BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF048L22

Length=390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621389.1|  PREDICTED: protein S-acyltransferase 24          76.6    2e-13   Nicotiana tomentosiformis
ref|XP_009762903.1|  PREDICTED: protein S-acyltransferase 24          75.5    5e-13   Nicotiana sylvestris
ref|XP_008457291.1|  PREDICTED: protein S-acyltransferase 24          75.1    6e-13   Cucumis melo [Oriental melon]
ref|XP_004139278.1|  PREDICTED: S-acyltransferase TIP1-like           75.1    6e-13   Cucumis sativus [cucumbers]
ref|XP_004159427.1|  PREDICTED: S-acyltransferase TIP1-like           74.3    7e-13   
ref|XP_002262878.1|  PREDICTED: protein S-acyltransferase 24          75.1    8e-13   Vitis vinifera
ref|XP_003549717.1|  PREDICTED: protein S-acyltransferase 24-like     73.6    2e-12   Glycine max [soybeans]
gb|KHN47119.1|  S-acyltransferase TIP1                                73.2    3e-12   Glycine soja [wild soybean]
ref|XP_008361110.1|  PREDICTED: protein S-acyltransferase 24-like     73.2    3e-12   
ref|XP_004508416.1|  PREDICTED: S-acyltransferase TIP1-like           72.4    5e-12   Cicer arietinum [garbanzo]
ref|XP_011020239.1|  PREDICTED: protein S-acyltransferase 24-like     72.4    6e-12   Populus euphratica
ref|XP_007204229.1|  hypothetical protein PRUPE_ppa002724mg           71.6    1e-11   Prunus persica
ref|XP_006381078.1|  hypothetical protein POPTR_0006s06050g           71.2    1e-11   
ref|XP_008242880.1|  PREDICTED: protein S-acyltransferase 24          71.2    1e-11   Prunus mume [ume]
gb|KDO73419.1|  hypothetical protein CISIN_1g006702mg                 71.2    2e-11   Citrus sinensis [apfelsine]
ref|XP_006453127.1|  hypothetical protein CICLE_v10007734mg           71.2    2e-11   Citrus clementina [clementine]
gb|KCW83016.1|  hypothetical protein EUGRSUZ_C043982                  70.9    2e-11   Eucalyptus grandis [rose gum]
gb|KCW83019.1|  hypothetical protein EUGRSUZ_C043982                  70.9    2e-11   Eucalyptus grandis [rose gum]
gb|KCW83018.1|  hypothetical protein EUGRSUZ_C043982                  70.9    2e-11   Eucalyptus grandis [rose gum]
ref|XP_009358538.1|  PREDICTED: protein S-acyltransferase 24-like     70.9    2e-11   Pyrus x bretschneideri [bai li]
gb|KCW83017.1|  hypothetical protein EUGRSUZ_C043982                  70.9    2e-11   Eucalyptus grandis [rose gum]
ref|XP_009338389.1|  PREDICTED: protein S-acyltransferase 24-like     70.5    2e-11   Pyrus x bretschneideri [bai li]
gb|KCW83020.1|  hypothetical protein EUGRSUZ_C043982                  70.5    2e-11   Eucalyptus grandis [rose gum]
emb|CDP10489.1|  unnamed protein product                              70.5    2e-11   Coffea canephora [robusta coffee]
ref|XP_010250284.1|  PREDICTED: protein S-acyltransferase 24-like     70.5    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010050124.1|  PREDICTED: protein S-acyltransferase 24-like     70.5    3e-11   Eucalyptus grandis [rose gum]
ref|XP_006389402.1|  hypothetical protein POPTR_0025s00390g           70.1    4e-11   
ref|XP_006400604.1|  hypothetical protein EUTSA_v10012979mg           69.7    5e-11   Eutrema salsugineum [saltwater cress]
ref|XP_006287281.1|  hypothetical protein CARUB_v10000476mg           69.3    6e-11   Capsella rubella
emb|CDY56864.1|  BnaC09g54140D                                        69.3    6e-11   Brassica napus [oilseed rape]
gb|EYU38308.1|  hypothetical protein MIMGU_mgv1a002757mg              69.3    7e-11   Erythranthe guttata [common monkey flower]
gb|KJB64636.1|  hypothetical protein B456_010G059000                  68.6    8e-11   Gossypium raimondii
gb|KDP30210.1|  hypothetical protein JCGZ_16992                       68.9    9e-11   Jatropha curcas
ref|XP_006359506.1|  PREDICTED: protein S-acyltransferase 24-like     68.9    1e-10   Solanum tuberosum [potatoes]
ref|XP_004242727.1|  PREDICTED: protein S-acyltransferase 24 isof...  68.9    1e-10   Solanum lycopersicum
gb|KJB64638.1|  hypothetical protein B456_010G059000                  68.6    1e-10   Gossypium raimondii
gb|KJB64635.1|  hypothetical protein B456_010G059000                  68.6    1e-10   Gossypium raimondii
ref|XP_010454339.1|  PREDICTED: protein S-acyltransferase 24          68.6    1e-10   Camelina sativa [gold-of-pleasure]
emb|CDX92467.1|  BnaA10g15060D                                        68.2    1e-10   
ref|XP_007013621.1|  Ankyrin repeat family protein with DHHC zinc...  68.2    1e-10   
gb|KHG04996.1|  Palmitoyltransferase AKR1                             68.2    2e-10   Gossypium arboreum [tree cotton]
ref|XP_009120814.1|  PREDICTED: protein S-acyltransferase 24-like     68.2    2e-10   Brassica rapa
ref|XP_007155091.1|  hypothetical protein PHAVU_003G172300g           68.2    2e-10   Phaseolus vulgaris [French bean]
ref|XP_008788793.1|  PREDICTED: protein S-acyltransferase 24-like     68.2    2e-10   Phoenix dactylifera
gb|EPS74107.1|  hypothetical protein M569_00641                       67.8    2e-10   Genlisea aurea
ref|XP_002532315.1|  Palmitoyltransferase TIP1, putative              65.9    2e-10   
ref|XP_007013622.1|  Ankyrin repeat family protein with DHHC zinc...  67.4    2e-10   
gb|KJB64637.1|  hypothetical protein B456_010G059000                  67.4    2e-10   Gossypium raimondii
ref|XP_009363933.1|  PREDICTED: protein S-acyltransferase 24-like     67.4    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_008362882.1|  PREDICTED: protein S-acyltransferase 24-like     67.4    3e-10   
ref|XP_008343921.1|  PREDICTED: protein S-acyltransferase 24-like     67.4    3e-10   
ref|XP_008384910.1|  PREDICTED: protein S-acyltransferase 24          67.4    3e-10   
ref|XP_011017904.1|  PREDICTED: protein S-acyltransferase 24-like     67.4    3e-10   Populus euphratica
ref|XP_010112497.1|  S-acyltransferase TIP1                           67.4    3e-10   
ref|XP_011084071.1|  PREDICTED: protein S-acyltransferase 24-like     67.0    4e-10   Sesamum indicum [beniseed]
ref|XP_010244896.1|  PREDICTED: protein S-acyltransferase 24-like     67.0    4e-10   Nelumbo nucifera [Indian lotus]
ref|XP_010928281.1|  PREDICTED: protein S-acyltransferase 24-like...  67.0    4e-10   
ref|XP_007013623.1|  Ankyrin repeat family protein with DHHC zinc...  66.6    4e-10   
ref|NP_197535.2|  S-acyltransferase TIP1                              66.2    7e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010928283.1|  PREDICTED: protein S-acyltransferase 24-like...  65.9    9e-10   
gb|KFK26273.1|  hypothetical protein AALP_AA8G225500                  65.5    1e-09   Arabis alpina [alpine rockcress]
ref|XP_010535848.1|  PREDICTED: protein S-acyltransferase 24          65.1    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_009398663.1|  PREDICTED: protein S-acyltransferase 24-like...  64.3    3e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398664.1|  PREDICTED: protein S-acyltransferase 24-like...  63.5    4e-09   
ref|XP_010520557.1|  PREDICTED: protein S-acyltransferase 24-like...  63.9    4e-09   Tarenaya hassleriana [spider flower]
ref|XP_010520556.1|  PREDICTED: protein S-acyltransferase 24-like...  63.9    4e-09   Tarenaya hassleriana [spider flower]
ref|XP_004287249.1|  PREDICTED: protein S-acyltransferase 24          63.5    6e-09   Fragaria vesca subsp. vesca
gb|KJB53968.1|  hypothetical protein B456_009G014100                  62.4    1e-08   Gossypium raimondii
ref|XP_010420875.1|  PREDICTED: protein S-acyltransferase 24-like     62.4    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010493140.1|  PREDICTED: protein S-acyltransferase 24-like     62.4    1e-08   Camelina sativa [gold-of-pleasure]
gb|KEH32151.1|  palmitoyltransferase TIP1                             62.0    2e-08   Medicago truncatula
ref|XP_006852828.1|  hypothetical protein AMTR_s00033p00182370        62.0    2e-08   
ref|XP_008659786.1|  PREDICTED: protein S-acyltransferase 24-like     62.0    2e-08   Zea mays [maize]
ref|XP_011078543.1|  PREDICTED: LOW QUALITY PROTEIN: protein S-ac...  62.0    2e-08   
gb|KJB53969.1|  hypothetical protein B456_009G014100                  61.6    2e-08   Gossypium raimondii
ref|XP_003609480.1|  S-acyltransferase TIP1                           62.0    2e-08   Medicago truncatula
gb|KEH44378.1|  DHHC-type zinc finger protein                         61.6    2e-08   Medicago truncatula
emb|CDY51852.1|  BnaA03g56190D                                        61.2    4e-08   Brassica napus [oilseed rape]
emb|CDX70923.1|  BnaC03g10070D                                        61.2    4e-08   
ref|XP_009126441.1|  PREDICTED: protein S-acyltransferase 24          61.2    4e-08   Brassica rapa
emb|CDY45091.1|  BnaA02g04850D                                        61.2    4e-08   Brassica napus [oilseed rape]
gb|KFK33845.1|  hypothetical protein AALP_AA5G067400                  60.1    7e-08   Arabis alpina [alpine rockcress]
ref|XP_009392141.1|  PREDICTED: protein S-acyltransferase 24-like     60.1    7e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010687832.1|  PREDICTED: protein S-acyltransferase 24          60.1    8e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG15624.1|  Palmitoyltransferase akr1                             59.7    1e-07   Gossypium arboreum [tree cotton]
ref|XP_002437346.1|  hypothetical protein SORBIDRAFT_10g025310        59.3    1e-07   Sorghum bicolor [broomcorn]
gb|KJB23675.1|  hypothetical protein B456_004G109200                  59.3    2e-07   Gossypium raimondii
gb|KJB23676.1|  hypothetical protein B456_004G109200                  59.3    2e-07   Gossypium raimondii
ref|NP_001058187.1|  Os06g0644500                                     58.5    3e-07   
gb|EEC81067.1|  hypothetical protein OsI_23878                        58.2    3e-07   Oryza sativa Indica Group [Indian rice]
gb|KHG18334.1|  Palmitoyltransferase akr1                             58.2    3e-07   Gossypium arboreum [tree cotton]
gb|KEH44377.1|  translation initiation factor IF-3                    57.4    9e-07   Medicago truncatula
ref|XP_010913354.1|  PREDICTED: protein S-acyltransferase 24-like     56.6    1e-06   Elaeis guineensis
gb|AFW76197.1|  hypothetical protein ZEAMMB73_209183                  55.5    2e-06   
ref|XP_008649039.1|  PREDICTED: protein S-acyltransferase 24          55.8    2e-06   Zea mays [maize]
ref|XP_003563307.1|  PREDICTED: protein S-acyltransferase 24          55.1    4e-06   Brachypodium distachyon [annual false brome]
gb|KCW79059.1|  hypothetical protein EUGRSUZ_C00485                   53.9    8e-06   Eucalyptus grandis [rose gum]
ref|XP_008795828.1|  PREDICTED: protein S-acyltransferase 24 isof...  53.9    1e-05   Phoenix dactylifera
ref|XP_008795826.1|  PREDICTED: protein S-acyltransferase 24 isof...  53.9    1e-05   Phoenix dactylifera
ref|XP_008645333.1|  PREDICTED: protein S-acyltransferase 24-like...  53.5    1e-05   
ref|XP_008645332.1|  PREDICTED: protein S-acyltransferase 24-like...  53.5    1e-05   
ref|XP_008645331.1|  PREDICTED: protein S-acyltransferase 24-like...  53.5    1e-05   
ref|XP_008645330.1|  PREDICTED: protein S-acyltransferase 24-like...  53.5    1e-05   
ref|XP_008645334.1|  PREDICTED: protein S-acyltransferase 24-like...  52.8    2e-05   
ref|XP_003570824.1|  PREDICTED: protein S-acyltransferase 24-like     52.8    2e-05   Brachypodium distachyon [annual false brome]
ref|XP_004965751.1|  PREDICTED: S-acyltransferase TIP1-like           52.8    2e-05   Setaria italica
gb|AFW70467.1|  hypothetical protein ZEAMMB73_828123                  52.4    2e-05   
ref|XP_004951656.1|  PREDICTED: S-acyltransferase TIP1-like isofo...  52.0    4e-05   
ref|XP_004951655.1|  PREDICTED: S-acyltransferase TIP1-like isofo...  52.0    4e-05   
ref|XP_002453418.1|  hypothetical protein SORBIDRAFT_04g005696        51.6    5e-05   
ref|XP_004951654.1|  PREDICTED: S-acyltransferase TIP1-like isofo...  51.6    5e-05   Setaria italica
ref|XP_004951657.1|  PREDICTED: S-acyltransferase TIP1-like isofo...  50.4    8e-05   
dbj|BAJ93741.1|  predicted protein                                    50.1    1e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010050341.1|  PREDICTED: protein S-acyltransferase 24          50.1    1e-04   
gb|KCW79060.1|  hypothetical protein EUGRSUZ_C00485                   50.1    2e-04   Eucalyptus grandis [rose gum]



