+
Sbjct  61   QGYGVDTAALSTALFNDGLSCGACFEIKCADEPQWCHSGSPSIFITATNFCPPNY  115



>gb|AEQ55290.1| expansin [Breonia chinensis]
Length=259

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +2

Query  92   MAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            MA V ++CIA  L L  L A  ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MAVVGLVCIASVLALAGLVA-EARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNL  59

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALFN+GL CGACFEIKC+N+ + C PG+PSIFVTATNFCPPN+
Sbjct  60   YSQGYGVNTAALSTALFNSGLRCGACFEIKCANEPQWCHPGSPSIFVTATNFCPPNY  116



>ref|NP_001284471.1| expansin-A4 precursor [Cucumis melo]
 gb|ABI94060.1| ripening-related expansin [Cucumis melo]
Length=259

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 89/96 (93%), Gaps = 1/96 (1%)
 Frame = +2

Query  149  HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALFNNGL  328
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGA GYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  329  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNF  116



>ref|XP_009589397.1| PREDICTED: expansin-A4-like [Nicotiana tomentosiformis]
Length=261

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 101/118 (86%), Gaps = 4/118 (3%)
 Frame = +2

Query  92   MAAVRVLC-IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA++ V+  I  L+  ++ V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MASMGVITSIIGLIFLVSLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNGLSCGACFEIKC+ND   + C PG+PSI +TATNFCPPN+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNY  118



>ref|XP_009768238.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=257

 Score =   171 bits (434),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 91/103 (88%), Gaps = 1/103 (1%)
 Frame = +2

Query  128  LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALST  307
            L  + AV  RIPGVYSGGAWQ+AHATFYGG+DASGTMGGA GYGNLYSQGYGVNN ALST
Sbjct  12   LILVAAVEGRIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNGALST  71

Query  308  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            ALFNNGLSCGACFEIKC  D +SC  G+PSIF+TATNFCPPNF
Sbjct  72   ALFNNGLSCGACFEIKCDKDPQSCHSGSPSIFITATNFCPPNF  114



>ref|NP_001234881.1| expansin9 precursor [Solanum lycopersicum]
 emb|CAB46492.1| expansin9 [Solanum lycopersicum]
Length=257

 Score =   171 bits (434),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  116  IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNA  295
            + ++L  L  V  RIPGVYSGG+WQ AHATFYGG+DASGTMGGA GYGNLYSQGYGVNNA
Sbjct  8    LIIILVILVGVEGRIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNA  67

Query  296  ALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            ALSTALFNNGLSCGACFEIKC N  + C PG+PSI +TATNFCPPN+
Sbjct  68   ALSTALFNNGLSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNY  114



>gb|AEQ55275.1| expansin [Breonia chinensis]
Length=259

 Score =   171 bits (434),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 101/117 (86%), Gaps = 4/117 (3%)
 Frame = +2

Query  92   MAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            MA V ++CIA  L L  L A  ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MAIVGLVCIASVLALAGLVA-EARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNL  59

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALFN+GL CGACFEIKC+N+ + C PG+PSIFVTATNFCPPN+
Sbjct  60   YSQGYGVNTAALSTALFNSGLRCGACFEIKCANEPQWCHPGSPSIFVTATNFCPPNY  116



>gb|AFZ78606.1| expansin protein [Populus tomentosa]
Length=262

 Score =   171 bits (434),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 100/119 (84%), Gaps = 5/119 (4%)
 Frame = +2

Query  92   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYG  259
            MA   ++CIA    +++ SL    ARIPGVYSGGAW+ AHATFYGGADASGTMGGA GYG
Sbjct  1    MAMRSLICIATSLLIIVSSLWMAEARIPGVYSGGAWENAHATFYGGADASGTMGGACGYG  60

Query  260  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            NLYSQGYGV+ AALSTALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNY  119



>ref|NP_181300.1| expansin-A3 [Arabidopsis thaliana]
 ref|XP_004253297.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
 sp|O80932.1|EXPA3_ARATH RecName: Full=Expansin-A3; Short=AtEXPA3; AltName: Full=Alpha-expansin-3; 
Short=At-EXP3; Short=AtEx3; AltName: Full=Ath-ExpAlpha-1.9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC23634.1| putative expansin [Arabidopsis thaliana]
 gb|AAL91271.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AAM67431.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AEC09429.1| expansin-A3 [Arabidopsis thaliana]
Length=262

 Score =   171 bits (434),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 90/100 (90%), Gaps = 1/100 (1%)
 Frame = +2

Query  137  LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALF  316
            LTA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGA GYGNLYSQGYGVN AALSTALF
Sbjct  20   LTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  79

Query  317  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            NNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNF
Sbjct  80   NNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNF  119



>ref|XP_009761115.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=260

 Score =   171 bits (434),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 96/117 (82%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSL--TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            M  +   CI  L+ SL    V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MEMLNFFCIFSLIISLFLLTVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YSQGYGVNNAALSTALFNNGLSCGACFEIKC N  + C  G+PSI +TATNFCPPN+
Sbjct  61   YSQGYGVNNAALSTALFNNGLSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNY  117



>ref|XP_010505357.1| PREDICTED: expansin-A3-like [Camelina sativa]
Length=262

 Score =   171 bits (434),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 96/112 (86%), Gaps = 4/112 (4%)
 Frame = +2

Query  110  LCIALLLCS---LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGY  280
            +C+ L + +   LTA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGA GYGNLYSQGY
Sbjct  8    ICLWLAVTASFLLTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGY  67

Query  281  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            GVN AALSTALFNNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNF
Sbjct  68   GVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNF  119



>gb|AEN70895.1| expansin [Gossypium mustelinum]
Length=259

 Score =   171 bits (434),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGA GYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  116



>gb|ADY68817.1| expansin [Gossypium raimondii]
Length=259

 Score =   171 bits (433),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGA GYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  116



>gb|ADY68814.1| expansin [Gossypium barbadense]
 gb|ADY68816.1| expansin [Gossypium herbaceum subsp. africanum]
 gb|AEN70897.1| expansin [Gossypium darwinii]
 gb|AEN70899.1| expansin [Gossypium tomentosum]
 gb|AEN70903.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70905.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70909.1| expansin [Gossypium davidsonii]
 gb|AEN70910.1| expansin [Gossypium klotzschianum]
 gb|KJB20062.1| hypothetical protein B456_003G131000 [Gossypium raimondii]
Length=259

 Score =   171 bits (433),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGA GYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  116



>ref|XP_009357738.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
 ref|XP_009357739.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   171 bits (433),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 99/118 (84%), Gaps = 4/118 (3%)
 Frame = +2

Query  92   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGN  262
            MAA+  +LCI  L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGA GYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  263  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            LYSQGYGVN AALSTALFNNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNF
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNF  118



>gb|AEN70901.1| expansin [Gossypium barbadense var. brasiliense]
Length=259

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGA GYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  116



>ref|NP_001288899.1| expansin-A6 precursor [Brassica rapa]
 gb|AGM16348.1| alpha-expansin protein 6 [Brassica rapa]
Length=260

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 95/111 (86%), Gaps = 2/111 (2%)
 Frame = +2

Query  107  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  7    VLCVLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  284  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNF
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNF  117



>ref|XP_006409928.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
 gb|ESQ51381.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
Length=260

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 98/111 (88%), Gaps = 2/111 (2%)
 Frame = +2

Query  107  VLCIALLLCSLTAVH-ARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            VLC+  +L  LTA++ ARIPGVY+GG W++AHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  7    VLCVLTILADLTAIYEARIPGVYNGGGWESAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  284  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNF
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNF  117



>emb|CDY31742.1| BnaA04g16780D [Brassica napus]
Length=260

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 95/111 (86%), Gaps = 2/111 (2%)
 Frame = +2

Query  107  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  7    VLCVLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  284  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNF
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNF  117



>ref|XP_002283530.1| PREDICTED: expansin-A4 [Vitis vinifera]
Length=258

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA   V+C A L+   + V A+IPG YSGGAWQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAVGVVVCFASLISLFSLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFE+KC+ND + C  G+PSI +TATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNY  115



>gb|AEN70891.1| expansin [Gossypium thurberi]
Length=259

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGA GYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  116



>gb|AHL25255.1| expansin [Boehmeria nivea]
Length=260

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 98/114 (86%), Gaps = 3/114 (3%)
 Frame = +2

