BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF048L02

Length=430
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002271665.2|  PREDICTED: pectinesterase-like                   82.4    3e-15   Vitis vinifera
emb|CBI36883.3|  unnamed protein product                              82.4    3e-15   Vitis vinifera
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                   82.0    3e-15   Nicotiana tomentosiformis
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                   80.9    1e-14   Populus euphratica
gb|EPS62329.1|  pectinesterase                                        79.3    3e-14   Genlisea aurea
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                   79.3    3e-14   Nelumbo nucifera [Indian lotus]
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                   78.2    7e-14   Sesamum indicum [beniseed]
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                   77.4    1e-13   Nicotiana tomentosiformis
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                   77.0    2e-13   Populus euphratica
gb|EYU46746.1|  hypothetical protein MIMGU_mgv1a0044632mg             73.2    4e-13   Erythranthe guttata [common monkey flower]
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g           75.5    7e-13   
gb|AHB84678.1|  pectin methylesterase                                 75.1    9e-13   Citrus reticulata [mandarin orange]
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...  74.7    1e-12   Citrus sinensis [apfelsine]
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg          74.7    1e-12   
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...  73.9    2e-12   Gossypium arboreum [tree cotton]
ref|XP_004290811.1|  PREDICTED: pectinesterase-like                   73.6    2e-12   Fragaria vesca subsp. vesca
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                   73.6    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...  73.2    4e-12   Glycine max [soybeans]
emb|CDP15269.1|  unnamed protein product                              71.2    1e-11   Coffea canephora [robusta coffee]
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                   71.6    1e-11   Prunus mume [ume]
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg           71.2    2e-11   
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                   70.9    2e-11   Nicotiana tomentosiformis
emb|CDP15270.1|  unnamed protein product                              70.5    3e-11   Coffea canephora [robusta coffee]
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                   70.1    4e-11   Nicotiana sylvestris
gb|KJB41904.1|  hypothetical protein B456_007G127000                  70.1    4e-11   Gossypium raimondii
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g           69.3    8e-11   Phaseolus vulgaris [French bean]
ref|XP_010321856.1|  PREDICTED: pectinesterase                        68.6    1e-10   Solanum lycopersicum
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative             67.4    4e-10   Ricinus communis
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor               67.0    4e-10   Medicago truncatula
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...  66.6    6e-10   Cicer arietinum [garbanzo]
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                   65.9    1e-09   Nicotiana sylvestris
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                   65.1    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB09419.1|  hypothetical protein B456_001G140500                  65.1    2e-09   Gossypium raimondii
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                   64.7    3e-09   
ref|XP_010069896.1|  PREDICTED: pectinesterase-like                   64.3    4e-09   Eucalyptus grandis [rose gum]
ref|XP_010910828.1|  PREDICTED: pectinesterase 3-like                 62.8    7e-09   
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g           63.5    7e-09   Phaseolus vulgaris [French bean]
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                   63.5    8e-09   Phoenix dactylifera
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                   62.0    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401623.1|  PREDICTED: pectinesterase 3-like                 60.8    3e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC70505.1|  hypothetical protein OsI_01594                        61.6    3e-08   Oryza sativa Indica Group [Indian rice]
gb|ACQ85264.1|  pectin methylesterase                                 61.6    3e-08   Musa acuminata AAA Group [Cavendish banana]
gb|AGG23325.1|  pectin methylesterase 1                               61.2    4e-08   Musa acuminata AAA Group [Cavendish banana]
gb|EEE54425.1|  hypothetical protein OsJ_01485                        61.2    5e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                   60.5    7e-08   Brachypodium distachyon [annual false brome]
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...  60.1    9e-08   Glycine max [soybeans]
ref|NP_001146685.1|  pectinesterase precursor                         58.5    3e-07   Zea mays [maize]
gb|KJB49889.1|  hypothetical protein B456_008G143700                  58.5    4e-07   Gossypium raimondii
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                   58.2    4e-07   Solanum lycopersicum
tpg|DAA54386.1|  TPA: hypothetical protein ZEAMMB73_825660            57.0    6e-07   
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...  57.4    7e-07   Solanum tuberosum [potatoes]
gb|EMS68834.1|  Pectinesterase 1                                      57.4    7e-07   Triticum urartu
dbj|BAJ96804.1|  predicted protein                                    57.0    1e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830        56.6    1e-06   Sorghum bicolor [broomcorn]
gb|EMT05022.1|  Pectinesterase 3                                      56.2    1e-06   
gb|EPS67066.1|  pectinesterase                                        54.7    7e-06   Genlisea aurea
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                   52.0    5e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010556724.1|  PREDICTED: pectinesterase-like                   50.8    1e-04   Tarenaya hassleriana [spider flower]



