BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF048K15

Length=482
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACF17656.1|  putative glutamine synthase 2                           208   5e-62   Capsicum annuum
ref|XP_009629915.1|  PREDICTED: glutamine synthetase, chloroplastic     206   3e-61   Nicotiana tomentosiformis
ref|XP_009773609.1|  PREDICTED: glutamine synthetase, chloroplastic     206   4e-61   Nicotiana sylvestris
ref|NP_001275177.1|  glutamine synthetase, chloroplastic-like           203   5e-60   Solanum tuberosum [potatoes]
ref|XP_004229461.1|  PREDICTED: glutamine synthetase, chloroplastic     201   3e-59   
ref|XP_010105702.1|  Glutamine synthetase leaf isozyme                  194   1e-56   Morus notabilis
emb|CDO98975.1|  unnamed protein product                                194   2e-56   Coffea canephora [robusta coffee]
ref|XP_011090823.1|  PREDICTED: glutamine synthetase leaf isozyme...    192   5e-56   Sesamum indicum [beniseed]
gb|EYU45601.1|  hypothetical protein MIMGU_mgv1a007136mg                192   5e-56   Erythranthe guttata [common monkey flower]
ref|XP_011006593.1|  PREDICTED: glutamine synthetase leaf isozyme...    191   2e-55   Populus euphratica
ref|XP_002314425.1|  glutamine synthetase family protein                191   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_006380048.1|  hypothetical protein POPTR_0008s20460g             187   2e-55   
ref|XP_007034566.1|  Glutamine synthetase 2                             193   3e-55   
emb|CAA47373.2|  glutamate--ammonia ligase                              191   3e-55   Nicotiana sylvestris
dbj|BAF62340.1|  glutamine synthetase                                   191   3e-55   Avicennia marina
ref|XP_011071523.1|  PREDICTED: glutamine synthetase leaf isozyme...    190   5e-55   Sesamum indicum [beniseed]
pir||S22527  glutamate-ammonia ligase (EC 6.3.1.2) - tobacco            189   9e-55
ref|XP_002312733.1|  glutamine synthetase family protein                189   1e-54   
ref|XP_011009035.1|  PREDICTED: glutamine synthetase leaf isozyme...    189   2e-54   Populus euphratica
ref|XP_002516801.1|  glutamine synthetase plant, putative               187   8e-54   Ricinus communis
sp|O22506.1|GLNA2_DAUCA  RecName: Full=Glutamine synthetase, chlo...    186   3e-53   Daucus carota [carrots]
gb|KDO74876.1|  hypothetical protein CISIN_1g013478mg                   183   8e-53   Citrus sinensis [apfelsine]
ref|XP_008223033.1|  PREDICTED: glutamine synthetase leaf isozyme...    184   9e-53   Prunus mume [ume]
ref|XP_008351243.1|  PREDICTED: glutamine synthetase, chloroplast...    176   2e-52   
gb|KHG04493.1|  Glutamine synthetase leaf isozyme, chloroplastic        183   2e-52   Gossypium arboreum [tree cotton]
ref|XP_006419778.1|  hypothetical protein CICLE_v10005007mg             183   2e-52   Citrus clementina [clementine]
gb|KDO74872.1|  hypothetical protein CISIN_1g013478mg                   183   2e-52   Citrus sinensis [apfelsine]
ref|XP_010255852.1|  PREDICTED: glutamine synthetase leaf isozyme...    183   3e-52   Nelumbo nucifera [Indian lotus]
ref|XP_007222384.1|  hypothetical protein PRUPE_ppa006025mg             182   8e-52   Prunus persica
gb|KDP40083.1|  hypothetical protein JCGZ_02081                         181   9e-52   Jatropha curcas
ref|XP_004174085.1|  PREDICTED: glutamine synthetase, chloroplast...    174   1e-51   
gb|KJB37729.1|  hypothetical protein B456_006G218100                    181   2e-51   Gossypium raimondii
ref|XP_011462784.1|  PREDICTED: glutamine synthetase leaf isozyme...    181   2e-51   Fragaria vesca subsp. vesca
gb|AAN84538.1|  putative plastidic glutamine synthetase                 180   2e-51   Spiraea nipponica
gb|KHN37551.1|  Glutamine synthetase leaf isozyme, chloroplastic        180   3e-51   Glycine soja [wild soybean]
gb|AAD49734.1|AF169795_1  glutamine synthetase precursor                180   4e-51   Juglans nigra
gb|KCW84320.1|  hypothetical protein EUGRSUZ_B01163                     176   9e-51   Eucalyptus grandis [rose gum]