>ref|XP_009621389.1| PREDICTED: protein S-acyltransferase 24 [Nicotiana tomentosiformis]
Length=631

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 45/71 (63%), Positives = 51/71 (72%), Gaps = 6/71 (8%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            MASEIEVVEE E      +    + +T+      G  VE++SLRNDVYTAAAYGDMEKLQ
Sbjct  1    MASEIEVVEEAE------SINVESTSTAAVNGGGGGGVEDESLRNDVYTAAAYGDMEKLQ  54

Query  357  RLVESEGCSVS  389
            RLVESEGCSVS
Sbjct  55   RLVESEGCSVS  65



>ref|XP_009762903.1| PREDICTED: protein S-acyltransferase 24 [Nicotiana sylvestris]
Length=631

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 51/71 (72%), Gaps = 6/71 (8%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            MASEIEVVEE E      +    + +T+      G  V+++SLRNDVYTAAAYGDMEKLQ
Sbjct  1    MASEIEVVEEAE------SINVESTSTAAVNGGGGGGVDDESLRNDVYTAAAYGDMEKLQ  54

Query  357  RLVESEGCSVS  389
            RLVESEGCSVS
Sbjct  55   RLVESEGCSVS  65



>ref|XP_008457291.1| PREDICTED: protein S-acyltransferase 24 [Cucumis melo]
Length=632

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 8/71 (11%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVV+EV+ RD+  +   + +T +           ++SLRNDVYTAAAYGD+EKLQ
Sbjct  1    MSSEIEVVDEVQSRDQQPSQNASASTANGDA--------DESLRNDVYTAAAYGDLEKLQ  52

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  53   RLVECEGCSVS  63



>ref|XP_004139278.1| PREDICTED: S-acyltransferase TIP1-like [Cucumis sativus]
 gb|KGN60728.1| hypothetical protein Csa_2G008680 [Cucumis sativus]
Length=632

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 8/71 (11%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVV+EV+ RD+  +   + +T +           ++SLRNDVYTAAAYGD+EKLQ
Sbjct  1    MSSEIEVVDEVQSRDQQPSQNASASTANGDA--------DESLRNDVYTAAAYGDLEKLQ  52

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  53   RLVECEGCSVS  63



>ref|XP_004159427.1| PREDICTED: S-acyltransferase TIP1-like [Cucumis sativus]
Length=415

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 8/71 (11%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVV+EV+ RD+  +   + +T +           ++SLRNDVYTAAAYGD+EKLQ
Sbjct  1    MSSEIEVVDEVQSRDQQPSQNASASTANGDA--------DESLRNDVYTAAAYGDLEKLQ  52

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  53   RLVECEGCSVS  63



>ref|XP_002262878.1| PREDICTED: protein S-acyltransferase 24 [Vitis vinifera]
 emb|CBI25565.3| unnamed protein product [Vitis vinifera]
Length=635

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVV+EVE RD       A     +   +     +E SLRNDVYTAAAYGDMEKLQ
Sbjct  1    MSSEIEVVDEVESRDPAINGGGAAGGGFSGEPSGIGAADE-SLRNDVYTAAAYGDMEKLQ  59

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  60   RLVEFEGCSVS  70



>ref|XP_003549717.1| PREDICTED: protein S-acyltransferase 24-like [Glycine max]
Length=633

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 46/71 (65%), Gaps = 19/71 (27%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEEV+ RD  S A                   E+SLRNDVYTAAAYGD+E+LQ
Sbjct  1    MSSEIEVVEEVQSRDEQSGA-------------------EESLRNDVYTAAAYGDLERLQ  41

Query  357  RLVESEGCSVS  389
            RLVE EGC VS
Sbjct  42   RLVEQEGCPVS  52



>gb|KHN47119.1| S-acyltransferase TIP1 [Glycine soja]
Length=677

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 49/71 (69%), Gaps = 9/71 (13%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEEV+ RD  SAA+        +         E+SLRNDVYTAA+YGD+EKLQ
Sbjct  1    MSSEIEVVEEVQSRDEQSAASGGGGDGMGA---------EESLRNDVYTAASYGDLEKLQ  51

Query  357  RLVESEGCSVS  389
            RLVE EGC V+
Sbjct  52   RLVEQEGCPVT  62



>ref|XP_008361110.1| PREDICTED: protein S-acyltransferase 24-like [Malus domestica]
Length=636