>ref|XP_002271665.2| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=561

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 71/116 (61%), Gaps = 14/116 (12%)
 Frame = +2

Query  83   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  262
            M+N + +A    ++   SA    AFL +T+   L           P + ++   +H  K 
Sbjct  1    MYNHRARAKFLLSLLSISA---FAFLLLTTVKPL--------KKSPKNTEIP-QLHLHKH  48

Query  263  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            +Q+AH+  CEGTLYPELCVSTL+T  PD  +KT+PE+IAATV+ TV EVK SA+NC
Sbjct  49   VQIAHSH-CEGTLYPELCVSTLST-FPDLASKTVPEVIAATVSHTVGEVKLSASNC  102



>emb|CBI36883.3| unnamed protein product [Vitis vinifera]
Length=549

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = +2

Query  137  AIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELC  316
            A  LL+ LS+++F  L           P + ++   +H  K +Q+AH+  CEGTLYPELC
Sbjct  18   AKFLLSLLSISAFAFLLLTTVKPLKKSPKNTEIP-QLHLHKHVQIAHSH-CEGTLYPELC  75

Query  317  VSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            VSTL+T  PD  +KT+PE+IAATV+ TV EVK SA+NC
Sbjct  76   VSTLST-FPDLASKTVPEVIAATVSHTVGEVKLSASNC  112



>ref|XP_009592542.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=568

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 72/116 (62%), Gaps = 9/116 (8%)
 Frame = +2

Query  83   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  262
            M+N++ K +L  TI   +A++LL F  + S       +  SSS+      +  +IH  K 
Sbjct  1    MYNIRHKPSLILTILASTALILLTFFVLLS-------NPKSSSSRAAEKTMTPHIHVHKN  53

Query  263  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            +Q+A +  CEGTL+PELCVSTL++  P+   K+I EII++TV + V EV+ASA NC
Sbjct  54   IQIAQSH-CEGTLHPELCVSTLSS-FPNLHRKSIAEIISSTVKIAVGEVRASAHNC  107



>ref|XP_011015915.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 52/62 (84%), Gaps = 2/62 (3%)
 Frame = +2

Query  245  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  424
            +H  K +Q+AH+ AC+GTLYPELCVSTL + LPD  +K++PE I+AT+N T+DEV+AS+A
Sbjct  43   LHIHKHIQIAHS-ACKGTLYPELCVSTLVS-LPDLASKSLPEFISATLNKTMDEVRASSA  100

Query  425  NC  430
            NC
Sbjct  101  NC  102



>gb|EPS62329.1| pectinesterase [Genlisea aurea]
Length=560

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +2

Query  245  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  424
            IH  + +QVA + AC+GTLYP+LCVST++  LP+ R KT+PEIIAAT+NVT+ EV+ +++
Sbjct  34   IHAYEHVQVAES-ACDGTLYPDLCVSTVSAVLPELRRKTLPEIIAATINVTMKEVRTASS  92

Query  425  NC  430
            NC
Sbjct  93   NC  94



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 2/62 (3%)
 Frame = +2

Query  245  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  424
            +H  K LQ+AH+ ACEGTLYPELCVST+++  PD  +KTIP+II+ATV  TV+EV+ SA+
Sbjct  44   LHLHKHLQIAHS-ACEGTLYPELCVSTVSS-FPDLASKTIPDIISATVQHTVNEVRTSAS  101

Query  425  NC  430
            NC
Sbjct  102  NC  103



>ref|XP_011079629.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=566

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 37/62 (60%), Positives = 50/62 (81%), Gaps = 2/62 (3%)
 Frame = +2

Query  245  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  424
            IH  + +Q+A +  CEGTLYP+LCVST+A A P+ R KT+PEII+ T+NVT+ EV+ASA+
Sbjct  41   IHVYRHVQIAKS-TCEGTLYPDLCVSTVA-AFPELRRKTLPEIISGTINVTMKEVRASAS  98

Query  425  NC  430
            NC
Sbjct  99   NC  100



>ref|XP_009614504.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=563

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 69/117 (59%), Gaps = 29/117 (25%)
 Frame = +2