ref|XP_006593484.1|  PREDICTED: glutamine synthetase precursor is...    179   1e-50   Glycine max [soybeans]
ref|XP_003546121.1|  PREDICTED: glutamine synthetase leaf isozyme...    179   1e-50   Glycine max [soybeans]
ref|NP_001237784.1|  glutamine synthetase precursor                     179   1e-50   
gb|ACU18743.1|  unknown                                                 178   1e-50   Glycine max [soybeans]
gb|ACU24520.1|  unknown                                                 178   1e-50   Glycine max [soybeans]
gb|KJB28233.1|  hypothetical protein B456_005G035800                    177   3e-50   Gossypium raimondii
ref|XP_010035905.1|  PREDICTED: glutamine synthetase leaf isozyme...    177   3e-50   Eucalyptus grandis [rose gum]
gb|ADK27329.1|  plastid glutamine synthetase                            177   4e-50   Vigna radiata [mung bean]
ref|XP_010035896.1|  PREDICTED: glutamine synthetase leaf isozyme...    177   4e-50   Eucalyptus grandis [rose gum]
ref|XP_009339932.1|  PREDICTED: glutamine synthetase leaf isozyme...    177   5e-50   Pyrus x bretschneideri [bai li]
ref|XP_010041422.1|  PREDICTED: glutamine synthetase leaf isozyme...    176   8e-50   Eucalyptus grandis [rose gum]
ref|XP_009352136.1|  PREDICTED: glutamine synthetase leaf isozyme...    176   8e-50   Pyrus x bretschneideri [bai li]
sp|P08281.2|GLNA2_PEA  RecName: Full=Glutamine synthetase leaf is...    176   9e-50   Pisum sativum [garden pea]
ref|XP_008361978.1|  PREDICTED: glutamine synthetase leaf isozyme...    175   2e-49   
gb|AGV54414.1|  glutamine synthetase                                    175   2e-49   Phaseolus vulgaris [French bean]
ref|XP_004486102.1|  PREDICTED: glutamine synthetase leaf isozyme...    175   2e-49   Cicer arietinum [garbanzo]
gb|AAF17703.1|AF031082_1  glutamine synthetase                          175   2e-49   Canavalia lineata
ref|XP_008390805.1|  PREDICTED: glutamine synthetase leaf isozyme...    175   3e-49   Malus domestica [apple tree]
ref|XP_002279497.1|  PREDICTED: glutamine synthetase leaf isozyme...    175   3e-49   Vitis vinifera
ref|XP_007147796.1|  hypothetical protein PHAVU_006G155800g             175   3e-49   Phaseolus vulgaris [French bean]
prf||1601519A  Gln synthetase                                           175   3e-49
ref|XP_008353244.1|  PREDICTED: glutamine synthetase leaf isozyme...    175   3e-49   
ref|NP_001284439.1|  glutamine synthetase leaf isozyme, chloropla...    174   4e-49   Cucumis melo [Oriental melon]
ref|XP_008438737.1|  PREDICTED: glutamine synthetase leaf isozyme...    174   5e-49   Cucumis melo [Oriental melon]
ref|XP_004134161.1|  PREDICTED: glutamine synthetase leaf isozyme...    174   5e-49   Cucumis sativus [cucumbers]
gb|AAN84537.1|  putative plastidic glutamine synthetase                 174   9e-49   Crataegus crus-galli
ref|XP_006593065.1|  PREDICTED: glutamine synthetase leaf isozyme...    166   3e-48   Glycine max [soybeans]
gb|KDO74871.1|  hypothetical protein CISIN_1g013478mg                   172   4e-48   Citrus sinensis [apfelsine]
gb|ACJ84875.1|  unknown                                                 169   6e-48   Medicago truncatula
gb|KDO74875.1|  hypothetical protein CISIN_1g013478mg                   171   1e-47   Citrus sinensis [apfelsine]
gb|AAN84563.1|  glutamine synthetase                                    171   1e-47   Lotus japonicus
sp|Q9XQ94.1|GLNA2_MEDSA  RecName: Full=Glutamine synthetase leaf ...    170   1e-47   Medicago sativa [alfalfa]
gb|AAO85218.1|  glutamine synthetase PR2 mutant                         170   1e-47   Lotus japonicus
gb|AAL67439.1|  glutamine synthetase precursor                          170   1e-47   Lotus japonicus
gb|KEH36742.1|  glutamine synthetase domain protein                     169   2e-47   Medicago truncatula
gb|AAO37651.1|  glutamine synthetase                                    169   3e-47   Medicago truncatula
gb|AJD14836.1|  plastid glutamine synthetase                            169   3e-47   Boehmeria nivea [Chinese silk-plant]
gb|AJI44225.1|  plastid glutamine synthetase                            169   4e-47   Boehmeria nivea [Chinese silk-plant]