Query  95   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQ  274
            AA ++ C+  L+    A  ARIPGVYSGG+WQTAHATFYGG+DASGTMGGA GYGNLYSQ
Sbjct  6    AAWKIACLVSLMT--LATEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  275  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            GYGVN AALSTALFN+GLSCGACFE+KC+ND +SC  G+PSI VTATNFCPPN+
Sbjct  64   GYGVNTAALSTALFNSGLSCGACFELKCANDPKSCHSGSPSIIVTATNFCPPNY  117



>ref|XP_009349313.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   171 bits (433),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 98/117 (84%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            M  V V  CIA L+ SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MGVVSVSTCIASLIISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALFNNGLSCGACFE+KC++D S C  G PSIF+TATNFCPPNF
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFELKCADDPSWCHAGGPSIFITATNFCPPNF  117



>emb|CBI16120.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA   V+C A L+   + V A+IPG YSGGAWQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAVGVVVCFASLISLFSLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFE+KC+ND + C  G+PSI +TATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNY  115



>ref|XP_009353647.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
 ref|XP_009349875.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 98/117 (84%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            M  V V  CIA L+ SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MGVVSVSTCIASLIISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALFNNGLSCGACFE+KC++D S C  G PSIF+TATNFCPPNF
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFELKCADDPSWCHAGGPSIFITATNFCPPNF  117



>ref|XP_002533097.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
 gb|EEF29289.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
Length=259

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 2/116 (2%)
 Frame = +2

Query  89   KMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            KM +V +  + LL+  + A  ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGA GYGNLY
Sbjct  2    KMGSV-ISGVILLVMLMGASEARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSI +TATNFCPPNF
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNF  116



>ref|XP_007205740.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
 dbj|BAC66787.1| expansin [Prunus persica]
 gb|EMJ06939.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
Length=260

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 96/109 (88%), Gaps = 2/109 (2%)
 Frame = +2

Query  113  CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVN  289
            C+A LL SL  V  ARIPGVYSGGAW+ AHATFYGG+DASGTMGGA GYGNLYSQGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  290  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNF
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNF  117



>ref|XP_010106493.1| hypothetical protein L484_025251 [Morus notabilis]
 gb|EXC10669.1| hypothetical protein L484_025251 [Morus notabilis]
Length=258

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA + V  IA LL  +    ARIPGVY+GG+W+TAHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAGLTVTWIASLLSLMWMAEARIPGVYTGGSWETAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGV+ AALSTALFNNGLSCGACFEIKC+ND + C  G+PSI +TATNFCPPN+
Sbjct  61   QGYGVSTAALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNY  115



>gb|KFK36651.1| alpha-expansin 4 [Arabis alpina]
Length=261

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 91/100 (91%), Gaps = 1/100 (1%)
 Frame = +2

Query  137  LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALF  316
            LTA +A+IPGVY+GG WQ AHATFYGGADASGTMGGA GYGNLYSQGYGVN AALSTALF
Sbjct  19   LTASNAKIPGVYTGGPWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALF  78

Query  317  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            NNGLSCGACFE+KC++D R C PGNPSI VTATNFCPPNF
Sbjct  79   NNGLSCGACFEMKCTDDPRWCVPGNPSILVTATNFCPPNF  118



>gb|AEU08407.1| expansin 2 [Prunus salicina]
Length=260

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 96/109 (88%), Gaps = 2/109 (2%)
 Frame = +2

Query  113  CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVN  289
            C+A LL SL  V  ARIPGVYSGGAW+ AHATFYGG+DASGTMGGA GYGNLYSQGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  290  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNF
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNF  117



>gb|AEN70907.1| expansin [Gossypium armourianum]
Length=259

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGA GYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNY  116



>gb|ADY68815.1| expansin [Gossypium barbadense]
 gb|ADY68819.1| expansin [Gossypium hirsutum]
 gb|AEN70892.1| expansin [Gossypium laxum]
 gb|AEN70894.1| expansin [Gossypium turneri]
 gb|AEN70896.1| expansin [Gossypium mustelinum]
 gb|AEN70898.1| expansin [Gossypium darwinii]
 gb|AEN70902.1| expansin [Gossypium barbadense var. brasiliense]
 gb|AEN70904.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70906.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70908.1| expansin [Gossypium harknessii]
 gb|AEN70911.1| expansin [Gossypium aridum]
 gb|AEN70912.1| expansin [Gossypium gossypioides]
 gb|AEN70913.1| expansin [Gossypium lobatum]
Length=259

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGA GYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNY  116



>ref|XP_009597793.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            + C+  L+  + AV +RIPGVYSGGAWQ+AHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  9    IACVFSLML-VVAVESRIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  287  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            NN ALSTALFNNGLSCGACFEIKC  D + C  G+PSIF+TATNFCPPNF
Sbjct  68   NNGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNF  117



>ref|XP_008223717.1| PREDICTED: expansin-A4 [Prunus mume]
Length=260

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 96/109 (88%), Gaps = 2/109 (2%)
 Frame = +2

Query  113  CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVN  289
            C+A LL SL  V  ARIPGVYSGGAW+ AHATFYGG+DASGTMGGA GYGNLYSQGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  290  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNF
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNF  117



>emb|CDX77222.1| BnaC04g40170D [Brassica napus]
Length=260

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 95/111 (86%), Gaps = 2/111 (2%)
 Frame = +2

Query  107  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  7    VLCLLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  284  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNF
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNF  117



>gb|AEN70893.1| expansin [Gossypium schwendimanii]
Length=259

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGA GYGNLY
Sbjct  1    MAMVNVISVLIFISSIWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNY  116



>gb|AAR09168.1| alpha-expansin 1 [Populus tremula x Populus tremuloides]
Length=262

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 100/119 (84%), Gaps = 5/119 (4%)
 Frame = +2

Query  92   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYG  259
            MA   ++CIA    +++ SL    ARIPGVYSGGAW+ AHATFYGG+DASGTMGGA GYG
Sbjct  1    MAMSSLICIATSLLIIVSSLWMAEARIPGVYSGGAWENAHATFYGGSDASGTMGGACGYG  60

Query  260  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            NLYSQGYGV+ AALSTALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNY  119



>ref|XP_010528418.1| PREDICTED: expansin-A3 [Tarenaya hassleriana]
Length=264

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 95/110 (86%), Gaps = 2/110 (2%)
 Frame = +2

Query  110  LCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            L +A+    L A   ARIPGVY+GG WQ+AHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  12   LSLAITASFLVASATARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  71

Query  287  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            N AALSTALFNNGLSCGACFEIKC+ D + C+PGNPSIFVTATNFCPPNF
Sbjct  72   NTAALSTALFNNGLSCGACFEIKCTEDPKWCNPGNPSIFVTATNFCPPNF  121



>ref|XP_008240857.1| PREDICTED: expansin-A6-like [Prunus mume]
Length=258

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA V +LCIA LL    A +ARI G  +GG W+ AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAFVHMLCIASLLSLFMAANARIRGFDTGGPWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            +GYGVN AALSTALFNNGLSCGACFEIKC +D + C PGNPSIF+TATNFCPPN+
Sbjct  61   EGYGVNTAALSTALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNY  115



>ref|XP_007163413.1| hypothetical protein PHAVU_001G232600g [Phaseolus vulgaris]
 gb|ESW35407.1| hypothetical protein PHAVU_001G232600g [Phaseolus vulgaris]
Length=258

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            M  + +  I  LL  LT   A+IPG +SGG WQTAHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MPMLNIFAIVSLLPFLTPSQAKIPGAFSGGPWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNG SCGACF+IKC++D + C PGNPSIFVTATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFQIKCTHDPKWCLPGNPSIFVTATNFCPPNY  115



>ref|XP_004143121.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004166197.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN47143.1| hypothetical protein Csa_6G190340 [Cucumis sativus]
Length=258

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 94/115 (82%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA    LCI LLL     + ARIPGVYSGG WQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MATPFSLCIPLLLSFSLLIEARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFN G SCGACFEIKC+ND R C  G+PSI +TATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNY  115



>gb|KJB55836.1| hypothetical protein B456_009G098800 [Gossypium raimondii]
Length=259

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            M     +CI + L+ S+    ARIPGVYSGGAWQ AHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MGIAGAVCIIVGLISSMWMAEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  116



>ref|XP_010920576.1| PREDICTED: expansin-A4-like [Elaeis guineensis]
Length=260

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = +2

Query  125  LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALS  304
            LL  LT   ARIPGVY+GG WQTAHATFYGG+DASGTMGGA GYGNLYSQGYGV  AALS
Sbjct  14   LLAFLTLADARIPGVYAGGQWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALS  73