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 6/72 (8%)
 Frame = +3

Query  177  MASEIEVVE-EVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVE EV+ RDR SA+A +      +         E+SLRNDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEDEVQTRDRESASANSANNNGEANGIG-----EESLRNDVYTAAAYGDLEKL  55

Query  354  QRLVESEGCSVS  389
            QRLVE EGCSVS
Sbjct  56   QRLVECEGCSVS  67



>ref|XP_004508416.1| PREDICTED: S-acyltransferase TIP1-like [Cicer arietinum]
Length=640

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 50/71 (70%), Gaps = 11/71 (15%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVV+EV+ RD+ S  +++    +           E++LRNDVYTAAAYGD+EKLQ
Sbjct  1    MSSEIEVVDEVQSRDQQSTPSSSADEVA-----------EETLRNDVYTAAAYGDLEKLQ  49

Query  357  RLVESEGCSVS  389
            RLVE EGC V+
Sbjct  50   RLVEQEGCLVT  60



>ref|XP_011020239.1| PREDICTED: protein S-acyltransferase 24-like [Populus euphratica]
Length=638

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 52/74 (70%), Gaps = 8/74 (11%)
 Frame = +3

Query  177  MASEIEVVEE---VEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDME  347
            M+SEIE+VEE    +  DR SAA     + +   VA      EDSLRNDVYTAAAYGD+E
Sbjct  1    MSSEIEIVEEDVVAQSNDRESAAVNGGNSNNGVAVAG-----EDSLRNDVYTAAAYGDLE  55

Query  348  KLQRLVESEGCSVS  389
            KLQRLVESEGCSVS
Sbjct  56   KLQRLVESEGCSVS  69



>ref|XP_007204229.1| hypothetical protein PRUPE_ppa002724mg [Prunus persica]
 gb|EMJ05428.1| hypothetical protein PRUPE_ppa002724mg [Prunus persica]
Length=639

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 46/72 (64%), Positives = 53/72 (74%), Gaps = 4/72 (6%)
 Frame = +3

Query  177  MASEIEVVE-EVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVE EV+ RD  SA A +  +T+N          E+SLRNDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEDEVQTRDHESAGAASANSTNNGDANGIG---EESLRNDVYTAAAYGDLEKL  57

Query  354  QRLVESEGCSVS  389
            QRLVE EGCSVS
Sbjct  58   QRLVECEGCSVS  69



>ref|XP_006381078.1| hypothetical protein POPTR_0006s06050g [Populus trichocarpa]
 gb|ERP58875.1| hypothetical protein POPTR_0006s06050g [Populus trichocarpa]
Length=611

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 51/74 (69%), Gaps = 8/74 (11%)
 Frame = +3

Query  177  MASEIEVVEE---VEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDME  347
            M SEIE+VEE    +  DR SAA     + +   VA      EDSLRNDVYTAAAYGD+E
Sbjct  1    MPSEIEIVEEDVVAQSNDRESAAVNGGISNNGVAVAG-----EDSLRNDVYTAAAYGDLE  55

Query  348  KLQRLVESEGCSVS  389
            KLQRLVESEGCSVS
Sbjct  56   KLQRLVESEGCSVS  69



>ref|XP_008242880.1| PREDICTED: protein S-acyltransferase 24 [Prunus mume]
Length=639

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 45/72 (63%), Positives = 52/72 (72%), Gaps = 4/72 (6%)
 Frame = +3

Query  177  MASEIEVVE-EVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVE EV+ RD  S  A +  +T+N          E+SLRNDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEDEVQTRDHESVGAASAKSTNNGDANGIG---EESLRNDVYTAAAYGDLEKL  57

Query  354  QRLVESEGCSVS  389
            QRLVE EGCSVS
Sbjct  58   QRLVECEGCSVS  69



>gb|KDO73419.1| hypothetical protein CISIN_1g006702mg [Citrus sinensis]
Length=634

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 6/71 (8%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEEV        ++        S  ++G VV+E+SLRNDVYTAAAYGD+EKLQ
Sbjct  1    MSSEIEVVEEV------GQSSQNHHNHDQSSPSNGVVVDEESLRNDVYTAAAYGDLEKLQ  54

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  55   RLVECEGCSVS  65



>ref|XP_006453127.1| hypothetical protein CICLE_v10007734mg [Citrus clementina]
 ref|XP_006474378.1| PREDICTED: protein S-acyltransferase 24-like [Citrus sinensis]
 gb|ESR66367.1| hypothetical protein CICLE_v10007734mg [Citrus clementina]
Length=634

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 51/71 (72%), Gaps = 6/71 (8%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEEV        ++        S  ++G VV+E+SLRNDVYTAAAYGD+EKLQ
Sbjct  1    MSSEIEVVEEV------GQSSQNHHNHDQSSPSNGVVVDEESLRNDVYTAAAYGDLEKLQ  54

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  55   RLVECEGCSVS  65



>gb|KCW83016.1| hypothetical protein EUGRSUZ_C043982 [Eucalyptus grandis]
Length=674

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 4/82 (5%)
 Frame = +3

Query  144  QFKAQFPRGFCMASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYT  323
            + +  FP    M+SEIEVV+E    DR +A A        +  A+ +   E+SLR+DVYT
Sbjct  53   RIRPPFPAA--MSSEIEVVDEARPADRDAAVAGGAVAAGAAAAAAAA--PEESLRDDVYT  108

Query  324  AAAYGDMEKLQRLVESEGCSVS  389
            AAAYGDMEKL+RLVESEGCSVS
Sbjct  109  AAAYGDMEKLRRLVESEGCSVS  130



>gb|KCW83019.1| hypothetical protein EUGRSUZ_C043982 [Eucalyptus grandis]
Length=694

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 4/82 (5%)
 Frame = +3

Query  144  QFKAQFPRGFCMASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYT  323
            + +  FP    M+SEIEVV+E    DR +A A        +  A+ +   E+SLR+DVYT
Sbjct  53   RIRPPFPAA--MSSEIEVVDEARPADRDAAVAGGAVAAGAAAAAAAA--PEESLRDDVYT  108

Query  324  AAAYGDMEKLQRLVESEGCSVS  389
            AAAYGDMEKL+RLVESEGCSVS
Sbjct  109  AAAYGDMEKLRRLVESEGCSVS  130



>gb|KCW83018.1| hypothetical protein EUGRSUZ_C043982 [Eucalyptus grandis]
Length=700

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 4/82 (5%)
 Frame = +3

Query  144  QFKAQFPRGFCMASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYT  323
            + +  FP    M+SEIEVV+E    DR +A A        +  A+ +   E+SLR+DVYT
Sbjct  53   RIRPPFPAA--MSSEIEVVDEARPADRDAAVAGGAVAAGAAAAAAAA--PEESLRDDVYT  108

Query  324  AAAYGDMEKLQRLVESEGCSVS  389
            AAAYGDMEKL+RLVESEGCSVS
Sbjct  109  AAAYGDMEKLRRLVESEGCSVS  130



>ref|XP_009358538.1| PREDICTED: protein S-acyltransferase 24-like [Pyrus x bretschneideri]
Length=636

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 6/72 (8%)
 Frame = +3

Query  177  MASEIEVVE-EVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVE EV+  DR SA+A +      +         E+SLRNDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEDEVQTHDRESASANSANNNGEANGIG-----EESLRNDVYTAAAYGDLEKL  55

Query  354  QRLVESEGCSVS  389
            QRLVE EGCSVS
Sbjct  56   QRLVECEGCSVS  67



>gb|KCW83017.1| hypothetical protein EUGRSUZ_C043982 [Eucalyptus grandis]
Length=727

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 4/82 (5%)
 Frame = +3

Query  144  QFKAQFPRGFCMASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYT  323
            + +  FP    M+SEIEVV+E    DR +A A        +  A+ +   E+SLR+DVYT
Sbjct  53   RIRPPFPAA--MSSEIEVVDEARPADRDAAVAGGAVAAGAAAAAAAA--PEESLRDDVYT  108

Query  324  AAAYGDMEKLQRLVESEGCSVS  389
            AAAYGDMEKL+RLVESEGCSVS
Sbjct  109  AAAYGDMEKLRRLVESEGCSVS  130



>ref|XP_009338389.1| PREDICTED: protein S-acyltransferase 24-like [Pyrus x bretschneideri]
Length=636

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 51/72 (71%), Gaps = 6/72 (8%)
 Frame = +3

Query  177  MASEIEVVE-EVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVE EV+  DR SA+A +      +         E+SLRNDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEDEVQTHDRESASANSANNNGEANGIG-----EESLRNDVYTAAAYGDLEKL  55

Query  354  QRLVESEGCSVS  389
            QRLVE EGCSVS
Sbjct  56   QRLVECEGCSVS  67



>gb|KCW83020.1| hypothetical protein EUGRSUZ_C043982 [Eucalyptus grandis]
Length=529

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 4/82 (5%)
 Frame = +3

Query  144  QFKAQFPRGFCMASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYT  323
            + +  FP    M+SEIEVV+E    DR +A A        +  A+ +   E+SLR+DVYT
Sbjct  53   RIRPPFPAA--MSSEIEVVDEARPADRDAAVAGGAVAAGAAAAAAAA--PEESLRDDVYT  108