gb|KCW44355.1|  hypothetical protein EUGRSUZ_L021751                    162   5e-47   Eucalyptus grandis [rose gum]
gb|ADM45299.1|  chloroplast GS2b-alpha precursor                        167   2e-46   Medicago truncatula
gb|AAO85217.1|  glutamine synthetase PR1 mutant                         167   3e-46   Lotus japonicus
ref|XP_003594092.1|  Glutamine synthetase                               170   3e-45   
gb|ABL89188.2|  plastid glutamine synthetase 2                          164   6e-45   Spinacia oleracea
ref|XP_002274139.1|  PREDICTED: glutamine synthetase leaf isozyme...    162   3e-44   Vitis vinifera
ref|XP_010557680.1|  PREDICTED: glutamine synthetase, chloroplast...    159   2e-43   Tarenaya hassleriana [spider flower]
gb|AFH88076.1|  chloroplast glutamine synthetase protein                159   3e-43   Sesuvium portulacastrum [sea-purslane]
ref|XP_010542001.1|  PREDICTED: glutamine synthetase, chloroplast...    158   5e-43   Tarenaya hassleriana [spider flower]
gb|AAD31898.1|AF145480_1  glutamine synthetase leaf isozyme precu...    154   3e-41   Mesembryanthemum crystallinum
gb|AAY33511.1|  glutamine synthetase precursor                          145   3e-41   Lotus japonicus
ref|XP_010666333.1|  PREDICTED: glutamine synthetase leaf isozyme...    152   1e-40   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN61808.1|  hypothetical protein VITISV_014295                     152   1e-40   Vitis vinifera
ref|XP_010435449.1|  PREDICTED: glutamine synthetase, chloroplast...    149   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010435447.1|  PREDICTED: glutamine synthetase, chloroplast...    149   2e-39   
dbj|BAH56878.1|  AT5G35630                                              145   4e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450396.1|  PREDICTED: glutamine synthetase, chloroplast...    147   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_002868428.1|  hypothetical protein ARALYDRAFT_493621             147   1e-38   
ref|XP_009124267.1|  PREDICTED: glutamine synthetase, chloroplastic     146   1e-38   Brassica rapa
emb|CDY33684.1|  BnaC04g29670D                                          147   1e-38   Brassica napus [oilseed rape]
ref|NP_198413.1|  glutamine synthetase 2                                146   2e-38   Arabidopsis thaliana [mouse-ear cress]
gb|ABY87178.1|  chloroplast glutamine synthetase                        145   4e-38   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_006395952.1|  hypothetical protein EUTSA_v10004280mg             144   7e-38   Eutrema salsugineum [saltwater cress]
emb|CDY49365.1|  BnaA08g29950D                                          143   1e-37   Brassica napus [oilseed rape]
ref|XP_008779349.1|  PREDICTED: glutamine synthetase leaf isozyme...    140   1e-37   
ref|XP_009108017.1|  PREDICTED: glutamine synthetase, chloroplast...    144   2e-37   Brassica rapa
emb|CAB72423.1|  glutamine synthetase                                   143   2e-37   Brassica napus [oilseed rape]
ref|XP_010938796.1|  PREDICTED: glutamine synthetase leaf isozyme...    143   3e-37   Elaeis guineensis
emb|CAA73062.1|  plastidic glutamine synthetase precursor               142   6e-37   Brassica napus [oilseed rape]
ref|XP_006282617.1|  hypothetical protein CARUB_v10004865mg             141   1e-36   Capsella rubella
ref|XP_006850815.1|  hypothetical protein AMTR_s00025p00120730          136   6e-35   Amborella trichopoda
ref|XP_010435452.1|  PREDICTED: glutamine synthetase, chloroplast...    136   7e-35   
ref|XP_009391592.1|  PREDICTED: glutamine synthetase leaf isozyme...    136   9e-35   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX84116.1|  BnaC08g07930D                                          130   6e-34   
ref|XP_009417914.1|  PREDICTED: glutamine synthetase leaf isozyme...    134   6e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003580719.1|  PREDICTED: glutamine synthetase, chloroplastic     123   4e-30   Brachypodium distachyon [annual false brome]
gb|KHN31946.1|  Glutamine synthetase leaf isozyme, chloroplastic        117   2e-29   Glycine soja [wild soybean]