Query  83   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  262
            M+N ++K +L  T+S   AI+LL F S                       L +++  Q +
Sbjct  1    MYNQRRKPSLLLTLS---AIILLIFFS-----------------------LPISLQTQNI  34

Query  263  -LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
             L++AH+  C+ TLYP+LC+STL+  +P+   KTIPEII++TVN TVDEVKAS  NC
Sbjct  35   QLEIAHSH-CQDTLYPQLCISTLSL-IPNLHQKTIPEIISSTVNTTVDEVKASTENC  89



>ref|XP_011010963.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=558

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 51/62 (82%), Gaps = 2/62 (3%)
 Frame = +2

Query  245  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  424
            +H  K +Q+AH+ AC+GTLYPELCVSTL + L D  +K++PE I+AT+N T+DEV+AS+A
Sbjct  43   LHIHKHIQIAHS-ACKGTLYPELCVSTLVS-LSDLASKSLPEFISATLNKTMDEVRASSA  100

Query  425  NC  430
            NC
Sbjct  101  NC  102



>gb|EYU46746.1| hypothetical protein MIMGU_mgv1a0044632mg, partial [Erythranthe 
guttata]
Length=201

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +2

Query  242  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  421
             +H  K  QV     C+GTLYP LCVST+A A P+ R KT+PEIIA T+NVT+ EV+ SA
Sbjct  41   KLHVYKHAQVIAESTCDGTLYPGLCVSTVA-AFPELRQKTLPEIIAGTINVTMKEVRDSA  99

Query  422  ANC  430
             NC
Sbjct  100  TNC  102



>ref|XP_002301486.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
 gb|EEE80759.2| hypothetical protein POPTR_0002s20370g [Populus trichocarpa]
Length=558

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 51/62 (82%), Gaps = 2/62 (3%)
 Frame = +2

Query  245  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  424
            +H  K +Q+AH+ AC+GTLYPELCVSTL + LPD  +K++ E I+AT+N T+DEV+AS+A
Sbjct  43   LHIHKHIQIAHS-ACKGTLYPELCVSTLVS-LPDLASKSLQEFISATLNKTMDEVRASSA  100

Query  425  NC  430
            +C
Sbjct  101  DC  102



>gb|AHB84678.1| pectin methylesterase [Citrus reticulata]
Length=569

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 66/100 (66%), Gaps = 12/100 (12%)
 Frame = +2

Query  134  SAIVLLAF-LSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPE  310
            SAI LL F LS  S  +L  K    ++  P     +L +H+    QVAH+ ACEGTLYPE
Sbjct  22   SAIFLLLFVLSAVSVTTL--KKNPKTTDAP-----HLRVHKH--FQVAHS-ACEGTLYPE  71

Query  311  LCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            LCVSTL + +PD  +K +PE+I+ T+N T+ E++AS++NC
Sbjct  72   LCVSTLLS-VPDLASKRVPELISVTINRTLSELRASSSNC  110



>ref|XP_006480001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Citrus sinensis]
Length=569

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 66/100 (66%), Gaps = 12/100 (12%)
 Frame = +2

Query  134  SAIVLLAF-LSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPE  310
            SAI LL F LS  S  +L  K    ++  P     +L +H+    QVAH+ ACEGTLYPE
Sbjct  22   SAIFLLLFVLSAVSVTTL--KKNPKTTDAP-----HLRVHKH--FQVAHS-ACEGTLYPE  71

Query  311  LCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            LCVSTL + +PD  +K +PE+I+ T+N T+ E++AS++NC
Sbjct  72   LCVSTLLS-VPDLASKRVPELISVTINRTLSELRASSSNC  110



>ref|XP_006444399.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
 gb|ESR57639.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
Length=548

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 66/100 (66%), Gaps = 12/100 (12%)
 Frame = +2

Query  134  SAIVLLAF-LSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPE  310
            SAI LL F LS  S  +L  K    ++  P     +L +H+    QVAH+ ACEGTLYPE
Sbjct  1    SAIFLLLFVLSAVSVTTL--KKNPKTTDAP-----HLRVHKH--FQVAHS-ACEGTLYPE  50

Query  311  LCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            LCVSTL + +PD  +K +PE+I+ T+N T+ E++AS++NC
Sbjct  51   LCVSTLLS-VPDLASKRVPELISVTINRTLSELRASSSNC  89



>gb|KHG05999.1| putative pectinesterase/pectinesterase inhibitor 40 -like protein 
[Gossypium arboreum]
Length=560