Query  324  AAAYGDMEKLQRLVESEGCSVS  389
            AAAYGDMEKL+RLVESEGCSVS
Sbjct  109  AAAYGDMEKLRRLVESEGCSVS  130



>emb|CDP10489.1| unnamed protein product [Coffea canephora]
Length=643

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            EE+SLRNDVYTAAAYGDMEKLQRLVESEGCSVS
Sbjct  38   EEESLRNDVYTAAAYGDMEKLQRLVESEGCSVS  70



>ref|XP_010250284.1| PREDICTED: protein S-acyltransferase 24-like [Nelumbo nucifera]
Length=631

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 40/71 (56%), Positives = 47/71 (66%), Gaps = 5/71 (7%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            MASEIEVV+E + RDR +      +  +N          +DSLRNDVYTAAAYG MEKL 
Sbjct  1    MASEIEVVDEGDSRDRQTGRTGGGSAETNGVDEG-----DDSLRNDVYTAAAYGHMEKLH  55

Query  357  RLVESEGCSVS  389
            RLVE +GCSVS
Sbjct  56   RLVECDGCSVS  66



>ref|XP_010050124.1| PREDICTED: protein S-acyltransferase 24-like [Eucalyptus grandis]
Length=639

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 2/71 (3%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVV+E    DR +A A        +  A+ +   E+SLR+DVYTAAAYGDMEKL+
Sbjct  1    MSSEIEVVDEARPADRDAAVAGGAVAAGAAAAAAAA--PEESLRDDVYTAAAYGDMEKLR  58

Query  357  RLVESEGCSVS  389
            RLVESEGCSVS
Sbjct  59   RLVESEGCSVS  69



>ref|XP_006389402.1| hypothetical protein POPTR_0025s00390g [Populus trichocarpa]
 gb|ERP48316.1| hypothetical protein POPTR_0025s00390g [Populus trichocarpa]
Length=638

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 50/74 (68%), Gaps = 8/74 (11%)
 Frame = +3

Query  177  MASEIEVVEE---VEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDME  347
            M+SEIE+VEE   V+  DR SAA       +   V       E+SLRNDVYTAAAYGD+E
Sbjct  1    MSSEIEIVEEDAVVQSNDRESAAVNGGNANNGVAVVG-----EESLRNDVYTAAAYGDLE  55

Query  348  KLQRLVESEGCSVS  389
            KL RLVESEGCSVS
Sbjct  56   KLHRLVESEGCSVS  69



>ref|XP_006400604.1| hypothetical protein EUTSA_v10012979mg [Eutrema salsugineum]
 dbj|BAJ33877.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42057.1| hypothetical protein EUTSA_v10012979mg [Eutrema salsugineum]
Length=619

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 12/71 (17%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEEV+   + +  +++               E++SL+NDVYTAAAYGD+EKL 
Sbjct  1    MSSEIEVVEEVQSNPKENGESSSKGI------------EDESLKNDVYTAAAYGDLEKLH  48

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  49   RLVECEGCSVS  59



>ref|XP_006287281.1| hypothetical protein CARUB_v10000476mg [Capsella rubella]
 gb|EOA20179.1| hypothetical protein CARUB_v10000476mg [Capsella rubella]
Length=620

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 12/71 (17%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEE++   + +  +++               EE+SL+NDVYTAAAYGD+EKL 
Sbjct  1    MSSEIEVVEEIQSNPQENGESSSKPV------------EEESLKNDVYTAAAYGDLEKLH  48

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  49   RLVECEGCSVS  59



>emb|CDY56864.1| BnaC09g54140D [Brassica napus]
Length=620

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 12/71 (17%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEEV+   + +  +++               E++SL+NDVYTAAAYGD+EKL 
Sbjct  1    MSSEIEVVEEVQSNHKENGESSSKPI------------EDESLKNDVYTAAAYGDLEKLH  48

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  49   RLVECEGCSVS  59



>gb|EYU38308.1| hypothetical protein MIMGU_mgv1a002757mg [Erythranthe guttata]
Length=641

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            E++SLRNDVYTAAAYGDMEKLQRLVESEGCSVS
Sbjct  35   EDESLRNDVYTAAAYGDMEKLQRLVESEGCSVS  67



>gb|KJB64636.1| hypothetical protein B456_010G059000 [Gossypium raimondii]
Length=500

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  MASEIEVVEE-VEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVEE V  +    A A             G V +++SL+NDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEETVPLKQLSGAVANGNEYGGGHHGVVGDVADDESLKNDVYTAAAYGDLEKL  60

Query  354  QRLVESEGCSVS  389
            QRLVESEGCS+S
Sbjct  61   QRLVESEGCSLS  72



>gb|KDP30210.1| hypothetical protein JCGZ_16992 [Jatropha curcas]
Length=636

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  294  EDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            EDSLRNDVYTAAAYGD+EKLQRLVESEGCSVS
Sbjct  37   EDSLRNDVYTAAAYGDLEKLQRLVESEGCSVS  68



>ref|XP_006359506.1| PREDICTED: protein S-acyltransferase 24-like [Solanum tuberosum]
Length=631

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            EE+SLR+DVYTAAAYGDMEKLQRLVESEGCSVS
Sbjct  32   EEESLRDDVYTAAAYGDMEKLQRLVESEGCSVS  64



>ref|XP_004242727.1| PREDICTED: protein S-acyltransferase 24 isoform X1 [Solanum lycopersicum]
Length=631

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            EE+SLR+DVYTAAAYGDMEKLQRLVESEGCSVS
Sbjct  32   EEESLRDDVYTAAAYGDMEKLQRLVESEGCSVS  64



>gb|KJB64638.1| hypothetical protein B456_010G059000 [Gossypium raimondii]
Length=633

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  MASEIEVVEE-VEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVEE V  +    A A             G V +++SL+NDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEETVPLKQLSGAVANGNEYGGGHHGVVGDVADDESLKNDVYTAAAYGDLEKL  60

Query  354  QRLVESEGCSVS  389
            QRLVESEGCS+S
Sbjct  61   QRLVESEGCSLS  72



>gb|KJB64635.1| hypothetical protein B456_010G059000 [Gossypium raimondii]
Length=627

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  MASEIEVVEE-VEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVEE V  +    A A             G V +++SL+NDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEETVPLKQLSGAVANGNEYGGGHHGVVGDVADDESLKNDVYTAAAYGDLEKL  60

Query  354  QRLVESEGCSVS  389
            QRLVESEGCS+S
Sbjct  61   QRLVESEGCSLS  72



>ref|XP_010454339.1| PREDICTED: protein S-acyltransferase 24 [Camelina sativa]
Length=620

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 48/71 (68%), Gaps = 12/71 (17%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEE++   + +  ++  A             +E+SL+NDVYTAAAYGD+EKL 
Sbjct  1    MSSEIEVVEEIQSNPQENGESSCKAV------------DEESLKNDVYTAAAYGDLEKLH  48

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  49   RLVECEGCSVS  59



>emb|CDX92467.1| BnaA10g15060D [Brassica napus]
Length=620

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 12/71 (17%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEEV+            +    +G +S   +E++SL+NDVYTAAAYGD+EKL 
Sbjct  1    MSSEIEVVEEVQ------------SIHKENGESSSKPIEDESLKNDVYTAAAYGDLEKLH  48

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  49   RLVECEGCSVS  59



>ref|XP_007013621.1| Ankyrin repeat family protein with DHHC zinc finger domain isoform 
1 [Theobroma cacao]
 gb|EOY31240.1| Ankyrin repeat family protein with DHHC zinc finger domain isoform 
1 [Theobroma cacao]
Length=640

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  MASEIEVVEEVE-YRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVEEV+  +  G   A        +    G V +++SL+NDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEEVQPSKQSGGVLANGNGNGGGNNGVVGGVADDESLKNDVYTAAAYGDLEKL  60

Query  354  QRLVESEGCSVS  389
             RLVESEGC+VS
Sbjct  61   HRLVESEGCTVS  72



>gb|KHG04996.1| Palmitoyltransferase AKR1 [Gossypium arboreum]
Length=622

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  MASEIEVVEE-VEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVEE V  +      A             G V +++SL+NDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEEAVPLKQLSGVVANGNEYGGGHHGVVGDVADDESLKNDVYTAAAYGDLEKL  60

Query  354  QRLVESEGCSVS  389
            QRLVESEGCS+S
Sbjct  61   QRLVESEGCSLS  72



>ref|XP_009120814.1| PREDICTED: protein S-acyltransferase 24-like [Brassica rapa]
Length=620

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 12/71 (17%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEEV+            +    +G +S   +E++SL+NDVYTAAAYGD+EKL 
Sbjct  1    MSSEIEVVEEVQ------------SIHKENGESSSKPIEDESLKNDVYTAAAYGDLEKLH  48

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  49   RLVECEGCSVS  59



>ref|XP_007155091.1| hypothetical protein PHAVU_003G172300g [Phaseolus vulgaris]
 gb|ESW27085.1| hypothetical protein PHAVU_003G172300g [Phaseolus vulgaris]
Length=635

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 46/71 (65%), Gaps = 12/71 (17%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEEV  RD             +     G  V E+SLRNDVYTAAAYGD+EKLQ
Sbjct  1    MSSEIEVVEEVS-RD-----------EQSPAAGVGDGVPEESLRNDVYTAAAYGDLEKLQ  48