prf||1804333B  Gln synthetase                                           119   1e-28
gb|AFB69878.1|  chloroplast glutamine synthetase isoform 2-1            118   3e-28   Secale cereale
gb|AAZ30061.1|  plastid glutamine synthetase isoform GS2b               117   5e-28   Triticum aestivum [Canadian hard winter wheat]
gb|AAZ30062.1|  plastid glutamine synthetase isoform GS2c               117   5e-28   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004960149.1|  PREDICTED: glutamine synthetase, chloroplast...    117   7e-28   Setaria italica
gb|AAZ30060.1|  plastid glutamine synthetase isoform GS2a               116   9e-28   Triticum aestivum [Canadian hard winter wheat]
gb|ACT22500.1|  plastid glutamine synthetase 2                          115   2e-27   Triticum aestivum [Canadian hard winter wheat]
gb|ACT22496.1|  plastid glutamine synthetase 2                          115   2e-27   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ91545.1|  predicted protein                                      115   2e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
prf||1804333D  Gln synthetase                                           115   2e-27
dbj|BAJ95492.1|  predicted protein                                      115   2e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001241708.1|  uncharacterized protein LOC100856886               115   3e-27   
ref|XP_008662330.1|  PREDICTED: glutamine synthetase, chloroplast...    115   3e-27   Zea mays [maize]
ref|XP_008662331.1|  PREDICTED: glutamine synthetase, chloroplast...    115   4e-27   
ref|NP_001105725.1|  glutamine synthetase, chloroplastic precursor      115   4e-27   
prf||1804333C  Gln synthetase                                           114   1e-26
gb|AAL87183.1|AF480497_11  putative precursor chloroplastic gluta...    113   2e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CAA34131.1|  unnamed protein product                                113   2e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAG88835.1|  unnamed protein product                                112   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054133.1|  Os04g0659100                                       113   2e-26   
dbj|BAD12057.1|  plastidic glutamine synthetase                         112   2e-26   Phragmites australis
dbj|BAD12059.1|  plastidic glutamine synthetase                         111   8e-26   Phragmites australis
sp|P13564.2|GLNA2_HORVU  RecName: Full=Glutamine synthetase leaf ...    110   1e-25   Hordeum vulgare [barley]
gb|EPS57543.1|  glutamine synthetase                                    108   1e-25   Genlisea aurea
gb|EMS53309.1|  Glutamine synthetase leaf isozyme, chloroplastic        110   3e-25   Triticum urartu
emb|CAA29057.1|  gluthamine synthetase                                  109   3e-25   Pisum sativum [garden pea]
gb|ACG35376.1|  glutamine synthetase                                    107   2e-24   Zea mays [maize]
gb|ACG31728.1|  hypothetical protein                                    106   3e-24   Zea mays [maize]
ref|XP_006653841.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    105   7e-24   
gb|AHJ10962.1|  chloroplast glutamine synthetase 2 isoform 2          89.7    6e-18   Lemna minor
gb|AHJ10961.1|  chloroplast glutamine synthetase 2 isoform 1          89.4    6e-18   Lemna minor
emb|CDY49656.1|  BnaC09g41340D                                        88.2    8e-18   Brassica napus [oilseed rape]
gb|AFW89160.1|  glutamine synthetase3 isoform 1                       84.0    9e-18   
gb|KFK25875.1|  hypothetical protein AALP_AA8G173600                  87.4    2e-17   Arabis alpina [alpine rockcress]
gb|AAP33476.1|  cytosolic glutamine synthetase                        83.2    3e-17   Securigera parviflora
gb|EYU24513.1|  hypothetical protein MIMGU_mgv1a008973mg              86.7    3e-17   Erythranthe guttata [common monkey flower]
ref|XP_010492570.1|  PREDICTED: glutamine synthetase cytosolic is...  85.9    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010420355.1|  PREDICTED: glutamine synthetase cytosolic is...  86.3    4e-17   Camelina sativa [gold-of-pleasure]