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +2

Query  245  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  424
            +H    LQ+AH+ ACEGTLYP+LCVST+ + LPD  +KT+PE+I AT+N T+ EV+ S+A
Sbjct  43   LHVHNHLQIAHS-ACEGTLYPDLCVSTI-SVLPDLASKTLPELIQATLNQTMYEVRLSSA  100

Query  425  NC  430
            NC
Sbjct  101  NC  102



>ref|XP_004290811.1| PREDICTED: pectinesterase-like [Fragaria vesca subsp. vesca]
Length=567

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 73/117 (62%), Gaps = 13/117 (11%)
 Frame = +2

Query  83   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPT-HLDLNLNIHRQK  259
            M++L+++  L  ++   SA +L+ F S+  F         ++S  PT    +++  H Q 
Sbjct  1    MYSLRRRTKLLLSLLPTSAFILIIFFSLNHF---------TNSPKPTKEFTIHVEKHNQ-  50

Query  260  LLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            L QVAH+  C+ TLY +LCVSTL T+ P+  +KT+P+II++TVN T+ EV AS +NC
Sbjct  51   LNQVAHS-TCQNTLYKDLCVSTL-TSFPNLSSKTVPQIISSTVNKTMYEVIASNSNC  105



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (84%), Gaps = 2/56 (4%)
 Frame = +2

Query  263  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            LQ+AH+ ACEGTLYPELCVSTL++  PD  +KTI ++I++TVN TV EV+ SA+NC
Sbjct  71   LQIAHS-ACEGTLYPELCVSTLSS-FPDLTSKTISQMISSTVNYTVKEVEISASNC  124



>ref|XP_003519757.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Glycine max]
Length=562

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 8/95 (8%)
 Frame = +2

Query  146  LLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVST  325
            LL FL  T F    T   I+ +  P    L+   H QK +QV     C+GTLYP+LCVST
Sbjct  16   LLLFLGTTHF----TNTPITITRAPDQKHLH---HFQKHIQVVAKSTCQGTLYPDLCVST  68

Query  326  LATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            LAT  PD   K++P++I++ VN T+ EV++S+ NC
Sbjct  69   LAT-FPDLATKSVPQVISSVVNHTMYEVRSSSYNC  102



>emb|CDP15269.1| unnamed protein product [Coffea canephora]
Length=385

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = +2

Query  245  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  424
            IH  + LQ+AH+  C+ T YP+LCVSTLAT  PD R +T+PEII+  VN TV EV+ S  
Sbjct  69   IHVHQHLQIAHS-TCQDTFYPDLCVSTLAT-FPDLRQRTLPEIISGMVNSTVFEVRDSKQ  126

Query  425  NC  430
            NC
Sbjct  127  NC  128



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 71/116 (61%), Gaps = 15/116 (13%)
 Frame = +2

Query  83   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  262
            M+NL+++  L  ++   SA++L+   S T F +       +S+T  TH      +H +  
Sbjct  1    MYNLRRRTKLLLSVLPTSALLLILLFSNTHFRN------SNSNTPKTH------VHNR--  46

Query  263  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            +Q+A   AC+ TLY  LCVSTL+T  PD   K++P+II+ TV+ TV EV+AS++NC
Sbjct  47   IQLAAHSACQDTLYKLLCVSTLST-FPDLTTKSVPQIISYTVSHTVSEVQASSSNC  101



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 68/118 (58%), Gaps = 15/118 (13%)
 Frame = +2

Query  77   TRMHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQ  256
            T M+NL+++  L  ++   SA++L+   S T   +       S+S  P         H  
Sbjct  11   TTMYNLRRRTKLLLSVLPTSALLLILLFSNTHLRN-------SNSITP-------KTHVH  56

Query  257  KLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
              +Q+A   AC+ TLY +LCVSTL+T  PD   K++P+II+ TV+ TV EV+AS++NC
Sbjct  57   NRIQLAAHSACQDTLYKDLCVSTLST-FPDLSTKSVPQIISYTVSHTVSEVQASSSNC  113



>ref|XP_009628637.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=567

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 71/116 (61%), Gaps = 11/116 (9%)
 Frame = +2

Query  83   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  262
            M+NL++K +L  T+   SAIV L F         FT      S+  T L    +IH  K 
Sbjct  1    MYNLRRKTSLLLTLFALSAIVSLTF---------FTLSNNPKSSSKTVLTTTPHIHVHKN  51