Query  305  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            TALFN GLSCGACFEIKC++D R C PG+PSIF+TATNFCPPN+
Sbjct  74   TALFNEGLSCGACFEIKCADDPRWCHPGSPSIFITATNFCPPNY  117



>gb|ACK36943.1| expansin [Annona cherimola]
Length=259

 Score =   169 bits (429),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 2/112 (2%)
 Frame = +2

Query  101  VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGY  280
            +R    +L+LC L+ V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGA GYGNLYSQGY
Sbjct  6    IRTFVASLILC-LSLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGY  64

Query  281  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            GVN A LSTA FNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+
Sbjct  65   GVNTAVLSTAFFNNGLSCGACFEIKCADDPKWCHSGSPSILITATNFCPPNY  116



>ref|XP_003547326.1| PREDICTED: expansin-A4-like [Glycine max]
Length=256

 Score =   169 bits (429),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 96/110 (87%), Gaps = 4/110 (4%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            VLC   L+  +  V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  7    VLC---LMSLMWMVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  63

Query  287  NNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            N AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+
Sbjct  64   NTAALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNY  113



>gb|AAM47000.1|AF512542_1 alpha-expansin precursor [Gossypium hirsutum]
Length=264

 Score =   169 bits (429),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 1/113 (1%)
 Frame = +2

Query  98   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQG  277
            ++ VLC A LL     V+ARIPGV++GGAW++AHATFYGG+DASGTMGGA GYGNLYSQG
Sbjct  9    SLSVLCFASLLSFFGWVNARIPGVFTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  278  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YGVN AALS ALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPN+
Sbjct  69   YGVNTAALSPALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNY  121



>gb|KJB73995.1| hypothetical protein B456_011G266000 [Gossypium raimondii]
Length=258

 Score =   169 bits (429),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA      +  L+   TAV ARIPGVYSGGAWQ+AHATFYGG DASGTMGGA G+GNLYS
Sbjct  1    MAIKGFTYLVYLIIISTAVEARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGFGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNY  115



>gb|ADY68818.1| expansin [Gossypium hirsutum]
Length=259

 Score =   169 bits (429),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGA GYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
             QGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  61   GQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  116



>ref|XP_006435550.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 ref|XP_006486470.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|ESR48790.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 gb|KDO69285.1| hypothetical protein CISIN_1g024916mg [Citrus sinensis]
Length=260

 Score =   169 bits (429),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  95   AAVRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
             AV ++CI   +  S  +V ARIPGVY G AWQ+AHATFYGG DASGTMGGA GYGNLYS
Sbjct  3    VAVGIICIVTFVTFSSLSVDARIPGVYGGEAWQSAHATFYGGNDASGTMGGACGYGNLYS  62

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIFVTATNFCPPNF
Sbjct  63   QGYGVNTAALSTALFNNGLSCGACFEIKCANDPQWCHAGSPSIFVTATNFCPPNF  117



>ref|XP_009130690.1| PREDICTED: expansin-A9-like [Brassica rapa]
 emb|CDY55128.1| BnaA03g55050D [Brassica napus]
Length=261

 Score =   169 bits (428),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            M A+ ++ +A L  +LT V+A+IPGVY+GG W  AHATFYG ADASGTMGGA GYGNLYS
Sbjct  6    MTAMAIMVVAAL--TLTTVNAKIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYS  63

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFE+KC ND   C PGNPSI +TATNFCPPNF
Sbjct  64   QGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNF  118



>emb|CDX80810.1| BnaC03g00640D [Brassica napus]
Length=261

 Score =   169 bits (428),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 96/115 (83%), Gaps = 3/115 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            M A+ ++ +A L  +LT V+A+IPGVY+GG W  AHATFYG ADASGTMGGA GYGNLYS
Sbjct  6    MTAMAIMVVAAL--TLTTVNAKIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYS  63

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFE+KC ND   C PGNPSI +TATNFCPPNF
Sbjct  64   QGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNF  118



>ref|XP_011042710.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=262

 Score =   169 bits (428),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 98/119 (82%), Gaps = 5/119 (4%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV----HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYG  259
            MA  R+LC    L  + ++     ARIPGVYSGGAW+TAHATFYGGADASGTMGGA GYG
Sbjct  1    MATSRLLCFTTTLLIMMSLMWKGEARIPGVYSGGAWETAHATFYGGADASGTMGGACGYG  60

Query  260  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            NLYSQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNY  119



>ref|XP_008371813.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   169 bits (428),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 99/118 (84%), Gaps = 4/118 (3%)
 Frame = +2

Query  92   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGN  262
            MAA+  +LCI  L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGA GYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  263  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            LYSQGYGVN AALSTALFN+GLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNF
Sbjct  61   LYSQGYGVNTAALSTALFNSGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNF  118



>dbj|BAC67194.1| expansin [Pyrus communis]
Length=261

 Score =   169 bits (428),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 98/118 (83%), Gaps = 4/118 (3%)
 Frame = +2

Query  92   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGN  262
            MAA+  +LCI  L  L S   V ARIPGVY+G AWQ AHATFYGG+DASGTMGGA GYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGAAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  263  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            LYSQGYGVN AALSTALFNNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNF
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNF  118



>gb|AAL31480.1|AF319475_1 alpha-expansin 9 precursor [Cucumis sativus]
Length=245

 Score =   169 bits (427),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  146  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALFNNG  325
            VHARIPGVYSGG WQ+AHATFYGG+DASGTMGGA GYGNLYSQGYGVN AALSTALFNNG
Sbjct  20   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  79

Query  326  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            LSCGACFE+KC+ND + C  G+PSIF+TATNFCPPN+
Sbjct  80   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNY  116



>ref|XP_010423881.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   169 bits (427),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA  +  +A+++ +   V+A+IPGVY+GG W  AHATFYGGADASGTMGGA GYGNLYS
Sbjct  1    MAAKVLTLMAVMVVTALTVNAKIPGVYNGGPWVNAHATFYGGADASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNF  115



>ref|XP_002881524.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002881525.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57783.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57784.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   169 bits (428),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 89/100 (89%), Gaps = 1/100 (1%)
 Frame = +2

Query  137  LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALF  316
             TA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGA GYGNLYSQGYGVN AALSTALF
Sbjct  20   FTASNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  79

Query  317  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            NNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNF
Sbjct  80   NNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNF  119



>ref|XP_010452058.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   169 bits (427),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA  +  +A+++ +   V+A+IPGVY+GG W  AHATFYGGADASGTMGGA GYGNLYS
Sbjct  1    MAAKVLTLMAVMVATALTVNAKIPGVYNGGPWINAHATFYGGADASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNF  115



>ref|XP_003543517.1| PREDICTED: expansin-A4 [Glycine max]
Length=257

 Score =   169 bits (427),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 95/108 (88%), Gaps = 4/108 (4%)
 Frame = +2

Query  122  LLLCSLT---AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNN  292
            +LLC ++    V ARIPGVYSGGAWQ AHATFYGG+DASGTMGGA GYGNLYSQGYGVN 
Sbjct  7    VLLCLMSLMWMVDARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNT  66

Query  293  AALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+
Sbjct  67   AALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNY  114



>ref|XP_010685747.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=261

 Score =   169 bits (427),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 96/117 (82%), Gaps = 1/117 (1%)
 Frame = +2

Query  86   GKMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            G  +   ++ +  L  + T V ARIPG Y GG+WQ+AHATFYGG+DASGTMGGA GYGNL
Sbjct  2    GMFSIFNIVSLMTLWVTSTLVDARIPGNYQGGSWQSAHATFYGGSDASGTMGGACGYGNL  61

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALFN+GLSCGACFE+KC+ND R C PG+PSI +TATNFCPPNF
Sbjct  62   YSQGYGVNTAALSTALFNSGLSCGACFELKCANDPRWCHPGSPSILITATNFCPPNF  118



>emb|CDP09064.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   169 bits (427),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 99/117 (85%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            MA V ++CIA  L L  +    ARIPGVY+GG WQ+AHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MAVVGLVCIASVLALAFMLGAEARIPGVYTGGDWQSAHATFYGGSDASGTMGGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALF++GLSCGACFEIKC++D   C PG+PSIFVTATNFCPPN+
Sbjct  61   YSQGYGVNTAALSTALFSSGLSCGACFEIKCASDPGWCHPGSPSIFVTATNFCPPNY  117