sp|P23712.2|GLNA_LACSA  RecName: Full=Glutamine synthetase; AltNa...  86.3    4e-17   Lactuca sativa [cultivated lettuce]
ref|XP_010492569.1|  PREDICTED: glutamine synthetase cytosolic is...  85.9    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010420354.1|  PREDICTED: glutamine synthetase cytosolic is...  85.9    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010453820.1|  PREDICTED: glutamine synthetase cytosolic is...  85.9    5e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006288043.1|  hypothetical protein CARUB_v10001277mg           85.9    5e-17   
ref|XP_006360384.1|  PREDICTED: glutamine synthetase nodule isozy...  85.5    9e-17   Solanum tuberosum [potatoes]
ref|XP_004162638.1|  PREDICTED: glutamine synthetase nodule isozy...  85.1    1e-16   
gb|KGN51032.1|  Glutamine synthetase                                  85.1    1e-16   Cucumis sativus [cucumbers]
gb|AHJ10959.1|  cytosolic glutamine synthetase 1 isoform 1            84.7    1e-16   Lemna minor
gb|AHJ10960.1|  cytosolic glutamine synthetase 1 isoform 2            84.7    1e-16   Lemna minor
ref|XP_004140309.1|  PREDICTED: glutamine synthetase nodule isozy...  84.7    1e-16   
ref|XP_009121474.1|  PREDICTED: glutamine synthetase cytosolic is...  84.7    2e-16   Brassica rapa
emb|CDX69442.1|  BnaA10g17910D                                        84.7    2e-16   
ref|XP_004240034.1|  PREDICTED: glutamine synthetase-like             84.3    2e-16   Solanum lycopersicum
ref|XP_002873784.1|  GLN1_4                                           84.3    2e-16   
ref|XP_010435596.1|  PREDICTED: glutamine synthetase cytosolic is...  83.6    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009629012.1|  PREDICTED: glutamine synthetase-like             84.0    3e-16   Nicotiana tomentosiformis
ref|XP_010440874.1|  PREDICTED: glutamine synthetase cytosolic is...  84.0    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010435595.1|  PREDICTED: glutamine synthetase cytosolic is...  84.0    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010419001.1|  PREDICTED: glutamine synthetase cytosolic is...  81.6    3e-16   
ref|XP_002465624.1|  hypothetical protein SORBIDRAFT_01g042450        84.0    3e-16   Sorghum bicolor [broomcorn]
gb|AAW21274.1|  glutamine synthetase                                  83.6    4e-16   Saccharum officinarum [noble cane]
gb|ABK21449.1|  unknown                                               83.6    4e-16   Picea sitchensis
emb|CDY38104.1|  BnaC02g06690D                                        83.6    5e-16   Brassica napus [oilseed rape]
gb|AGC24244.1|  glutamine synthetase 1                                80.9    5e-16   Brassica napus [oilseed rape]
ref|XP_009126124.1|  PREDICTED: glutamine synthetase cytosolic is...  83.6    5e-16   Brassica rapa
gb|AGC24239.1|  glutamine synthetase 1                                83.2    5e-16   Brassica napus [oilseed rape]
ref|XP_009800983.1|  PREDICTED: glutamine synthetase-like             83.2    5e-16   Nicotiana sylvestris
sp|P38563.2|GLNA5_MAIZE  RecName: Full=Glutamine synthetase root ...  83.2    6e-16   Zea mays [maize]
ref|XP_009785976.1|  PREDICTED: glutamine synthetase isoform X1       83.2    6e-16   Nicotiana sylvestris
sp|O04867.1|GLNA1_ALNGL  RecName: Full=Glutamine synthetase; AltN...  83.2    6e-16   Alnus glutinosa
gb|ACN36710.1|  unknown                                               82.0    6e-16   Zea mays [maize]
ref|XP_009785977.1|  PREDICTED: glutamine synthetase isoform X2       83.2    6e-16   Nicotiana sylvestris
gb|AFK46766.1|  unknown                                               81.6    7e-16   Medicago truncatula
tpg|DAA44141.1|  TPA: glutamine synthetase6                           82.8    8e-16   
dbj|BAA04995.1|  glutamine synthetase                                 82.8    8e-16   Raphanus sativus
ref|XP_011001555.1|  PREDICTED: glutamine synthetase cytosolic is...  82.8    8e-16   Populus euphratica
gb|AAR86718.1|  glutamine synthetase GS56                             82.8    8e-16   Nicotiana attenuata