Query  263  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            +Q+AH+  C+ T YP+LCVSTL+  +PD   K+I +II++T+NVTV EVKASA NC
Sbjct  52   IQIAHSH-CQDTRYPKLCVSTLSL-IPDLAQKSISQIISSTINVTVAEVKASARNC  105



>emb|CDP15270.1| unnamed protein product [Coffea canephora]
Length=587

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 2/62 (3%)
 Frame = +2

Query  245  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  424
            IH  + LQ+AH+  C+ T YP+LCVSTLAT  PD R +T+PEII+  VN TV EV+ S  
Sbjct  61   IHVHQHLQIAHS-TCQDTFYPDLCVSTLAT-FPDLRQRTLPEIISGMVNSTVFEVRDSKQ  118

Query  425  NC  430
            NC
Sbjct  119  NC  120



>ref|XP_009771845.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=561

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +2

Query  263  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            L++AH+  C+ TLYP+LC+STL+  +P+   KTIPEII++TVN T+DEVK S  NC
Sbjct  36   LEIAHSH-CQDTLYPQLCISTLSL-IPNLHQKTIPEIISSTVNATIDEVKGSTENC  89



>gb|KJB41904.1| hypothetical protein B456_007G127000 [Gossypium raimondii]
Length=560

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 48/62 (77%), Gaps = 2/62 (3%)
 Frame = +2

Query  245  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  424
            +H    LQ+AH+ ACE TLYP+LCVST+ + LPD  +K++PE+I AT+N T+ EV+ S+A
Sbjct  43   LHVHNHLQIAHS-ACEATLYPDLCVSTI-SVLPDLASKSLPELIQATLNQTMYEVRLSSA  100

Query  425  NC  430
            NC
Sbjct  101  NC  102



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 48/63 (76%), Gaps = 2/63 (3%)
 Frame = +2

Query  242  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  421
            ++H  K +QVA +  C+GTLYP+LCVSTLAT  PD  +K++P++I++ VN T+ EVK+S 
Sbjct  34   HLHFHKHMQVAQS-TCQGTLYPDLCVSTLAT-FPDLTSKSVPQVISSVVNHTMYEVKSSF  91

Query  422  ANC  430
             NC
Sbjct  92   YNC  94



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 49/62 (79%), Gaps = 2/62 (3%)
 Frame = +2

Query  245  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  424
            IH  K +Q+A++  C+ TLYP+LC+STL+  +P+   K+IPEII++ VNVT++EVK+SA 
Sbjct  37   IHVHKNIQIANSH-CQDTLYPKLCISTLSL-IPNLHKKSIPEIISSNVNVTMNEVKSSAE  94

Query  425  NC  430
            NC
Sbjct  95   NC  96



>ref|XP_002523113.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF39298.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=557

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +2

Query  242  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  421
            ++H QK  Q+AH+ ACEGTLYPELCVSTL ++LPD   +++ ++I++T++ T+ EV+ S 
Sbjct  39   HLHIQKHNQIAHS-ACEGTLYPELCVSTL-SSLPDLTYRSLQQLISSTISRTMYEVRVSY  96

Query  422  ANC  430
            +NC
Sbjct  97   SNC  99



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = +2

Query  263  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            +QVA + ACEGTLY +LCVSTL+T LPD  +KT+P+II + +N T+ EVK S++NC
Sbjct  42   IQVAQS-ACEGTLYQDLCVSTLST-LPDLTSKTVPQIICSVLNNTIKEVKQSSSNC  95



>ref|XP_004494389.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Cicer arietinum]
Length=549

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = +2

Query  263  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            LQVAH+  C+GTLYP LCVSTL+T   D  +K++P+II +T+N T++EVK+S+ NC
Sbjct  38   LQVAHS-TCQGTLYPNLCVSTLST-FQDLASKSVPQIICSTLNSTINEVKSSSFNC  91



>ref|XP_009765668.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=566

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 72/116 (62%), Gaps = 12/116 (10%)
 Frame = +2

Query  83   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  262
            M+NL++K  L  T+   SAIV + F  +++     +K   +  T P       +IH  K 
Sbjct  1    MYNLRRKTPLLLTLFALSAIVSVTFFGLSNNPKSSSK---TVQTTP-------HIHVHKN  50