>ref|XP_008461679.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=260

 Score =   169 bits (427),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  146  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALFNNG  325
            VHARIPGVYSGG WQ+AHATFYGG+DASGTMGGA GYGNLYSQGYGVN AALSTALFNNG
Sbjct  21   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  80

Query  326  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            LSCGACFE+KC+ND + C  G+PSIF+TATNFCPPN+
Sbjct  81   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNY  117



>gb|ADC35365.1| alpha-expansin 2 [Coffea arabica]
Length=258

 Score =   169 bits (427),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA+ + CI  L   LT   ARIPGVY+G +W++AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAAMGLTCIVALSLLLTLTEARIPGVYTGDSWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNG SCG+CFE+KC++D + C PG+PSI +TATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNY  115



>ref|XP_010033123.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
 gb|KCW52678.1| hypothetical protein EUGRSUZ_J02048 [Eucalyptus grandis]
Length=263

 Score =   169 bits (427),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 97/120 (81%), Gaps = 6/120 (5%)
 Frame = +2

Query  92   MAAVRVLCIALL-----LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGY  256
            MAA RV+ +AL      L +     ARIPG+Y+GG WQ+AHATFYGGADASGTMGGA GY
Sbjct  1    MAAARVMALALAFLGVALSATRMAEARIPGIYTGGPWQSAHATFYGGADASGTMGGACGY  60

Query  257  GNLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            GNLYSQGYGVN AALSTALFNNG SCGACFEIKC+ND + C  G+ SIFVTATNFCPPN+
Sbjct  61   GNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSSSIFVTATNFCPPNY  120



>ref|XP_004147685.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004161909.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN50556.1| hypothetical protein Csa_5G182120 [Cucumis sativus]
Length=259

 Score =   169 bits (427),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 90/97 (93%), Gaps = 1/97 (1%)
 Frame = +2

Query  146  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALFNNG  325
            VHARIPGVYSGG WQ+AHATFYGG+DASGTMGGA GYGNLYSQGYGVN AALSTALFNNG
Sbjct  20   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  79

Query  326  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            LSCGACFE+KC+ND + C  G+PSIF+TATNFCPPN+
Sbjct  80   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNY  116



>gb|AEN70900.1| expansin [Gossypium tomentosum]
Length=259

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHAT YGGADASGTMGGA GYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATLYGGADASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNY  116



>gb|ABO32367.1| expansin [Litchi chinensis]
Length=256

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA   VLC  L L  LTA +A+IPGVY+GG W++AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAVFNVLCF-LSLLFLTA-NAKIPGVYTGGPWESAHATFYGGSDASGTMGGACGYGNLYS  58

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFE+KC  D R C PGNPSI VTATNFCPPNF
Sbjct  59   QGYGVNTAALSTALFNNGLSCGACFELKCVADPRWCLPGNPSILVTATNFCPPNF  113



>gb|KHG20113.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=259

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 96/116 (83%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            M     +CI +  + S+    ARIPGVYSGGAWQ AHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MGIAGAVCIIVGFISSMWMAEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  116



>ref|XP_006429095.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
 gb|ESR42335.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
Length=259

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA  R+LC   L  SL A  +A+IPGV++GG WQ+AHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MALFRMLCFFSLALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNGLSCGACFE+KC  D + C+PGNP+I +TATNFCPPNF
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNF  116



>gb|AEQ55274.1| expansin [Breonia chinensis]
 gb|AEQ55289.1| expansin [Breonia chinensis]
Length=256

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA V + CIA +L  +    ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAIVVLTCIASVLALVA--EARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYS  58

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN  ALSTALFN+GLSCGACFE+KC+ND   C PG+PSIF+TATNFCPPN+
Sbjct  59   QGYGVNTGALSTALFNSGLSCGACFELKCANDPGWCHPGSPSIFITATNFCPPNY  113



>ref|NP_001288852.1| expansin-A3 precursor [Brassica rapa]
 gb|AGM16345.1| alpha-expansin protein 3 [Brassica rapa]
 emb|CDX91376.1| BnaC04g07740D [Brassica napus]
Length=263

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = +2

Query  101  VRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQG  277
            +R + +A+     LT  +A+IPGVY+GG WQ AHATFYGG+DASGTMGGA GYGNLYSQG
Sbjct  8    IRFMWLAVTASLMLTVTNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQG  67

Query  278  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YGVN AALSTALFNNG SCGACFE+KC++D R C PGNPSI VTATNFCPPNF
Sbjct  68   YGVNTAALSTALFNNGFSCGACFELKCTDDPRWCVPGNPSILVTATNFCPPNF  120



>emb|CDX74942.1| BnaA05g06880D [Brassica napus]
Length=263

 Score =   168 bits (426),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 95/113 (84%), Gaps = 2/113 (2%)
 Frame = +2

Query  101  VRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQG  277
            +R + +A+     LT  +A+IPGVY+GG WQ AHATFYGG+DASGTMGGA GYGNLYSQG
Sbjct  8    IRFMWLAVTASLMLTVTNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQG  67

Query  278  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YGVN AALSTALFNNG SCGACFE+KC++D R C PGNPSI VTATNFCPPNF
Sbjct  68   YGVNTAALSTALFNNGFSCGACFELKCTDDPRWCVPGNPSILVTATNFCPPNF  120



>ref|XP_008384848.1| PREDICTED: expansin-A4 [Malus domestica]
Length=260

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 94/108 (87%), Gaps = 2/108 (2%)
 Frame = +2

Query  116  IALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNN  292
            IA L+ SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGA GYGNLYSQGYGVN 
Sbjct  10   IASLIISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNT  69

Query  293  AALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            AALSTALFNNGLSCGACFE+KC+ D S C  G+PSIF+TATNFCPPNF
Sbjct  70   AALSTALFNNGLSCGACFELKCAEDPSWCHAGSPSIFITATNFCPPNF  117



>ref|XP_010922313.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A4-like [Elaeis guineensis]
Length=258

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA +R++ +A LL  L    ARIPGVYS G WQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAILRLVALASLLAFLVPAAARIPGVYSSGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGV  AALSTALFN+G+SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  61   QGYGVETAALSTALFNDGMSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNY  115



>emb|CDY47883.1| BnaA07g14280D [Brassica napus]
Length=260

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +2

Query  107  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            VLCI  +L   T +   RIPGVY+GG W+TAHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  7    VLCILTILADFTTITEGRIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  284  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNF
Sbjct  67   VNTAALSTALFNNGYSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNF  117



>ref|XP_002283358.1| PREDICTED: expansin-A4 [Vitis vinifera]
 emb|CBI31662.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            M  V V+C   +   L    ARIPGVY+GG WQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MGLVAVVCFVAMASVLKLGEARIPGVYTGGGWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFE+KC+ND   C  G+PSI +TATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPEWCHSGSPSILITATNFCPPNY  115



>ref|XP_010043542.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 ref|XP_010043543.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 gb|KCW85556.1| hypothetical protein EUGRSUZ_B02355 [Eucalyptus grandis]
Length=260

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 95/111 (86%), Gaps = 2/111 (2%)
 Frame = +2

Query  107  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            V   +L+  SL  +  ARIPGVYSGG WQTAHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  7    VFAASLISFSLMWLADARIPGVYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  284  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            VN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIFVTATNFCPPNF
Sbjct  67   VNTAALSTALFNNGLSCGACFEIKCANDPTWCHSGSPSIFVTATNFCPPNF  117



>ref|XP_010521846.1| PREDICTED: expansin-A6 [Tarenaya hassleriana]
Length=259

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA + ++ +  +L SLT +  ARIPGVY GGAWQ AHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MAMISLVFVLTILVSLTLMSEARIPGVYGGGAWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNG  CGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  61   SQGYGVNTAALSTALFNNGFRCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  116



>ref|XP_010414459.1| PREDICTED: expansin-A6-like [Camelina sativa]
Length=257

 Score =   167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = +2

Query  110  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVN  289
            L + +L   L  + ARIPGVY+GG W+TAHATFYGG+DASGTMGGA GYGNLYSQGYGVN
Sbjct  6    LVLFVLTILLATIEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  290  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
             AALSTALFNNG SCGACFE+KC++D R C  G+PSIFVTATNFCPPNF
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFVTATNFCPPNF  114



>gb|ABK93258.1| unknown [Populus trichocarpa]
Length=182

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 98/119 (82%), Gaps = 5/119 (4%)
 Frame = +2