emb|CCO25538.1|  glutamine synthetase                                 82.4    9e-16   Pinus pinaster [cluster pine]
gb|AAW21275.1|  glutamine synthetase                                  82.8    9e-16   Saccharum officinarum [noble cane]
gb|AGT16433.1|  glutamine synthetase                                  82.8    9e-16   Saccharum hybrid cultivar R570
ref|XP_008460506.1|  PREDICTED: glutamine synthetase nodule isozy...  82.4    9e-16   Cucumis melo [Oriental melon]
ref|XP_009385541.1|  PREDICTED: glutamine synthetase nodule isozy...  82.4    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAP33167.1|  cytosolic glutamine synthetase                        82.4    1e-15   Securigera parviflora
ref|XP_010415164.1|  PREDICTED: glutamine synthetase cytosolic is...  81.6    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010470494.1|  PREDICTED: glutamine synthetase cytosolic is...  81.6    1e-15   Camelina sativa [gold-of-pleasure]
gb|ACG47508.1|  glutamine synthetase root isozyme 5                   82.4    1e-15   Zea mays [maize]
ref|XP_009370058.1|  PREDICTED: glutamine synthetase cytosolic is...  82.4    1e-15   Pyrus x bretschneideri [bai li]
gb|KJB10479.1|  hypothetical protein B456_001G203300                  81.6    1e-15   Gossypium raimondii
sp|P08282.2|GLNA1_PEA  RecName: Full=Glutamine synthetase nodule ...  82.4    1e-15   Pisum sativum [garden pea]
emb|CAJ87510.1|  putative glutamine synthetase                        82.4    1e-15   Pisum sativum [garden pea]
ref|XP_009338856.1|  PREDICTED: glutamine synthetase cytosolic is...  82.4    1e-15   
ref|NP_001105443.1|  glutamine synthetase root isozyme 2              82.4    1e-15   
ref|NP_001105297.1|  glutamine synthetase root isozyme 5              82.4    1e-15   
gb|KJB10478.1|  hypothetical protein B456_001G203300                  81.3    1e-15   Gossypium raimondii
gb|AFW90613.1|  glutamine synthetase GS1                              81.3    1e-15   Solanum tuberosum [potatoes]
gb|ACL54769.1|  unknown                                               82.4    1e-15   Zea mays [maize]
gb|AAB61597.1|  glutamine synthetase                                  82.0    1e-15   Hevea brasiliensis [jebe]
sp|P04078.1|GLNA1_MEDSA  RecName: Full=Glutamine synthetase cytos...  82.0    1e-15   Medicago sativa [alfalfa]
emb|CAA71317.1|  glutamine synthetase                                 82.0    1e-15   Medicago truncatula
gb|ACF78695.1|  unknown                                               82.0    1e-15   Zea mays [maize]
gb|KDP25795.1|  hypothetical protein JCGZ_22517                       82.0    1e-15   Jatropha curcas
ref|XP_003600702.1|  Glutamine synthetase                             82.0    1e-15   Medicago truncatula
ref|XP_010511548.1|  PREDICTED: glutamine synthetase cytosolic is...  82.0    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010415162.1|  PREDICTED: glutamine synthetase cytosolic is...  82.0    1e-15   Camelina sativa [gold-of-pleasure]
emb|CAG27625.1|  putative glutamine synthetase                        77.8    1e-15   Populus x canadensis [Canadian poplar]
ref|XP_004288594.1|  PREDICTED: glutamine synthetase nodule isozyme   82.0    1e-15   Fragaria vesca subsp. vesca
ref|NP_568335.1|  glutamine synthetase 1;4                            82.0    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470493.1|  PREDICTED: glutamine synthetase cytosolic is...  82.0    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_003544980.1|  PREDICTED: glutamine synthetase cytosolic is...  82.0    1e-15   
ref|XP_004981993.1|  PREDICTED: glutamine synthetase cytosolic is...  82.0    1e-15   Setaria italica
ref|XP_006300523.1|  hypothetical protein CARUB_v10020543mg           82.0    1e-15   Capsella rubella
gb|ABW89464.1|  glutamine synthetase                                  82.0    1e-15   Gossypium hirsutum [American cotton]
sp|P04770.1|GLNA1_PHAVU  RecName: Full=Glutamine synthetase PR-1;...  82.0    1e-15   Phaseolus vulgaris [French bean]
gb|ABW89460.1|  glutamine synthetase                                  82.0    1e-15   Gossypium herbaceum [Arabian cotton]