Query  263  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            +Q+AH+  C+ T YP+LCVSTL+  +PD   K+I +II++T+NVTV EVKASA NC
Sbjct  51   IQIAHSH-CQDTRYPKLCVSTLSL-IPDLAQKSISQIISSTINVTVAEVKASAKNC  104



>ref|XP_009383893.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=567

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 46/65 (71%), Gaps = 2/65 (3%)
 Frame = +2

Query  236  NLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKA  415
             L++H  +L   A  + C+GTLYP+LCVSTL+T +PD  AK++PE+I A+VN T   V+ 
Sbjct  46   QLHVH-SRLQATAAADHCDGTLYPDLCVSTLST-IPDLHAKSLPEVICASVNTTAAAVRN  103

Query  416  SAANC  430
            +A NC
Sbjct  104  AAKNC  108



>gb|KJB09419.1| hypothetical protein B456_001G140500 [Gossypium raimondii]
Length=561

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 46/61 (75%), Gaps = 2/61 (3%)
 Frame = +2

Query  245  IHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAA  424
             H    LQ A + AC+GTLYPELCVST+ + LPD  +K++PE+I+AT+N T+ EV+ S+A
Sbjct  43   FHVHNHLQRA-SSACDGTLYPELCVSTI-SVLPDLASKSLPELISATLNQTMHEVRLSSA  100

Query  425  N  427
            N
Sbjct  101  N  101



>ref|XP_008359413.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=579

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 69/117 (59%), Gaps = 13/117 (11%)
 Frame = +2

Query  83   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQK-  259
            M+NL++   L  T+   S + L    S   F +       S+S  P    ++   H QK 
Sbjct  1    MYNLRRTKILLSTLFLTSILFLSLLFSKPHFKN-------SNSKSP---KIHFQNHIQKQ  50

Query  260  LLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            +L+ AH  AC+ TLY  LC+STLAT  P+  +KT+P+II++TV+ TV EVKAS++NC
Sbjct  51   VLETAHW-ACQDTLYKSLCLSTLAT-FPNLASKTLPQIISSTVSHTVLEVKASSSNC  105



>ref|XP_010069896.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=561

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 2/52 (4%)
 Frame = +2

Query  242  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVT  397
            + H ++ LQVAH+  C+GTLYP+LCVSTLA+  PD  +K++PEII++TVN+T
Sbjct  33   HFHTRRHLQVAHS-TCQGTLYPDLCVSTLAS-FPDLASKSVPEIISSTVNLT  82



>ref|XP_010910828.1| PREDICTED: pectinesterase 3-like [Elaeis guineensis]
Length=338

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 6/76 (8%)
 Frame = +2

Query  218  PTHLDLNLNIHRQKLLQV-AHTEA----CEGTLYPELCVSTLATALPDRRAKTIPEIIAA  382
            P     + N  R+  L V +H +A    C+GTLYP+LCVSTLA  +P+  +K++P++IAA
Sbjct  26   PIERKPSANGRRRHQLHVHSHLQAAARHCDGTLYPDLCVSTLAD-IPNLTSKSLPDVIAA  84

Query  383  TVNVTVDEVKASAANC  430
             VN T ++V+ SA+NC
Sbjct  85   VVNRTANDVRFSASNC  100



>ref|XP_007163135.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
 gb|ESW35129.1| hypothetical protein PHAVU_001G209400g [Phaseolus vulgaris]
Length=601

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 57/99 (58%), Gaps = 15/99 (15%)
 Frame = +2

Query  134  SAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPEL  313
            SA+ +L   SVT F+      G + S    HL             VA++  CEGTLYP+L
Sbjct  60   SAVHVLLLFSVTQFS---ITAGATRSLQQNHLHF----------HVANS-TCEGTLYPDL  105

Query  314  CVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            CVSTL T+ PD  +KT+PE+I + VN T+ EV  S++NC
Sbjct  106  CVSTL-TSFPDLTSKTVPEMIRSVVNHTIYEVTLSSSNC  143



>ref|XP_008795768.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=557

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 47/63 (75%), Gaps = 2/63 (3%)
 Frame = +2

Query  242  NIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASA  421
            ++H +  LQVA +  C+GTLYP+LCVSTLA  +P+  +K +P++IAA VN T   V++SA
Sbjct  42   HLHIRSDLQVA-SRHCDGTLYPDLCVSTLAD-IPNLSSKPLPDVIAAVVNRTAAAVRSSA  99