Query  92   MAAVRVLC----IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYG  259
            MA   +LC    + +++  +    ARIPGVYSGGAWQTAHATFYGGADASGTMGGA GYG
Sbjct  1    MAMGSLLCFTTSLLIMMSLMWKGEARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  60

Query  260  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            NLYSQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNY  119



>gb|KJB78839.1| hypothetical protein B456_013G022200 [Gossypium raimondii]
Length=258

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA     C+  LL  +  V ARIPGVYS GAWQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MANWVDTCLVSLLFIIVTVEARIPGVYSDGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNG SCGACFEIKC N  + C  G+PSIF+TATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCVNQPQWCHSGSPSIFITATNFCPPNY  115



>ref|XP_010534508.1| PREDICTED: expansin-A4 [Tarenaya hassleriana]
Length=261

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 94/112 (84%), Gaps = 1/112 (1%)
 Frame = +2

Query  101  VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGY  280
            + V  + L +  L+   ARIPG+YSG AWQ+AHATFYGG+DASGTMGGA GYGNLYSQGY
Sbjct  7    ILVTALPLFVLFLSFADARIPGIYSGSAWQSAHATFYGGSDASGTMGGACGYGNLYSQGY  66

Query  281  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            GVN AALSTALFNNG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPNF
Sbjct  67   GVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNF  118



>gb|EYU26594.1| hypothetical protein MIMGU_mgv1a012061mg [Erythranthe guttata]
Length=262

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +2

Query  95   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQ  274
            AA  +L I  +LC +T   A+I GVY+GG WQ AHATFYGG+DASGTMGGA GYGNLYSQ
Sbjct  4    AATLLLYIGSILCFITTARAKIFGVYAGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  275  GYGVNNAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPN  430
            GYGVN AALSTALFNNGLSCGACFEIKC    + +SC+PG+PSI +TATNFCPPN
Sbjct  64   GYGVNTAALSTALFNNGLSCGACFEIKCDAAQDSKSCNPGSPSILITATNFCPPN  118



>gb|KJB08889.1| hypothetical protein B456_001G111100 [Gossypium raimondii]
Length=260

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +2

Query  107  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            V CI L L S   +  ARIPGVYSGGAWQ AHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  7    VACILLFLSSTMWMGEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  284  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            VN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  67   VNTAALSTALFNNGFSCGACFEIKCASDPQWCHSGSPSIFITATNFCPPNY  117



>dbj|BAN09210.1| alpha expansin [Eustoma exaltatum subsp. russellianum]
Length=262

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 89/98 (91%), Gaps = 3/98 (3%)
 Frame = +2

Query  149  HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALFNNGL  328
             ARIPGVYSGGAW++AHATFYGG+DASGTMGGA GYGNLYSQGYGVN AALSTALFNNGL
Sbjct  22   EARIPGVYSGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  81

Query  329  SCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNF  433
            SCGACFEIKC ND   R C PG+PSIF+TATNFCPPN+
Sbjct  82   SCGACFEIKCINDPNWRWCHPGSPSIFITATNFCPPNY  119



>emb|CDY07642.1| BnaA03g18690D [Brassica napus]
Length=258

 Score =   167 bits (423),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA  ++  +       T   A+IPGVYSGGAWQTAHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAITKLAVLFTTFVLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYG N AALSTALFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNF
Sbjct  61   QGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNF  115



>ref|XP_006294816.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
 gb|EOA27714.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
Length=262

 Score =   167 bits (423),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 94/112 (84%), Gaps = 4/112 (4%)
 Frame = +2

Query  110  LCIALLLCS---LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGY  280
            +C+ L + +   LTA  A+I GVYSGG WQ AHATFYGG+DASGTMGGA GYGNLYSQGY
Sbjct  8    ICLWLAVTASFLLTASDAKIAGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGY  67

Query  281  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            GVN AALSTALFNNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNF
Sbjct  68   GVNTAALSTALFNNGYSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNF  119



>ref|XP_010690765.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=258

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 100/116 (86%), Gaps = 3/116 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSL-TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA++ +L I L L SL + +HAR PGVYS G WQ+AHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MASI-ILPITLSLFSLFSLIHARYPGVYSRGGWQSAHATFYGGSDASGTMGGACGYGNLY  59

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFN+G SCGACFE+KC++D R C PG+PSIF+TATNFCPPN+
Sbjct  60   SQGYGVNTAALSTALFNSGQSCGACFELKCADDPRWCHPGSPSIFITATNFCPPNY  115



>ref|XP_006480833.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO51152.1| hypothetical protein CISIN_1g025025mg [Citrus sinensis]
Length=259

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA  R+LC   +  SL A  +A+IPGV++GG WQ+AHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MALFRMLCFFSVALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNGLSCGACFE+KC  D + C+PGNP+I +TATNFCPPNF
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNF  116



>ref|XP_011089478.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=260

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +2

Query  107  VLCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            ++CIA L+  L     ARIPGVY+GG WQTAHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  7    IVCIASLISVLQPPAEARIPGVYTGGGWQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  284  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            VN AALSTALFNNG SCGACFEIKC+ ++  C  G+PSIFVTATNFCPPN+
Sbjct  67   VNTAALSTALFNNGFSCGACFEIKCAMEKQWCHAGSPSIFVTATNFCPPNY  117



>gb|KDP44940.1| hypothetical protein JCGZ_01440 [Jatropha curcas]
Length=258

 Score =   167 bits (422),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            M     + I  LL  L    ARIPGVYSGG+W++AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MGLKGTISIFCLLLVLKLADARIPGVYSGGSWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNY  115



>ref|XP_002881024.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57283.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   166 bits (421),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = +2

Query  110  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVN  289
            L +++L   L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGA GYGNLYSQGYGVN
Sbjct  6    LVLSVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  290  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
             AALSTALFNNG SCGACFE+KC++D R C  G+PSIF+TATNFCPPNF
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFITATNFCPPNF  114



>ref|XP_006411198.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
 gb|ESQ52651.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
Length=258

 Score =   166 bits (421),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 94/115 (82%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA V+++ +      L    A+IPGVYSGGAWQTAHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAIVKLVILFTTFLFLNIADAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYG N AALSTALFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPN 
Sbjct  61   QGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNL  115



>ref|XP_002313434.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|EEE87389.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   166 bits (421),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 98/119 (82%), Gaps = 5/119 (4%)
 Frame = +2

Query  92   MAAVRVLC----IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYG  259
            MA   +LC    + +++  +    ARIPGVYSGGAWQTAHATFYGGADASGTMGGA GYG
Sbjct  1    MAMGSLLCFTTSLLIMMSLMWKGEARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  60

Query  260  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            NLYSQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNY  119



>gb|KHG24991.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=260

 Score =   166 bits (421),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = +2

Query  95   AAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
             A  V CI L + S   +  ARIPGVYSGGAWQ AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  3    VASAVACIFLFISSTMWMGEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYS  62

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  63   QGYGVNTAALSTALFNNGFSCGACFEIKCASDPQWCHSGSPSIFITATNFCPPNY  117



>ref|XP_010264435.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   166 bits (421),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 87/97 (90%), Gaps = 1/97 (1%)
 Frame = +2

Query  146  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALFNNG  325
            V ARIPGVYSGG WQ AHATFYGG+DASGTMGGA GYGNLYSQGYGVN AALSTALFNNG
Sbjct  21   VDARIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  80

Query  326  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            LSCGACFEIKC+ND + C PG PSI +TATNFCPPNF
Sbjct  81   LSCGACFEIKCANDPQWCHPGGPSILITATNFCPPNF  117



>ref|XP_006366490.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=257

 Score =   166 bits (420),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = +2

Query  110  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVN  289
             C+ ++L  +  V  RIPGVYSGG+WQ AHATFYGG+DASGTMGGA GYGNLYSQGYGVN
Sbjct  6    FCLIIILVIIVGVEGRIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  290  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            NAALSTALFNNGLSCGACFEIKC N  + C PG+PSI +TATNFCPPN+
Sbjct  66   NAALSTALFNNGLSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNY  114



>ref|XP_010490643.1| PREDICTED: expansin-A9 [Camelina sativa]
Length=258

 Score =   166 bits (420),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA  +  +A+++ +   V+A+IPGVY+GG W  AHATFYG ADASGTMGGA GYGNLYS
Sbjct  1    MAAKVLTLMAVMVVTAFTVNAKIPGVYNGGPWTNAHATFYGEADASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNF  115



>gb|AAK48848.1|AF350939_1 expansin [Prunus cerasus]
Length=260

 Score =   166 bits (420),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 95/109 (87%), Gaps = 2/109 (2%)
 Frame = +2