Query  357  RLVESEGCSVS  389
            RLVE EGC V+
Sbjct  49   RLVEQEGCPVT  59



>ref|XP_008788793.1| PREDICTED: protein S-acyltransferase 24-like [Phoenix dactylifera]
Length=626

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 46/71 (65%), Gaps = 13/71 (18%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEE                    GV  G+  EE++LRNDVYTAAAYGD+EKLQ
Sbjct  1    MSSEIEVVEE-------------GPAAVAGGVGVGAPQEEEALRNDVYTAAAYGDLEKLQ  47

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  48   RLVEVEGCSVS  58



>gb|EPS74107.1| hypothetical protein M569_00641, partial [Genlisea aurea]
Length=543

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 45/71 (63%), Gaps = 10/71 (14%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            MASEIEVV E ++R+    +                  EE+SLRNDVYTAAAYGDMEKL 
Sbjct  1    MASEIEVVVE-DHRENNPYSNAGDEAVIV---------EEESLRNDVYTAAAYGDMEKLH  50

Query  357  RLVESEGCSVS  389
            RLV+ EGCSVS
Sbjct  51   RLVDQEGCSVS  61



>ref|XP_002532315.1| Palmitoyltransferase TIP1, putative [Ricinus communis]
 gb|EEF30067.1| Palmitoyltransferase TIP1, putative [Ricinus communis]
Length=286

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 11/71 (15%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEE + +             +++   S   + E+SLRNDVYTAAAYGD+EKLQ
Sbjct  1    MSSEIEVVEETQTQ-----------YNNDNEGESNGGIGEESLRNDVYTAAAYGDLEKLQ  49

Query  357  RLVESEGCSVS  389
            RLVESEGCSVS
Sbjct  50   RLVESEGCSVS  60



>ref|XP_007013622.1| Ankyrin repeat family protein with DHHC zinc finger domain isoform 
2 [Theobroma cacao]
 gb|EOY31241.1| Ankyrin repeat family protein with DHHC zinc finger domain isoform 
2 [Theobroma cacao]
Length=462

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  MASEIEVVEEVE-YRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVEEV+  +  G   A        +    G V +++SL+NDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEEVQPSKQSGGVLANGNGNGGGNNGVVGGVADDESLKNDVYTAAAYGDLEKL  60

Query  354  QRLVESEGCSVS  389
             RLVESEGC+VS
Sbjct  61   HRLVESEGCTVS  72



>gb|KJB64637.1| hypothetical protein B456_010G059000 [Gossypium raimondii]
Length=427

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  MASEIEVVEE-VEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVEE V  +    A A             G V +++SL+NDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEETVPLKQLSGAVANGNEYGGGHHGVVGDVADDESLKNDVYTAAAYGDLEKL  60

Query  354  QRLVESEGCSVS  389
            QRLVESEGCS+S
Sbjct  61   QRLVESEGCSLS  72



>ref|XP_009363933.1| PREDICTED: protein S-acyltransferase 24-like [Pyrus x bretschneideri]
Length=636

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 6/72 (8%)
 Frame = +3

Query  177  MASEIEVVE-EVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVE EV+  D GS +A +T    ++         E+SLRNDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEDEVQTGDPGSVSANSTNNNGDANRIG-----EESLRNDVYTAAAYGDLEKL  55

Query  354  QRLVESEGCSVS  389
            QRLVE EGCSVS
Sbjct  56   QRLVECEGCSVS  67



>ref|XP_008362882.1| PREDICTED: protein S-acyltransferase 24-like [Malus domestica]
Length=636

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 6/72 (8%)
 Frame = +3

Query  177  MASEIEVVE-EVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVE EV+  D GS +A +T    ++         E+SLRNDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEDEVQTGDPGSVSANSTNNNGDANRIG-----EESLRNDVYTAAAYGDLEKL  55

Query  354  QRLVESEGCSVS  389
            QRLVE EGCSVS
Sbjct  56   QRLVECEGCSVS  67



>ref|XP_008343921.1| PREDICTED: protein S-acyltransferase 24-like [Malus domestica]
Length=636

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 6/72 (8%)
 Frame = +3

Query  177  MASEIEVVE-EVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVE EV+  D GS +A +T    ++         E+SLRNDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEDEVQTGDPGSVSANSTNNNGDANRIG-----EESLRNDVYTAAAYGDLEKL  55

Query  354  QRLVESEGCSVS  389
            QRLVE EGCSVS
Sbjct  56   QRLVECEGCSVS  67



>ref|XP_008384910.1| PREDICTED: protein S-acyltransferase 24 [Malus domestica]
Length=636

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 6/72 (8%)
 Frame = +3

Query  177  MASEIEVVE-EVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVE EV+  D GS +A +T    ++         E+SLRNDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEDEVQTGDPGSVSANSTNNNGDANRIG-----EESLRNDVYTAAAYGDLEKL  55

Query  354  QRLVESEGCSVS  389
            QRLVE EGCSVS
Sbjct  56   QRLVECEGCSVS  67



>ref|XP_011017904.1| PREDICTED: protein S-acyltransferase 24-like [Populus euphratica]
Length=638

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 44/74 (59%), Positives = 50/74 (68%), Gaps = 8/74 (11%)
 Frame = +3

Query  177  MASEIEVVEE---VEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDME  347
            M+SEIE+VEE   V+  DR SAA     T +   V       E+SLRNDVYTAAAYGD+E
Sbjct  1    MSSEIEIVEEDAVVQSNDRESAALNGGNTNNGVAVVG-----EESLRNDVYTAAAYGDIE  55

Query  348  KLQRLVESEGCSVS  389
             L RLVESEGCSVS
Sbjct  56   NLHRLVESEGCSVS  69



>ref|XP_010112497.1| S-acyltransferase TIP1 [Morus notabilis]
 gb|EXC33817.1| S-acyltransferase TIP1 [Morus notabilis]
Length=619

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 44/71 (62%), Positives = 50/71 (70%), Gaps = 6/71 (8%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVV+E     RG   A + A    +GVA      E+SLRNDVYTAAAYGD EKLQ
Sbjct  1    MSSEIEVVDEEAQTSRGGVMANSAAGGMANGVA------EESLRNDVYTAAAYGDFEKLQ  54

Query  357  RLVESEGCSVS  389
            RLVES+GCSVS
Sbjct  55   RLVESDGCSVS  65



>ref|XP_011084071.1| PREDICTED: protein S-acyltransferase 24-like [Sesamum indicum]
Length=634

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  294  EDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            ++SLRNDVYTAAAYGDMEKLQRLVESEGCSVS
Sbjct  36   DESLRNDVYTAAAYGDMEKLQRLVESEGCSVS  67



>ref|XP_010244896.1| PREDICTED: protein S-acyltransferase 24-like [Nelumbo nucifera]
Length=629

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 5/71 (7%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M SEIEVV+E   R+R ++ +   +  +N          ++SLRNDVYTAAAYGDMEKL 
Sbjct  1    MVSEIEVVDEGNSRNRETSNSDGDSAETNGVGGG-----DESLRNDVYTAAAYGDMEKLH  55

Query  357  RLVESEGCSVS  389
            RLV+ EGCSVS
Sbjct  56   RLVKYEGCSVS  66



>ref|XP_010928281.1| PREDICTED: protein S-acyltransferase 24-like isoform X1 [Elaeis 
guineensis]
Length=626

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 46/71 (65%), Gaps = 13/71 (18%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEE                    GV  G+  EE++LRNDVYTAAAYGD+EKLQ
Sbjct  1    MSSEIEVVEE-------------GPAAGAGGVGGGAPAEEEALRNDVYTAAAYGDLEKLQ  47

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  48   RLVEVEGCSVS  58



>ref|XP_007013623.1| Ankyrin repeat family protein with DHHC zinc finger domain isoform 
3 [Theobroma cacao]
 gb|EOY31242.1| Ankyrin repeat family protein with DHHC zinc finger domain isoform 
3 [Theobroma cacao]
Length=425

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 40/72 (56%), Positives = 50/72 (69%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  MASEIEVVEEVE-YRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKL  353
            M+SEIEVVEEV+  +  G   A        +    G V +++SL+NDVYTAAAYGD+EKL
Sbjct  1    MSSEIEVVEEVQPSKQSGGVLANGNGNGGGNNGVVGGVADDESLKNDVYTAAAYGDLEKL  60

Query  354  QRLVESEGCSVS  389
             RLVESEGC+VS
Sbjct  61   HRLVESEGCTVS  72



>ref|NP_197535.2| S-acyltransferase TIP1 [Arabidopsis thaliana]
 sp|Q52T38.1|ZDH22_ARATH RecName: Full=Protein S-acyltransferase 24; AltName: Full=Ankyrin 
repeat-containing S-palmitoyltransferase; AltName: Full=Palmitoyltransferase 
TIP1; AltName: Full=Protein TIP GROWTH 
DEFECTIVE 1; Short=AtTIP1; AltName: Full=Zinc finger DHHC domain-containing 
protein TIP1 [Arabidopsis thaliana]
 gb|AAX89384.1| ankryin repeat S-palmitoyl transferase [Arabidopsis thaliana]
 dbj|BAF00511.1| ankyrin-repeat protein [Arabidopsis thaliana]
 gb|AED92834.1| S-acyltransferase TIP1 [Arabidopsis thaliana]
 gb|AFI41207.1| ankyrin protein, partial [Arabidopsis thaliana]
Length=620