Query  422  ANC  430
            +NC
Sbjct  100  SNC  102



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 6/71 (8%)
 Frame = +2

Query  218  PTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVT  397
            P H  L+++ H Q       T+ C+GTLYP+LC STL+T +PD  +K++PE+I AT+N +
Sbjct  42   PYHHRLHVHSHLQDA-----TDHCDGTLYPDLCASTLST-IPDLHSKSLPEVICATINAS  95

Query  398  VDEVKASAANC  430
               V  SA NC
Sbjct  96   EAAVIKSAKNC  106



>ref|XP_009401623.1| PREDICTED: pectinesterase 3-like [Musa acuminata subsp. malaccensis]
Length=352

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +2

Query  206  SSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAAT  385
            S+  P      L +H       A  + C+GT+YPELCVSTL +  PD  +K++P +I AT
Sbjct  31   SAPKPVAYHHKLRVHSHLHAAAAAVDHCDGTIYPELCVSTL-SVFPDLHSKSLPAVICAT  89

Query  386  VNVTVDEVKASAANC  430
            +N T   V+ SA NC
Sbjct  90   INATEAAVRGSAKNC  104



>gb|EEC70505.1| hypothetical protein OsI_01594 [Oryza sativa Indica Group]
Length=565

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +2

Query  287  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            CEGTLYPELC+STLA  +PD   K++P++I  TVN T D V A++ NC
Sbjct  49   CEGTLYPELCLSTLAD-IPDLHTKSLPDVICGTVNRTKDAVAATSYNC  95



>gb|ACQ85264.1| pectin methylesterase [Musa acuminata AAA Group]
Length=565

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 6/71 (8%)
 Frame = +2

Query  218  PTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVT  397
            P H  L+++ H Q       T  C+GTLYP+LC STL+T +PD  +K++PE+I AT+N +
Sbjct  41   PYHHRLHVHSHLQDA-----TGHCDGTLYPDLCASTLST-IPDLHSKSLPEVICATINAS  94

Query  398  VDEVKASAANC  430
               V  SA NC
Sbjct  95   EGAVIKSAKNC  105



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 6/71 (8%)
 Frame = +2

Query  218  PTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVT  397
            P H  L+++ H Q       T  C+GTLYP+LC STL+T +PD  +K++PE+I AT+N +
Sbjct  42   PYHHRLHVHSHLQDA-----TXHCDGTLYPDLCASTLST-IPDLHSKSLPEVICATINAS  95

Query  398  VDEVKASAANC  430
               V  SA NC
Sbjct  96   EXAVIKSAKNC  106



>gb|EEE54425.1| hypothetical protein OsJ_01485 [Oryza sativa Japonica Group]
Length=584

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +2

Query  287  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            CEGTLYPELC+STLA  +PD   K++P++I  TVN T D V A++ NC
Sbjct  49   CEGTLYPELCLSTLAD-IPDLHTKSLPDVICGTVNRTKDAVAATSYNC  95



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +2

Query  287  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            CEGTLYPELC+STLAT +PD   K +P++I ATVN T  EV   A+NC
Sbjct  43   CEGTLYPELCLSTLAT-VPDLHKKPLPDVICATVNRTEVEVADMASNC  89



>ref|XP_003553658.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39-like 
[Glycine max]
Length=615

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 2/56 (4%)
 Frame = +2

Query  263  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
             QVA++  CEGTLY +LCVSTLA+  PD  +KT+P++I + VN T+ EV  SA+NC
Sbjct  102  FQVANS-TCEGTLYSDLCVSTLAS-FPDLTSKTLPQMIRSVVNHTIYEVTLSASNC  155



>ref|NP_001146685.1| pectinesterase precursor [Zea mays]
 gb|ACL54524.1| unknown [Zea mays]
 tpg|DAA54385.1| TPA: pectinesterase [Zea mays]
Length=563

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +2

Query  287  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            C+GTLYPELC+STLA  +PD   K +P++I A VN T D V A+++NC
Sbjct  44   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTEDVVVATSSNC  90



>gb|KJB49889.1| hypothetical protein B456_008G143700 [Gossypium raimondii]
Length=558

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 51/76 (67%), Gaps = 7/76 (9%)
 Frame = +2

Query  203  SSSTGPTHLDLNLNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAA  382
            S  T  TH     + H    LQ+A+T ACEGTLYP+LCV+T++  L +  ++++P++I+A
Sbjct  31   SPETSETH-----HFHVNNNLQIAYT-ACEGTLYPDLCVATVSI-LQNLASRSLPDLISA  83