Query  113  CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVN  289
            C+A LL S+  V  ARIPGVY+G AW+ AHATFYGG+DASGTMGGA GYGNLYSQGYGV+
Sbjct  9    CLASLLISVMWVAEARIPGVYTGDAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  290  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNF
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNF  117



>gb|ACN94264.1| expansin [Rehmannia glutinosa]
 gb|ACN94265.1| expansin [Rehmannia glutinosa]
Length=260

 Score =   166 bits (420),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 97/117 (83%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRVL-CIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            MA + V+ CIA L+  L   + ARIPG Y GGAWQ AHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MALLAVIACIASLISVLPPPIEARIPGNYGGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALFNNG SCGACFEIKC+ND+  C  G+PSIFVTATNFCPPN+
Sbjct  61   YSQGYGVNTAALSTALFNNGFSCGACFEIKCANDKQWCHAGSPSIFVTATNFCPPNY  117



>ref|XP_007141864.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
 gb|ESW13858.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
Length=260

 Score =   166 bits (420),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +2

Query  116  IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNA  295
            ++L+   L +  ARIPGVY GGAW+TAHATFYGG+DASGTMGGA GYGNLYSQGYGVN A
Sbjct  11   VSLVTVLLASAEARIPGVYGGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTA  70

Query  296  ALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            ALSTALFN+GLSCGACFEIKC++D S C  G+PSI VTATNFCPPN+
Sbjct  71   ALSTALFNSGLSCGACFEIKCADDPSWCHAGSPSILVTATNFCPPNY  117



>ref|XP_004486999.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 96/111 (86%), Gaps = 2/111 (2%)
 Frame = +2

Query  107  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            ++ I  L+ SLT +  +RIPG Y+GGAW+TAHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  4    IVYIVSLIMSLTWLAESRIPGNYNGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  63

Query  284  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            VN AALSTALFN GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+
Sbjct  64   VNTAALSTALFNKGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNY  114



>emb|CAA04385.1| Expansin [Brassica napus]
Length=260

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 94/111 (85%), Gaps = 2/111 (2%)
 Frame = +2

Query  107  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMG A GYGNLY++GYG
Sbjct  7    VLCLLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGSACGYGNLYTKGYG  66

Query  284  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNF
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNF  117



>gb|ABO30976.2| alpha expansin protein 1 [Calotropis procera]
Length=260

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 96/117 (82%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA V + CI  +L  L   + ARIPGVYSGG WQ AHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MAMVNLACIVSILSLLVVGIQARIPGVYSGGTWQRAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  S-QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            S   YGVN AALSTALFNNGLSCGACFEIKC+N+ + C PG+PSIF+TATNFCPPNF
Sbjct  61   SPNEYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHPGSPSIFITATNFCPPNF  117



>ref|XP_010510558.1| PREDICTED: expansin-A6 [Camelina sativa]
 ref|XP_010470018.1| PREDICTED: expansin-A6 [Camelina sativa]
Length=256

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +2

Query  116  IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNA  295
            +  +L  L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGA GYGNLYSQGYGVN A
Sbjct  7    VLFVLTILATSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTA  66

Query  296  ALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            ALSTALFNNG SCGACFE+KC++D R C  G+PSIFVTATNFCPPNF
Sbjct  67   ALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFVTATNFCPPNF  113



>ref|XP_002870966.1| ATEXPA9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47225.1| ATEXPA9 [Arabidopsis lyrata subsp. lyrata]
Length=258

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA  +  +A+++ +   V+A+IPGVY+GG W  AHATFYG ADASGTMGGA GYGNLYS
Sbjct  1    MAARVITLMAVMVVTAFTVNAKIPGVYTGGPWINAHATFYGEADASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCG+C+E+KC ND   C PGNPSI VTATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCYELKCVNDPGWCLPGNPSILVTATNFCPPNF  115



>ref|XP_009122794.1| PREDICTED: expansin-A9 [Brassica rapa]
 emb|CDY40344.1| BnaA10g27240D [Brassica napus]
Length=258

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 92/115 (80%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA  +  + +     T V+ARIPGVY+GG W  AHATFYG ADASGTMGGA GYGNLYS
Sbjct  1    MAAKIMTLMVVAALVATTVNARIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFE+KC ND   C PGNPSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNF  115



>ref|XP_010558331.1| PREDICTED: expansin-A9 [Tarenaya hassleriana]
Length=268

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 93/116 (80%), Gaps = 3/116 (3%)
 Frame = +2

Query  89   KMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            K+ AV     A  L +   V A+IPGVYSGG W  AHATFYGGADASGTMGGA GYGNLY
Sbjct  11   KLVAVVPAVTASFLAA--EVDAKIPGVYSGGPWIDAHATFYGGADASGTMGGACGYGNLY  68

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNGLSCGACFE+KC +D R C PGNPSI +TATNFCPPNF
Sbjct  69   SQGYGVNTAALSTALFNNGLSCGACFELKCIDDPRWCLPGNPSILITATNFCPPNF  124



>ref|XP_009124371.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A6 [Brassica rapa]
Length=260

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 93/111 (84%), Gaps = 2/111 (2%)
 Frame = +2

Query  107  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            VLCI  +L   T +   RIPGVY+GG W+TAHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  7    VLCILTILADFTTITEGRIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  284  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            VN AALSTALFNNG SCGACFE+ C++D + C  G+PSIFVTATNFCPPNF
Sbjct  67   VNTAALSTALFNNGYSCGACFELXCASDPKWCHSGSPSIFVTATNFCPPNF  117



>ref|NP_001288961.1| expansin-A4 precursor [Brassica rapa]
 gb|AGM16346.1| alpha-expansin protein 4 [Brassica rapa]
Length=258

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 97/117 (83%), Gaps = 5/117 (4%)
 Frame = +2

Query  92   MAAVR--VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            MA ++  +L  A LL +L    ARIPGVYSGGAWQ AHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MAVIKLAILFTAYLLFNL--ADARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNL  58

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YSQGYG N AALSTALFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNF
Sbjct  59   YSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNF  115



>gb|KFK32246.1| hypothetical protein AALP_AA6G217100 [Arabis alpina]
Length=257

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 94/110 (85%), Gaps = 3/110 (3%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            VL +  +L  LT   ARIPGVY+GG W+TAHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  7    VLLVLTILADLT--EARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  64

Query  287  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            N AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNF
Sbjct  65   NTAALSTALFNNGYSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNF  114



>ref|NP_001234761.1| expansin18 precursor [Solanum lycopersicum]
 emb|CAA06271.2| expansin18 [Solanum lycopersicum]
Length=260

 Score =   166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 95/111 (86%), Gaps = 4/111 (4%)
 Frame = +2

Query  110  LCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
             C+A L  L  LTA  ARIPGV++ GAWQ+AHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  8    FCVASLFSLILLTA-EARIPGVFTAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  284  VNNAALSTALFNNGLSCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNF  433
            VNN ALSTALFNNGLSCGACFEIKC N  + C PG+PSIF+TATNFCPPNF
Sbjct  67   VNNGALSTALFNNGLSCGACFEIKCDNYPQWCHPGSPSIFITATNFCPPNF  117



>gb|KHN30166.1| Expansin-A4 [Glycine soja]
Length=292

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 94/108 (87%), Gaps = 4/108 (4%)
 Frame = +2

Query  122  LLLCSLT---AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNN  292
            +LLC ++    V ARIPGVYSGGAWQ AHATFYGG+DASGTMGGA GYGNLYSQGYGVN 
Sbjct  7    VLLCLMSLMWMVDARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNT  66

Query  293  AALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCP N+
Sbjct  67   AALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPSNY  114



>ref|XP_011077214.1| PREDICTED: expansin-A6-like [Sesamum indicum]
Length=259

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA +   CIA LL  L + V  RIPGVY+GGAWQTAHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MATMGFSCIAALLLLLLSYVECRIPGVYTGGAWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNG SCGACFEIKC ++ + C PG+PSIF+TATNFCPPN+
Sbjct  61   SQGYGVNTAALSTALFNNGFSCGACFEIKCRDEPQWCHPGSPSIFITATNFCPPNY  116



>ref|XP_009613959.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 88/97 (91%), Gaps = 1/97 (1%)
 Frame = +2

Query  146  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALFNNG  325
            V ARIPGVY+GG+WQTAHATFYGG+DASGTMGGA GYGNLYSQGYGVNNAALSTALFNNG
Sbjct  21   VEARIPGVYTGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  80