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 12/71 (17%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEE++   + +  +++               EE+SL+NDVYTAAAYGD+EKL 
Sbjct  1    MSSEIEVVEEIQSNPKENGESSSKGI------------EEESLKNDVYTAAAYGDLEKLH  48

Query  357  RLVESEGCSVS  389
            RLVE EG SVS
Sbjct  49   RLVECEGSSVS  59



>ref|XP_010928283.1| PREDICTED: protein S-acyltransferase 24-like isoform X2 [Elaeis 
guineensis]
Length=540

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 41/71 (58%), Positives = 46/71 (65%), Gaps = 13/71 (18%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEE                    GV  G+  EE++LRNDVYTAAAYGD+EKLQ
Sbjct  1    MSSEIEVVEE-------------GPAAGAGGVGGGAPAEEEALRNDVYTAAAYGDLEKLQ  47

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  48   RLVEVEGCSVS  58



>gb|KFK26273.1| hypothetical protein AALP_AA8G225500 [Arabis alpina]
Length=626

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            EEDSL+NDVYTAAAYGD+EKL RLVE EGCSVS
Sbjct  27   EEDSLKNDVYTAAAYGDLEKLHRLVECEGCSVS  59



>ref|XP_010535848.1| PREDICTED: protein S-acyltransferase 24 [Tarenaya hassleriana]
Length=634

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            EE+SLRNDVYTAAAYGD+EKL RLVE EGCSVS
Sbjct  28   EEESLRNDVYTAAAYGDLEKLHRLVECEGCSVS  60



>ref|XP_009398663.1| PREDICTED: protein S-acyltransferase 24-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=617

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 43/71 (61%), Gaps = 12/71 (17%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            MASEIEVVEE                   +    G    +++L+NDVYTAAAYGD+EKLQ
Sbjct  1    MASEIEVVEEAS------------GAGGGAAPGGGGAGAQEALKNDVYTAAAYGDLEKLQ  48

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  49   RLVEEEGCSVS  59



>ref|XP_009398664.1| PREDICTED: protein S-acyltransferase 24-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=458

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 43/71 (61%), Gaps = 12/71 (17%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            MASEIEVVEE                   +    G    +++L+NDVYTAAAYGD+EKLQ
Sbjct  1    MASEIEVVEEAS------------GAGGGAAPGGGGAGAQEALKNDVYTAAAYGDLEKLQ  48

Query  357  RLVESEGCSVS  389
            RLVE EGCSVS
Sbjct  49   RLVEEEGCSVS  59



>ref|XP_010520557.1| PREDICTED: protein S-acyltransferase 24-like isoform X2 [Tarenaya 
hassleriana]
Length=630

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            EE+SLRNDVYTAAAYGD+EKL RLVE EGCS+S
Sbjct  28   EEESLRNDVYTAAAYGDLEKLHRLVECEGCSLS  60



>ref|XP_010520556.1| PREDICTED: protein S-acyltransferase 24-like isoform X1 [Tarenaya 
hassleriana]
Length=635

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            EE+SLRNDVYTAAAYGD+EKL RLVE EGCS+S
Sbjct  28   EEESLRNDVYTAAAYGDLEKLHRLVECEGCSLS  60



>ref|XP_004287249.1| PREDICTED: protein S-acyltransferase 24 [Fragaria vesca subsp. 
vesca]
Length=634

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  294  EDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            E+SLRNDVYTA AYGD+EKLQRLVE EGCSVS
Sbjct  37   EESLRNDVYTATAYGDLEKLQRLVECEGCSVS  68



>gb|KJB53968.1| hypothetical protein B456_009G014100 [Gossypium raimondii]
Length=590

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +3

Query  183  SEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQRL  362
            SEIEVVEEV    +                    V  +++LRNDVYTAA YGD+EKLQRL
Sbjct  2    SEIEVVEEVLPLKQSGDVVANGNGYRGGNNGVIGVSHDENLRNDVYTAATYGDLEKLQRL  61

Query  363  VESEGCSVS  389
            VE EGCS++
Sbjct  62   VEYEGCSLT  70



>ref|XP_010420875.1| PREDICTED: protein S-acyltransferase 24-like [Camelina sativa]
Length=619

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            +E+SL+NDVYTAAAYGD+EKL RLVE EGCSVS
Sbjct  27   DEESLKNDVYTAAAYGDLEKLHRLVECEGCSVS  59



>ref|XP_010493140.1| PREDICTED: protein S-acyltransferase 24-like [Camelina sativa]
Length=620

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            +E+SL+NDVYTAAAYGD+EKL RLVE EGCSVS
Sbjct  27   DEESLKNDVYTAAAYGDLEKLHRLVECEGCSVS  59



>gb|KEH32151.1| palmitoyltransferase TIP1 [Medicago truncatula]
Length=506

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 7/71 (10%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEEV+ R           +  +S  +S +VV+E + RNDVYTAAAYGD+EKL 
Sbjct  1    MSSEIEVVEEVQSR-------RDQQSPPSSSSSSSAVVDEVASRNDVYTAAAYGDLEKLH  53

Query  357  RLVESEGCSVS  389
            RLVE EGC V+
Sbjct  54   RLVEIEGCLVN  64



>ref|XP_006852828.1| hypothetical protein AMTR_s00033p00182370 [Amborella trichopoda]
 gb|ERN14295.1| hypothetical protein AMTR_s00033p00182370 [Amborella trichopoda]
Length=634

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 41/71 (58%), Gaps = 18/71 (25%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            MASEIE+V E                          V  E+SLRNDVYTAAAYGD+EKL+
Sbjct  1    MASEIEIVTE------------------GVSDTVAEVGGEESLRNDVYTAAAYGDLEKLK  42

Query  357  RLVESEGCSVS  389
            RLVE EGCSV+
Sbjct  43   RLVEFEGCSVT  53



>ref|XP_008659786.1| PREDICTED: protein S-acyltransferase 24-like [Zea mays]
 gb|AFW87295.1| hypothetical protein ZEAMMB73_866253 [Zea mays]
Length=639

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            MASEIEV+E+       ++   A +T  +    + +  E+DSL+NDVYTAAAYGD+EKLQ
Sbjct  1    MASEIEVLEDTT--TSSTSLVAAASTVPSLAEGAEAPAEDDSLKNDVYTAAAYGDLEKLQ  58

Query  357  RLVESEGCSVS  389
            RLVE EG  V+
Sbjct  59   RLVEGEGRPVT  69



>ref|XP_011078543.1| PREDICTED: LOW QUALITY PROTEIN: protein S-acyltransferase 24 
[Sesamum indicum]
Length=619

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            E++SL NDVYTAAAYGDMEKLQRLVE EGC VS
Sbjct  26   EDESLTNDVYTAAAYGDMEKLQRLVEXEGCLVS  58



>gb|KJB53969.1| hypothetical protein B456_009G014100 [Gossypium raimondii]
Length=426

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 34/69 (49%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = +3

Query  183  SEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQRL  362
            SEIEVVEEV    +                    V  +++LRNDVYTAA YGD+EKLQRL
Sbjct  2    SEIEVVEEVLPLKQSGDVVANGNGYRGGNNGVIGVSHDENLRNDVYTAATYGDLEKLQRL  61

Query  363  VESEGCSVS  389
            VE EGCS++
Sbjct  62   VEYEGCSLT  70



>ref|XP_003609480.1| S-acyltransferase TIP1 [Medicago truncatula]
 gb|AES91677.1| palmitoyltransferase TIP1 [Medicago truncatula]
Length=642

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/71 (55%), Positives = 49/71 (69%), Gaps = 7/71 (10%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEEV+ R           +  +S  +S +VV+E + RNDVYTAAAYGD+EKL 
Sbjct  1    MSSEIEVVEEVQSR-------RDQQSPPSSSSSSSAVVDEVASRNDVYTAAAYGDLEKLH  53

Query  357  RLVESEGCSVS  389
            RLVE EGC V+
Sbjct  54   RLVEIEGCLVN  64



>gb|KEH44378.1| DHHC-type zinc finger protein [Medicago truncatula]
Length=634

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 58/101 (57%), Gaps = 22/101 (22%)
 Frame = +3

Query  96   HYTH*LKFNTLNFESFQFKAQFPRGF---CMASEIEVVEEVEYRDRgsaaatatattsns  266
            H T+ L FN       Q K Q+ +      M+SEI+V+E+V  +              + 
Sbjct  82   HDTNWLPFN------HQIKDQYVKSVVDDAMSSEIKVMEKVHPQQ-------------SI  122

Query  267  gvasgsvvEEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
             ++S   V EDSLRNDVYTAAAYGD+EKL+RLVE EGC V+
Sbjct  123  SLSSTGEVAEDSLRNDVYTAAAYGDLEKLRRLVEQEGCLVT  163



>emb|CDY51852.1| BnaA03g56190D [Brassica napus]
Length=594

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            E++SL+NDVYTA+AYGD+EKL RLVE EGCSVS
Sbjct  28   EDESLKNDVYTASAYGDLEKLHRLVECEGCSVS  60



>emb|CDX70923.1| BnaC03g10070D [Brassica napus]
Length=602

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            E++SL+NDVYTA+AYGD+EKL RLVE EGCSVS
Sbjct  28   EDESLKNDVYTASAYGDLEKLHRLVECEGCSVS  60