ref|XP_006400196.1|  hypothetical protein EUTSA_v10013948mg           82.0    2e-15   Eutrema salsugineum [saltwater cress]
ref|XP_010551131.1|  PREDICTED: glutamine synthetase nodule isozy...  82.0    2e-15   Tarenaya hassleriana [spider flower]
gb|ABW89463.1|  glutamine synthetase                                  82.0    2e-15   Gossypium raimondii
tpg|DAA44139.1|  TPA: glutamine synthetase6                           82.0    2e-15   
gb|KHG00636.1|  Glutamine synthetase cytosolic isozyme 1              82.0    2e-15   Gossypium arboreum [tree cotton]
ref|NP_001105538.1|  glutamine synthetase root isozyme 1              82.0    2e-15   Zea mays [maize]
sp|P14636.1|GLNA3_LUPAN  RecName: Full=Glutamine synthetase nodul...  81.3    2e-15   Lupinus angustifolius
gb|ABW89461.1|  glutamine synthetase                                  82.0    2e-15   Gossypium hirsutum [American cotton]
emb|CAA65173.1|  glutamine synthetase                                 82.0    2e-15   Nicotiana tabacum [American tobacco]
gb|ABW89462.1|  glutamine synthetase                                  81.6    2e-15   Gossypium hirsutum [American cotton]
ref|XP_010940335.1|  PREDICTED: glutamine synthetase nodule isozy...  81.6    2e-15   Elaeis guineensis
ref|XP_009614064.1|  PREDICTED: glutamine synthetase cytosolic is...  81.6    2e-15   Nicotiana tomentosiformis
gb|AGI78873.1|  glutamine synthetase                                  81.6    2e-15   Vigna unguiculata
gb|AGG19203.1|  glutamine synthetase                                  81.6    2e-15   Vigna unguiculata
gb|AAT46062.1|  glutamine synthetase GS2                              79.3    2e-15   Apium graveolens Dulce Group [celery]
sp|P52782.1|GLNA_LUPLU  RecName: Full=Glutamine synthetase nodule...  81.6    2e-15   Lupinus luteus
ref|XP_007032111.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...  81.6    2e-15   
ref|XP_006284008.1|  hypothetical protein CARUB_v10005130mg           81.6    2e-15   Capsella rubella
dbj|BAA04996.1|  glutamine synthetase                                 81.3    2e-15   Raphanus sativus
ref|XP_009370554.1|  PREDICTED: glutamine synthetase cytosolic is...  81.3    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_007215605.1|  hypothetical protein PRUPE_ppa007772mg           81.3    3e-15   Prunus persica
ref|XP_009772493.1|  PREDICTED: glutamine synthetase cytosolic is...  81.3    3e-15   Nicotiana sylvestris
emb|CAA65174.1|  glutamine synthetase                                 81.3    3e-15   Nicotiana tabacum [American tobacco]
ref|XP_006647853.1|  PREDICTED: glutamine synthetase cytosolic is...  81.3    3e-15   
ref|XP_008353857.1|  PREDICTED: glutamine synthetase cytosolic is...  81.3    3e-15   
gb|AAG40238.2|AF302115_1  glutamine synthetase GS1                    81.3    3e-15   Solanum tuberosum [potatoes]
gb|AFN42876.1|  glutamine synthetase                                  81.3    3e-15   Camellia sinensis [black tea]
ref|XP_004503122.1|  PREDICTED: glutamine synthetase nodule isozy...  81.3    3e-15   Cicer arietinum [garbanzo]
gb|AGI78872.1|  glutamine synthetase                                  81.3    3e-15   Vigna unguiculata
sp|Q42899.2|GLNA1_LOTJA  RecName: Full=Glutamine synthetase cytos...  81.3    3e-15   Lotus japonicus
emb|CAA63963.1|  glutamate synthetase                                 81.3    3e-15   Lotus japonicus
emb|CDY01727.1|  BnaC04g30250D                                        80.9    3e-15   
ref|NP_001267644.1|  glutamine synthetase cytosolic isozyme-like      81.3    3e-15   Cucumis sativus [cucumbers]
ref|XP_009414782.1|  PREDICTED: glutamine synthetase cytosolic is...  80.9    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006298020.1|  hypothetical protein CARUB_v10014064mg           80.9    3e-15   Capsella rubella
gb|EYU30859.1|  hypothetical protein MIMGU_mgv1a008986mg              80.9    3e-15   Erythranthe guttata [common monkey flower]
emb|CAA58118.1|  glutamate--ammonia ligase                            80.9    3e-15   Brassica napus [oilseed rape]