Query  326  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            LSCGACFEIKC N  + C  G+PSI +TATNFCPPN+
Sbjct  81   LSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNY  117



>emb|CDY10456.1| BnaCnng03570D [Brassica napus]
Length=258

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 92/115 (80%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA  +  + +     T V+ARIPGVY+GG W  AHATFYG ADASGTMGGA GYGNLYS
Sbjct  1    MAAKIMTLMVVAALVATTVNARIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCGACFE+KC ND   C PGNPSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNF  115



>gb|KHG29956.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=258

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA      +  L+   TAV ARIPG YSGG WQ+AHATFYGG DASGTMGGA GYGNLYS
Sbjct  1    MAIKGFTYLVYLIIISTAVEARIPGFYSGGEWQSAHATFYGGNDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGV+ AALSTALFNNG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+
Sbjct  61   QGYGVSTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNY  115



>gb|KCW65541.1| hypothetical protein EUGRSUZ_G02938 [Eucalyptus grandis]
Length=259

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAV-RVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA+V RV+ +  L+   T   ARIPGVY+GG WQ+AHATFYGG+DASGTMGGA GYGNLY
Sbjct  1    MASVSRVVGLVSLILFSTLAEARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNG SCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+
Sbjct  61   SQGYGVNTAALSTALFNNGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNY  116



>gb|AAM62987.1| expansin AtEx6 [Arabidopsis thaliana]
Length=257

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = +2

Query  110  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVN  289
            L +++L   L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGA GYGNLYSQGYGVN
Sbjct  6    LVLSVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  290  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
             AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNF
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNF  114



>ref|XP_004145295.1| PREDICTED: expansin-A4-like [Cucumis sativus]
Length=258

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 94/110 (85%), Gaps = 2/110 (2%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            +LCIA L+ ++    ARIPG+YSGG W++AHATFYGG+DASGTMG   GYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTMGRC-GYGNLYSQGYGV  65

Query  287  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNF
Sbjct  66   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNF  115



>ref|NP_001233958.1| expansin precursor [Solanum lycopersicum]
 gb|AAC63088.1| expansin [Solanum lycopersicum]
 gb|AAQ12264.1| expansin 1 protein [Solanum lycopersicum]
Length=261

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 93/114 (82%), Gaps = 3/114 (3%)
 Frame = +2

Query  101  VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGY  280
            + +L +  +      V  RIPGVYSGG+W+TAHATFYGG+DASGTMGGA GYGNLYSQGY
Sbjct  5    IFILVLLFVDSCFNIVEGRIPGVYSGGSWETAHATFYGGSDASGTMGGACGYGNLYSQGY  64

Query  281  GVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNF  433
            GVN AALSTALFNNGLSCGACFE+KC+N    + C PGNPSI +TATNFCPPN+
Sbjct  65   GVNTAALSTALFNNGLSCGACFELKCTNTPNWKWCLPGNPSILITATNFCPPNY  118



>gb|EYU18981.1| hypothetical protein MIMGU_mgv1a012125mg [Erythranthe guttata]
Length=260

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 97/117 (83%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRVL-CIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            MA + V+ CIA ++  L   + ARIPGVYSGG WQ AHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MALLAVIACIATIVSVLPPPIEARIPGVYSGGGWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            YSQGYGVN AALSTALFNNG SCGACFEIKC+N++  C  G+PSI VTATNFCPPN+
Sbjct  61   YSQGYGVNTAALSTALFNNGFSCGACFEIKCANEKQWCHAGSPSILVTATNFCPPNY  117



>ref|NP_180461.1| expansin A6 [Arabidopsis thaliana]
 sp|Q38865.2|EXPA6_ARATH RecName: Full=Expansin-A6; Short=AtEXPA6; AltName: Full=Alpha-expansin-6; 
Short=At-EXP6; Short=AtEx6; AltName: Full=Ath-ExpAlpha-1.8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC33223.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAL25606.1| At2g28950/F8N16.24 [Arabidopsis thaliana]
 gb|AAB38072.2| expansin At-EXPA6 [Arabidopsis thaliana]
 gb|AAL62401.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAM15074.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAO30068.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AEC08194.1| expansin A6 [Arabidopsis thaliana]
Length=257

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = +2

Query  110  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVN  289
            L +++L   L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGA GYGNLYSQGYGVN
Sbjct  6    LVLSVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  290  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
             AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNF
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNF  114



>emb|CDY69611.1| BnaCnng64440D [Brassica napus]
Length=258

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 97/117 (83%), Gaps = 5/117 (4%)
 Frame = +2

Query  92   MAAVR--VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            MA ++  +L  A LL +L    ARIPGVYSGGAWQ AHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MAIIKLAILFTAYLLFNL--ADARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNL  58

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YSQGYG N AALSTALFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNF
Sbjct  59   YSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNF  115



>ref|XP_008777004.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=258

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA +R++ +A +L  L+   ARI GVY+GGAWQ+AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAILRLVALASVLAFLSPAAARILGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGV  AALSTALFN G SCGACFEIKC++D S C  G+PSIF+TATNFCPPN+
Sbjct  61   QGYGVETAALSTALFNEGQSCGACFEIKCADDPSWCHRGSPSIFITATNFCPPNY  115



>ref|NP_001150534.1| alpha-expansin 6 precursor [Zea mays]
 gb|ACG39445.1| alpha-expansin 6 precursor [Zea mays]
Length=263

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 92/113 (81%), Gaps = 8/113 (7%)
 Frame = +2

Query  119  ALLLCSLTAVH-----ARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYG  283
            ALLL   TA+      ARIPGVY GG WQ+AHATFYGG+DASGTMGGA GYGNLYSQGYG
Sbjct  7    ALLLVVATAMMFSPAAARIPGVYGGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  284  VNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNF  433
            VNNAALSTALFN GLSCGACFEIKC +    R C PG+PSI VTATNFCPPN+
Sbjct  67   VNNAALSTALFNQGLSCGACFEIKCEDQPGWRWCRPGSPSILVTATNFCPPNY  119



>ref|XP_006350774.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=260

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 95/117 (81%), Gaps = 3/117 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAV--HARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNL  265
            M  + V C    L SL  +   ARIPGV++ GAWQ+AHATFYGG+DASGTMGGA GYGNL
Sbjct  1    MGFLNVACCVASLFSLILLTAEARIPGVFTAGAWQSAHATFYGGSDASGTMGGACGYGNL  60

Query  266  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNF  433
            YSQGYGVNN ALSTALFNNGLSCGACFEIKC N  + C PG+PSIF+TATNFCPPNF
Sbjct  61   YSQGYGVNNGALSTALFNNGLSCGACFEIKCDNYPQWCHPGSPSIFITATNFCPPNF  117



>ref|XP_009141827.1| PREDICTED: expansin-A4-like [Brassica rapa]
Length=258

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA  ++  +       T   A+IPGVYSGGAWQTAHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAITKLAVLFTTFVLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYG N AALSTALFN+G+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNF
Sbjct  61   QGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNF  115



>ref|XP_008784594.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=260

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = +2

Query  125  LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALS  304
            LL  LT   ARIPGVY+GG WQTAHATFYGG+DASGTMGGA GYGNLYSQGYGV  AALS
Sbjct  14   LLAFLTLADARIPGVYAGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALS  73

Query  305  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            TALFN+GLSCGACFEIKC  + R C PG+PSI +TATNFCPPN+
Sbjct  74   TALFNDGLSCGACFEIKCGEEPRWCHPGSPSILITATNFCPPNY  117



>emb|CDY07024.1| BnaA04g22910D [Brassica napus]
Length=258

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA  ++  +       T   A+IPGVYSGGAWQTAHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAITKLAVLFTTFVLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYG N AALSTALFN+G+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNF
Sbjct  61   QGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNF  115



>ref|XP_010532011.1| PREDICTED: expansin-A4-like [Tarenaya hassleriana]
Length=261

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 3/113 (3%)
 Frame = +2

Query  104  RVL--CIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQG  277
            R+L   + L +   +   ARIPGVYSGGAWQ+AHATFYGG DASGTMGGA GYGNLYSQG
Sbjct  6    RILLNTLPLFVLFFSFADARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGNLYSQG  65

Query  278  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YGVN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPNF
Sbjct  66   YGVNTAALSTALFNNGFSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNF  118



>ref|XP_010067412.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
Length=307

 Score =   166 bits (419),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 97/116 (84%), Gaps = 2/116 (2%)
 Frame = +2