>ref|XP_009126441.1| PREDICTED: protein S-acyltransferase 24 [Brassica rapa]
Length=617

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            E++SL+NDVYTA+AYGD+EKL RLVE EGCSVS
Sbjct  24   EDESLKNDVYTASAYGDLEKLHRLVECEGCSVS  56



>emb|CDY45091.1| BnaA02g04850D [Brassica napus]
Length=630

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            E++SL+NDVYTA+AYGD+EKL RLVE EGCSVS
Sbjct  24   EDESLKNDVYTASAYGDLEKLHRLVECEGCSVS  56



>gb|KFK33845.1| hypothetical protein AALP_AA5G067400 [Arabis alpina]
Length=624

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            +++SLRNDVYTAAAYGD+EKL RLV+S+GCS+S
Sbjct  28   DDESLRNDVYTAAAYGDLEKLHRLVDSDGCSLS  60



>ref|XP_009392141.1| PREDICTED: protein S-acyltransferase 24-like [Musa acuminata 
subsp. malaccensis]
Length=626

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  303  LRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            L+NDVYTAAAYGD+EKLQRLVE+EGCSVS
Sbjct  34   LKNDVYTAAAYGDLEKLQRLVEAEGCSVS  62



>ref|XP_010687832.1| PREDICTED: protein S-acyltransferase 24 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +3

Query  210  EYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            + RDR +     T   ++S  +      ++SL++DVYTAAAYGDMEKL+RLVE E CSVS
Sbjct  16   QSRDRSTTTTANTIGAASSSSSMVERENDESLKDDVYTAAAYGDMEKLERLVERENCSVS  75



>gb|KHG15624.1| Palmitoyltransferase akr1 [Gossypium arboreum]
Length=590

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  294  EDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            +++LRNDVYTAAAYGD+EKLQRLVE EGCS++
Sbjct  39   DENLRNDVYTAAAYGDLEKLQRLVEYEGCSLA  70



>ref|XP_002437346.1| hypothetical protein SORBIDRAFT_10g025310 [Sorghum bicolor]
 gb|EER88713.1| hypothetical protein SORBIDRAFT_10g025310 [Sorghum bicolor]
Length=640

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            MASEIEV+E+         AA A A   ++   +G+  E++SL+NDVYTAAAYGD+EKLQ
Sbjct  1    MASEIEVLEDTTTSSTSLVAAAAAAAAPSAAEGAGAPAEDESLKNDVYTAAAYGDLEKLQ  60

Query  357  RLVESEGCSVS  389
            RLVE EG  V+
Sbjct  61   RLVEGEGRPVT  71



>gb|KJB23675.1| hypothetical protein B456_004G109200 [Gossypium raimondii]
Length=662

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +3

Query  177  MASEIEVVEEVE--YRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEK  350
            M+SEIEVVE+V+   +  G            +    G  V+++SLRNDVYT AAYGD+EK
Sbjct  1    MSSEIEVVEDVQPLKQSDGVVGNGNGYYGGGNNGVVGGFVDDESLRNDVYTVAAYGDLEK  60

Query  351  LQRLVESEGCSVS  389
            LQRLVE EG S+S
Sbjct  61   LQRLVEYEGRSLS  73



>gb|KJB23676.1| hypothetical protein B456_004G109200 [Gossypium raimondii]
Length=667

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +3

Query  177  MASEIEVVEEVE--YRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEK  350
            M+SEIEVVE+V+   +  G            +    G  V+++SLRNDVYT AAYGD+EK
Sbjct  1    MSSEIEVVEDVQPLKQSDGVVGNGNGYYGGGNNGVVGGFVDDESLRNDVYTVAAYGDLEK  60

Query  351  LQRLVESEGCSVS  389
            LQRLVE EG S+S
Sbjct  61   LQRLVEYEGRSLS  73



>ref|NP_001058187.1| Os06g0644500 [Oryza sativa Japonica Group]
 dbj|BAD37437.1| ankyrin repeat-containing protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF20101.1| Os06g0644500 [Oryza sativa Japonica Group]
 gb|EEE66105.1| hypothetical protein OsJ_22138 [Oryza sativa Japonica Group]
Length=649

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            E+DSL+NDVYTAAAYGD+EKLQRLVE EG  V+
Sbjct  48   EDDSLKNDVYTAAAYGDLEKLQRLVEGEGHPVT  80



>gb|EEC81067.1| hypothetical protein OsI_23878 [Oryza sativa Indica Group]
Length=649

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            E+DSL+NDVYTAAAYGD+EKLQRLVE EG  V+
Sbjct  48   EDDSLKNDVYTAAAYGDLEKLQRLVEGEGHPVT  80



>gb|KHG18334.1| Palmitoyltransferase akr1 [Gossypium arboreum]
Length=654

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 36/73 (49%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsv--vEEDSLRNDVYTAAAYGDMEK  350
            M+SEIEVVE+V+   +              G        V+++SLRNDVYT AAYGD+EK
Sbjct  1    MSSEIEVVEDVQPLKQLDGVLANGNGYYGGGNNGVVGGFVDDESLRNDVYTVAAYGDLEK  60

Query  351  LQRLVESEGCSVS  389
            LQRLVE EG S+S
Sbjct  61   LQRLVEYEGRSLS  73



>gb|KEH44377.1| translation initiation factor IF-3 [Medicago truncatula]
Length=949

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 11/71 (15%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M+SEIEVVEEV+Y D+ S  ++     +           ED L+ DVY A AY D+EKL+
Sbjct  99   MSSEIEVVEEVQYGDQQSTPSSFAGGVA-----------EDRLQKDVYIATAYEDLEKLR  147

Query  357  RLVESEGCSVS  389
            RLVE EGC V+
Sbjct  148  RLVEQEGCLVT  158



>ref|XP_010913354.1| PREDICTED: protein S-acyltransferase 24-like [Elaeis guineensis]
Length=620

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  303  LRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            LRNDVYTAAAYGD+EKLQRLVE E CSVS
Sbjct  30   LRNDVYTAAAYGDLEKLQRLVEVELCSVS  58



>gb|AFW76197.1| hypothetical protein ZEAMMB73_209183 [Zea mays]
Length=422

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            MASEIEV+E+         AA +TA ++  G  + +  E  SL+NDVYTAAAYGD+EKLQ
Sbjct  1    MASEIEVLEDTTTSSTSLVAAASTAPSAAEGAGAPAENE--SLKNDVYTAAAYGDLEKLQ  58

Query  357  RLVESEGCSVS  389
            RLVE EG  V+
Sbjct  59   RLVEGEGRPVT  69



>ref|XP_008649039.1| PREDICTED: protein S-acyltransferase 24 [Zea mays]
 gb|AFW76198.1| hypothetical protein ZEAMMB73_209183 [Zea mays]
Length=638

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            MASEIEV+E+         AA +TA ++  G  + +  E  SL+NDVYTAAAYGD+EKLQ
Sbjct  1    MASEIEVLEDTTTSSTSLVAAASTAPSAAEGAGAPAENE--SLKNDVYTAAAYGDLEKLQ  58

Query  357  RLVESEGCSVS  389
            RLVE EG  V+
Sbjct  59   RLVEGEGRPVT  69



>ref|XP_003563307.1| PREDICTED: protein S-acyltransferase 24 [Brachypodium distachyon]
Length=638

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            MASEIEV+E+       +  + A  + + +   +    E++ L++DVYTAAAYGD+EKLQ
Sbjct  1    MASEIEVLEDTTTA--TTTVSVAVDSAAVAEKGAVPSKEDEPLKDDVYTAAAYGDLEKLQ  58

Query  357  RLVESEGCSVS  389
            RLVE+EG  V+
Sbjct  59   RLVEAEGRPVA  69



>gb|KCW79059.1| hypothetical protein EUGRSUZ_C00485 [Eucalyptus grandis]
Length=534

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 37/70 (53%), Positives = 45/70 (64%), Gaps = 5/70 (7%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M++EI+VVEEV       AAA  +    + G   G    ++ LRNDVY AAAYGDMEKL+
Sbjct  1    MSTEIQVVEEVR-----PAAAVESCGGGDGGGGVGGGAGKERLRNDVYAAAAYGDMEKLR  55

Query  357  RLVESEGCSV  386
            RLVE EG SV
Sbjct  56   RLVEVEGRSV  65



>ref|XP_008795828.1| PREDICTED: protein S-acyltransferase 24 isoform X2 [Phoenix dactylifera]
Length=591

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  303  LRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            LRNDVYTAAAYGD+EKLQRLV+ + CSVS
Sbjct  30   LRNDVYTAAAYGDLEKLQRLVDVDLCSVS  58



>ref|XP_008795826.1| PREDICTED: protein S-acyltransferase 24 isoform X1 [Phoenix dactylifera]
Length=621

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  303  LRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            LRNDVYTAAAYGD+EKLQRLV+ + CSVS
Sbjct  30   LRNDVYTAAAYGDLEKLQRLVDVDLCSVS  58



>ref|XP_008645333.1| PREDICTED: protein S-acyltransferase 24-like isoform X4 [Zea 
mays]
Length=529