Query  383  TVNVTVDEVKASAANC  430
             +  T+DEV+ S ANC
Sbjct  84   ILIQTMDEVRLSCANC  99



>ref|XP_004247400.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=562

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 66/116 (57%), Gaps = 18/116 (16%)
 Frame = +2

Query  83   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  262
            M++L+ K  L  ++     IV L F +  S NS                   ++IH  K 
Sbjct  1    MYSLQWKTPLLLSLLAIFIIVSLTFFTSLSKNSSEI----------------VHIHVHKN  44

Query  263  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            +Q+AH+  CE  LY +LCVSTLA+ +PD   K+I +II++T+NVTV EVKASA NC
Sbjct  45   IQIAHSH-CEDALYKQLCVSTLAS-IPDLPQKSISQIISSTINVTVVEVKASAKNC  98



>tpg|DAA54386.1| TPA: hypothetical protein ZEAMMB73_825660 [Zea mays]
Length=347

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +2

Query  287  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            C+GTLYPELC+STLA  +PD   K +P++I A VN T D V A+++NC
Sbjct  44   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTEDVVVATSSNC  90



>ref|XP_006359860.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Solanum tuberosum]
Length=562

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 69/116 (59%), Gaps = 18/116 (16%)
 Frame = +2

Query  83   MHNLKQKATLFFTISGCSAIVLLAFLSVTSFNSLFTKDGISSSTGPTHLDLNLNIHRQKL  262
            M+NLK K  L  ++   SAIV L F +  S NS  T                ++IH  K 
Sbjct  1    MYNLKWKTPLLLSLLAISAIVCLTFFTSLSKNSSET----------------VHIHVHKN  44

Query  263  LQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            +Q+AH+  CE  LY +LCVSTL++ +PD   K+I +II++T+NVTV EVKASA NC
Sbjct  45   IQIAHSH-CEDALYKQLCVSTLSS-IPDLPQKSISQIISSTINVTVVEVKASAKNC  98



>gb|EMS68834.1| Pectinesterase 1 [Triticum urartu]
Length=449

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +2

Query  287  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            CEGTLYPELC+STLA  +PD   K +P++I A VN T  EV   +ANC
Sbjct  54   CEGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTETEVTTMSANC  100



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +2

Query  287  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            C+GTLYPELC+STLA  +PD   K +P++I A VN T  EV   +ANC
Sbjct  55   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTETEVTTMSANC  101



>ref|XP_002455538.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
 gb|EES00658.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
Length=576

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +2

Query  287  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            C+GTLYPELC+STLA  +PD   K +P++I A VN T D V A++ NC
Sbjct  49   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNHTEDVVTATSTNC  95



>gb|EMT05022.1| Pectinesterase 3 [Aegilops tauschii]
Length=472

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = +2

Query  287  CEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            C+GTLYPELC+STLA  +PD   K +P++I A VN T  EV   +ANC
Sbjct  52   CDGTLYPELCLSTLAD-IPDLHKKPLPDVICAAVNRTETEVTTMSANC  98



>gb|EPS67066.1| pectinesterase [Genlisea aurea]
Length=955

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = +2

Query  284  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAAN  427
            AC+G LY +LCVST+ T L  RR  T+PE+IAATV+V + EV ++++N
Sbjct  451  ACDGALYDDLCVSTVVTKL--RRNTTLPEMIAATVDVAMAEVMSASSN  496



>ref|XP_010684346.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=576

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 43/63 (68%), Gaps = 2/63 (3%)
 Frame = +2

Query  239  LNIHRQKLLQVAHTEACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKAS  418
            +++H Q  LQ+A +  C+GTLY +LC+STL+  +P    K++ EI+   ++VT  EV+AS
Sbjct  38   IHLHVQNHLQLAQSH-CDGTLYTDLCISTLSN-IPHLHKKSLTEILRYVISVTEAEVRAS  95

Query  419  AAN  427
            A N
Sbjct  96   ATN  98



>ref|XP_010556724.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=547

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +2

Query  284  ACEGTLYPELCVSTLATALPDRRAKTIPEIIAATVNVTVDEVKASAANC  430
            ACE T + +LC S L++ LP   + ++PE+IAATVN T+ EV  S++NC
Sbjct  50   ACERTRFKDLCFSPLSS-LPPGNSSSVPELIAATVNETISEVMISSSNC  97



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551197703000