Query  92   MAAV-RVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLY  268
            MA+V RV+ +  L+   T   ARIPGVY+GG WQ+AHATFYGG+DASGTMGGA GYGNLY
Sbjct  49   MASVSRVVGLVSLILFSTLAEARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLY  108

Query  269  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            SQGYGVN AALSTALFNNG SCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+
Sbjct  109  SQGYGVNTAALSTALFNNGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNY  164



>emb|CDY24952.1| BnaC03g22200D [Brassica napus]
Length=258

 Score =   164 bits (416),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 92/115 (80%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA +++  +           ARIPGVYSGGAWQ AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAIIKLAILFTTYLLFNLADARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYG N AALSTALFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNF
Sbjct  61   QGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNF  115



>ref|XP_006398690.1| hypothetical protein EUTSA_v10014430mg [Eutrema salsugineum]
 gb|ESQ40143.1| hypothetical protein EUTSA_v10014430mg [Eutrema salsugineum]
Length=261

 Score =   164 bits (416),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 95/118 (81%), Gaps = 4/118 (3%)
 Frame = +2

Query  92   MAAVRVLCIALLLC---SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGN  262
            MAA  +  +A+++    + T V A+IPGVY+GG W  AHATFYG ADASGTMGGA GYGN
Sbjct  1    MAAKVITVMAVMVVAALTATTVSAKIPGVYTGGPWVNAHATFYGEADASGTMGGACGYGN  60

Query  263  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            LYSQGYGVN AALSTALFNNG+SCGACFE+KC ND   C PGNPSI +TATNFCPPNF
Sbjct  61   LYSQGYGVNTAALSTALFNNGVSCGACFELKCVNDPGWCLPGNPSILITATNFCPPNF  118



>gb|ACT67493.1| expansin A1 [Raphanus sativus]
Length=258

 Score =   164 bits (415),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MA  ++  +       +   A+IPGVYSGGAWQTAHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MAITKIAILFTTFVLFSLADAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYG N AALSTALFN+G+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNF
Sbjct  61   QGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNF  115



>ref|NP_195846.1| expansin A9 [Arabidopsis thaliana]
 sp|Q9LZ99.1|EXPA9_ARATH RecName: Full=Expansin-A9; Short=AtEXPA9; AltName: Full=Alpha-expansin-9; 
Short=At-EXP9; Short=AtEx9; AltName: Full=Ath-ExpAlpha-1.10; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB85531.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AAK96777.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AAL47389.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AAM63290.1| expansin precursor-like protein [Arabidopsis thaliana]
 gb|AED90451.1| expansin A9 [Arabidopsis thaliana]
Length=258

 Score =   164 bits (415),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 94/115 (82%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            MAA  +  +A+++ +    +A+IPGVY+GG W  AHATFYG ADASGTMGGA GYGNLYS
Sbjct  1    MAAKVITFMAVMVVTAFTANAKIPGVYTGGPWINAHATFYGEADASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNF  433
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNF
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNF  115



>ref|XP_006846223.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
 gb|ERN07898.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
Length=258

 Score =   164 bits (415),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  92   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYS  271
            M+   VL +ALL   +    ARIPGVYSG  W++AHATFYGG+DASGTMGGA GYGNLYS
Sbjct  1    MSPKWVLALALLASIMVPAFARIPGVYSGSDWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  272  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            QGYGV  AALSTALFN+GLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+
Sbjct  61   QGYGVETAALSTALFNSGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNY  115



>ref|XP_009409516.1| PREDICTED: expansin-A6-like [Musa acuminata subsp. malaccensis]
Length=261

 Score =   164 bits (414),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 92/113 (81%), Gaps = 1/113 (1%)
 Frame = +2

Query  98   AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQG  277
            A+ V    +L  S     ARIPGVY+GG WQTAHATFYGG+DASGTMGGA GYGNLYSQG
Sbjct  6    ALAVTVALVLASSALLADARIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQG  65

Query  278  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            YGV  AALSTAL+N+GL CGACFEIKC++D R C  GNPSIF+TATNFCPPN+
Sbjct  66   YGVETAALSTALYNDGLRCGACFEIKCADDPRWCKGGNPSIFITATNFCPPNY  118



>ref|XP_009380637.1| PREDICTED: expansin-A4 [Musa acuminata subsp. malaccensis]
Length=262

 Score =   164 bits (414),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 93/114 (82%), Gaps = 1/114 (1%)
 Frame = +2

Query  95   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQ  274
            +AV      +L  S     ARIPGVY+GG WQ+AHATFYGG+DASGTMGGA GYGNLYSQ
Sbjct  6    SAVAATVALVLASSALLADARIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQ  65

Query  275  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            GYGV  AALSTALFN+GLSCGACFEIKC++D R C  G+PSIF+TATNFCPPN+
Sbjct  66   GYGVETAALSTALFNDGLSCGACFEIKCADDPRWCKGGSPSIFITATNFCPPNY  119



>emb|CDP00110.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   164 bits (414),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            + CI  L   LT   ARIPGVY+G +W++AHATFYGG+DASGTMGGA GYGNLYSQGYGV
Sbjct  3    LTCIIALSLLLTPTEARIPGVYTGDSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  62

Query  287  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            N AALSTALFNNG SCG+CFE+KC++D + C PG+PSI +TATNFCPPN+
Sbjct  63   NTAALSTALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNY  112



>ref|XP_002878036.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54295.1| ATEXPA16 [Arabidopsis lyrata subsp. lyrata]
Length=260

 Score =   164 bits (414),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +2

Query  107  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGV  286
            +L I  L   L+   A IPGVYSGG+WQTAHATFYGG DASGTMGGA GYGNLYSQGYG 
Sbjct  8    LLTIFPLFLLLSFTDAGIPGVYSGGSWQTAHATFYGGNDASGTMGGACGYGNLYSQGYGT  67

Query  287  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            N AALSTALFN+G SCGACFEIKC ND + C PGNPS+FVTATNFCPPN 
Sbjct  68   NTAALSTALFNSGQSCGACFEIKCVNDPKWCHPGNPSVFVTATNFCPPNL  117



>ref|XP_002266625.1| PREDICTED: expansin-A6 [Vitis vinifera]
 emb|CAN65872.1| hypothetical protein VITISV_000251 [Vitis vinifera]
 emb|CBI30547.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   163 bits (413),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 89/97 (92%), Gaps = 1/97 (1%)
 Frame = +2

Query  146  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALFNNG  325
            VHARIPGVY+ G W++AHATFYGG+DASGTMGGA GYGNLYSQGYGVN AALSTALFN+G
Sbjct  19   VHARIPGVYTSGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSG  78

Query  326  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  433
            LSCGACFEIKC+ND + C  G+PSIFVTATNFCPPN+
Sbjct  79   LSCGACFEIKCANDPKWCHSGSPSIFVTATNFCPPNY  115



>gb|AFW67136.1| hypothetical protein ZEAMMB73_591538 [Zea mays]
Length=162

 Score =   160 bits (405),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 85/97 (88%), Gaps = 3/97 (3%)
 Frame = +2

Query  152  ARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAALSTALFNNGLS  331
            ARIPGVY GG WQ+AHATFYGG+DASGTMGGA GYGNLYSQGYGVNNAALSTALFN GLS
Sbjct  25   ARIPGVYGGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNQGLS  84

Query  332  CGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNF  433
            CGACFEIKC +    R C PG+PSI VTATNFCPPN+
Sbjct  85   CGACFEIKCEDQPGWRWCRPGSPSILVTATNFCPPNY  121



>gb|ACO52788.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52789.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52790.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52797.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52798.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52799.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52800.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52801.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52802.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52803.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52805.1| EXP6, partial [Brachypodium distachyon]
 gb|ACO52809.1| EXP6, partial [Brachypodium distachyon]
Length=150

 Score =   160 bits (404),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 88/107 (82%), Gaps = 3/107 (3%)
 Frame = +2

Query  122  LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGAWGYGNLYSQGYGVNNAAL  301
            LLL    A  ARIPGVY+GG WQ+AHATFYGG+DASGTMGGA GYGNLYSQGYGVNNAAL
Sbjct  3    LLLLLPHAAEARIPGVYTGGDWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAAL  62

Query  302  STALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNF  433
            STALFN G  CGACFEIKC N    + C PG+PSI VTATNFCPPN+
Sbjct  63   STALFNGGQRCGACFEIKCVNQPDWKWCHPGSPSILVTATNFCPPNY  109



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566946208800