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 6/80 (8%)
 Frame = +3

Query  150  KAQFPRGFCMASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAA  329
            +A  P G   +SEIEVVE+       + AAT+          +    E ++L++DVYT A
Sbjct  27   RAPNPPGPMASSEIEVVEDA------TPAATSGGAGRAVAEVARQEGEGEALKDDVYTGA  80

Query  330  AYGDMEKLQRLVESEGCSVS  389
            AYGD+EKL RLVE EG SV+
Sbjct  81   AYGDLEKLHRLVEREGRSVT  100



>ref|XP_008645332.1| PREDICTED: protein S-acyltransferase 24-like isoform X3 [Zea 
mays]
Length=622

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 6/80 (8%)
 Frame = +3

Query  150  KAQFPRGFCMASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAA  329
            +A  P G   +SEIEVVE+       + AAT+          +    E ++L++DVYT A
Sbjct  27   RAPNPPGPMASSEIEVVEDA------TPAATSGGAGRAVAEVARQEGEGEALKDDVYTGA  80

Query  330  AYGDMEKLQRLVESEGCSVS  389
            AYGD+EKL RLVE EG SV+
Sbjct  81   AYGDLEKLHRLVEREGRSVT  100



>ref|XP_008645331.1| PREDICTED: protein S-acyltransferase 24-like isoform X2 [Zea 
mays]
Length=656

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 6/80 (8%)
 Frame = +3

Query  150  KAQFPRGFCMASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAA  329
            +A  P G   +SEIEVVE+       + AAT+          +    E ++L++DVYT A
Sbjct  27   RAPNPPGPMASSEIEVVEDA------TPAATSGGAGRAVAEVARQEGEGEALKDDVYTGA  80

Query  330  AYGDMEKLQRLVESEGCSVS  389
            AYGD+EKL RLVE EG SV+
Sbjct  81   AYGDLEKLHRLVEREGRSVT  100



>ref|XP_008645330.1| PREDICTED: protein S-acyltransferase 24-like isoform X1 [Zea 
mays]
Length=657

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 6/80 (8%)
 Frame = +3

Query  150  KAQFPRGFCMASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAA  329
            +A  P G   +SEIEVVE+       + AAT+          +    E ++L++DVYT A
Sbjct  27   RAPNPPGPMASSEIEVVEDA------TPAATSGGAGRAVAEVARQEGEGEALKDDVYTGA  80

Query  330  AYGDMEKLQRLVESEGCSVS  389
            AYGD+EKL RLVE EG SV+
Sbjct  81   AYGDLEKLHRLVEREGRSVT  100



>ref|XP_008645334.1| PREDICTED: protein S-acyltransferase 24-like isoform X5 [Zea 
mays]
Length=453

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 6/80 (8%)
 Frame = +3

Query  150  KAQFPRGFCMASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAA  329
            +A  P G   +SEIEVVE+       + AAT+          +    E ++L++DVYT A
Sbjct  27   RAPNPPGPMASSEIEVVEDA------TPAATSGGAGRAVAEVARQEGEGEALKDDVYTGA  80

Query  330  AYGDMEKLQRLVESEGCSVS  389
            AYGD+EKL RLVE EG SV+
Sbjct  81   AYGDLEKLHRLVEREGRSVT  100



>ref|XP_003570824.1| PREDICTED: protein S-acyltransferase 24-like [Brachypodium distachyon]
 ref|XP_010233921.1| PREDICTED: protein S-acyltransferase 24-like [Brachypodium distachyon]
Length=632

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 38/71 (54%), Positives = 47/71 (66%), Gaps = 5/71 (7%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            MASEIEV+E     D  +AAAT T   +   VA  +   E+ L++DVYT AAYGD+EKL 
Sbjct  1    MASEIEVLE-----DTTAAAATTTTAGAVVAVARDAEPAEEPLKDDVYTGAAYGDLEKLH  55

Query  357  RLVESEGCSVS  389
            RLVE EG SV+
Sbjct  56   RLVEQEGRSVT  66



>ref|XP_004965751.1| PREDICTED: S-acyltransferase TIP1-like [Setaria italica]
Length=643

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  300  SLRNDVYTAAAYGDMEKLQRLVESEG  377
            SL+NDVYTAAAYGD+EKLQRLVE EG
Sbjct  49   SLKNDVYTAAAYGDLEKLQRLVEGEG  74



>gb|AFW70467.1| hypothetical protein ZEAMMB73_828123 [Zea mays]
Length=401

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 6/80 (8%)
 Frame = +3

Query  150  KAQFPRGFCMASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAA  329
            +A  P G   +SEIEVVE+       + AAT+          +    E ++L++DVYT A
Sbjct  105  RAPNPPGPMASSEIEVVEDA------TPAATSGGAGRAVAEVARQEGEGEALKDDVYTGA  158

Query  330  AYGDMEKLQRLVESEGCSVS  389
            AYGD+EKL RLVE EG SV+
Sbjct  159  AYGDLEKLHRLVEREGRSVT  178



>ref|XP_004951656.1| PREDICTED: S-acyltransferase TIP1-like isoform X3 [Setaria italica]
Length=508

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +3

Query  180  ASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQR  359
            +SEIEVV++ E     +AA    A    +  A     EE +L++DVYT AAYGD+EKL R
Sbjct  3    SSEIEVVDDTETVS-TAAATGDGAGPVVAAGAGQEGEEEAALKDDVYTGAAYGDLEKLHR  61

Query  360  LVESEGCSVS  389
            LVE EG SV+
Sbjct  62   LVEREGRSVT  71



>ref|XP_004951655.1| PREDICTED: S-acyltransferase TIP1-like isoform X2 [Setaria italica]
Length=515

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +3

Query  180  ASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQR  359
            +SEIEVV++ E     +AA    A    +  A     EE +L++DVYT AAYGD+EKL R
Sbjct  3    SSEIEVVDDTETVS-TAAATGDGAGPVVAAGAGQEGEEEAALKDDVYTGAAYGDLEKLHR  61

Query  360  LVESEGCSVS  389
            LVE EG SV+
Sbjct  62   LVEREGRSVT  71



>ref|XP_002453418.1| hypothetical protein SORBIDRAFT_04g005696 [Sorghum bicolor]
 gb|EES06394.1| hypothetical protein SORBIDRAFT_04g005696 [Sorghum bicolor]
Length=587

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  291  EEDSLRNDVYTAAAYGDMEKLQRLVESEGCSVS  389
            +E++L++DVYT AAYGD+EKL RLVE EG SV+
Sbjct  25   DEEALKDDVYTGAAYGDLEKLHRLVEREGRSVT  57



>ref|XP_004951654.1| PREDICTED: S-acyltransferase TIP1-like isoform X1 [Setaria italica]
Length=639

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +3

Query  180  ASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQR  359
            +SEIEVV++ E     +AA    A    +  A     EE +L++DVYT AAYGD+EKL R
Sbjct  3    SSEIEVVDDTETVS-TAAATGDGAGPVVAAGAGQEGEEEAALKDDVYTGAAYGDLEKLHR  61

Query  360  LVESEGCSVS  389
            LVE EG SV+
Sbjct  62   LVEREGRSVT  71



>ref|XP_004951657.1| PREDICTED: S-acyltransferase TIP1-like isoform X4 [Setaria italica]
Length=424

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = +3

Query  180  ASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQR  359
            +SEIEVV++ E     +AA    A    +  A     EE +L++DVYT AAYGD+EKL R
Sbjct  3    SSEIEVVDDTETVS-TAAATGDGAGPVVAAGAGQEGEEEAALKDDVYTGAAYGDLEKLHR  61

Query  360  LVESEGCSVS  389
            LVE EG SV+
Sbjct  62   LVEREGRSVT  71



>dbj|BAJ93741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/25 (84%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +3

Query  303  LRNDVYTAAAYGDMEKLQRLVESEG  377
            L++DVYTAAAYGD+EKLQRLVE+EG
Sbjct  31   LKDDVYTAAAYGDLEKLQRLVEAEG  55



>ref|XP_010050341.1| PREDICTED: protein S-acyltransferase 24 [Eucalyptus grandis]
Length=559

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 45/70 (64%), Gaps = 5/70 (7%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M++EI+VVEEV       AAA  +    + G   G    ++ LRNDVY AAAYGDMEKL+
Sbjct  1    MSTEIQVVEEVR-----PAAAVESCGGGDGGGGVGGGAGKERLRNDVYAAAAYGDMEKLR  55

Query  357  RLVESEGCSV  386
            RLVE EG SV
Sbjct  56   RLVEVEGRSV  65



>gb|KCW79060.1| hypothetical protein EUGRSUZ_C00485 [Eucalyptus grandis]
Length=548

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 45/70 (64%), Gaps = 5/70 (7%)
 Frame = +3

Query  177  MASEIEVVEEVEYRDRgsaaatatattsnsgvasgsvvEEDSLRNDVYTAAAYGDMEKLQ  356
            M++EI+VVEEV       AAA  +    + G   G    ++ LRNDVY AAAYGDMEKL+
Sbjct  1    MSTEIQVVEEVR-----PAAAVESCGGGDGGGGVGGGAGKERLRNDVYAAAAYGDMEKLR  55

Query  357  RLVESEGCSV  386
            RLVE EG SV
Sbjct  56   RLVEVEGRSV  65



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561277149640