ref|XP_004135959.1|  PREDICTED: glutamine synthetase nodule isozy...  80.9    4e-15   Cucumis sativus [cucumbers]
ref|XP_002888488.1|  ATGSR2                                           80.9    4e-15   
ref|XP_006590378.1|  PREDICTED: glutamine synthetase cytosolic is...  80.1    4e-15   Glycine max [soybeans]
gb|AAG24873.1|AF301590_1  cytosolic glutamine synthetase GSbeta1      80.9    4e-15   Glycine max [soybeans]
gb|AAD28469.1|AF130882_1  glutamine synthetase                        79.3    4e-15   Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_010525077.1|  PREDICTED: glutamine synthetase nodule isozyme   80.9    4e-15   Tarenaya hassleriana [spider flower]
ref|XP_007141923.1|  hypothetical protein PHAVU_008G237400g           80.9    4e-15   Phaseolus vulgaris [French bean]
ref|XP_006590377.1|  PREDICTED: glutamine synthetase cytosolic is...  80.9    4e-15   
ref|XP_011085871.1|  PREDICTED: glutamine synthetase cytosolic is...  80.9    4e-15   Sesamum indicum [beniseed]
ref|NP_001238531.1|  glutamine synthetase cytosolic isozyme 1         80.9    4e-15   
gb|AGV54248.1|  glutamine synthetase                                  80.9    4e-15   Phaseolus vulgaris [French bean]
ref|NP_188409.1|  glutamine synthetase cytosolic isozyme 1-3          80.5    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAO42253.1|  putative glutamine synthetase                         80.5    5e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CAN68162.1|  hypothetical protein VITISV_015673                   80.5    5e-15   Vitis vinifera
gb|AGC24238.1|  glutamine synthetase 1                                80.5    5e-15   Brassica napus [oilseed rape]
sp|P38561.1|GLNA3_MAIZE  RecName: Full=Glutamine synthetase root ...  80.5    5e-15   Zea mays [maize]
ref|XP_006391364.1|  hypothetical protein EUTSA_v10018774mg           80.5    5e-15   Eutrema salsugineum [saltwater cress]
ref|XP_009139734.1|  PREDICTED: glutamine synthetase cytosolic is...  80.5    5e-15   
gb|AAK49029.1|  cytosolic glutamine synthetase                        80.5    5e-15   
ref|NP_001051067.1|  Os03g0712800                                     80.9    5e-15   
gb|EEC76061.1|  hypothetical protein OsI_13264                        80.9    5e-15   
ref|XP_010500377.1|  PREDICTED: glutamine synthetase cytosolic is...  80.5    5e-15   
ref|XP_002870545.1|  ATGSR1                                           80.5    5e-15   
ref|XP_004953842.1|  PREDICTED: glutamine synthetase cytosolic is...  80.5    5e-15   
ref|XP_009631593.1|  PREDICTED: glutamine synthetase isoform X2       79.7    5e-15   
gb|EEC73954.1|  hypothetical protein OsI_08842                        80.5    5e-15   
gb|AJD14835.1|  glutamine synthetase                                  80.5    5e-15   
ref|XP_009360053.1|  PREDICTED: glutamine synthetase nodule isozy...  80.5    5e-15   
ref|XP_004236686.1|  PREDICTED: glutamine synthetase cytosolic is...  80.5    6e-15   
ref|XP_002527139.1|  glutamine synthetase plant, putative             80.5    6e-15   
gb|KFK39112.1|  hypothetical protein AALP_AA3G202500                  80.5    6e-15   
gb|ACA50923.1|  glutamine synthetase                                  80.5    6e-15   
sp|P12424.1|GLNA_NICPL  RecName: Full=Glutamine synthetase; AltNa...  80.5    6e-15   
ref|XP_006346760.1|  PREDICTED: glutamine synthetase cytosolic is...  80.5    6e-15   
ref|NP_001048045.1|  Os02g0735200                                     80.5    6e-15   
ref|XP_010528561.1|  PREDICTED: glutamine synthetase nodule isozy...  80.5    6e-15   
ref|NP_198576.1|  glutamine synthetase 1;1                            80.5    6e-15   
ref|NP_001105296.1|  glutamine synthetase root isozyme 3              80.1    6e-15   
gb|KCW69393.1|  hypothetical protein EUGRSUZ_F02872                   79.3    6e-15   
ref|XP_008803403.1|  PREDICTED: glutamine synthetase nodule isozy...  80.1    6e-15   
ref|XP_007141924.1|  hypothetical protein PHAVU_008G237500g           80.1    6e-15   
ref|XP_009631592.1|  PREDICTED: glutamine synthetase isoform X1       80.1    7e-15   
gb|AAG40237.2|  glutamine synthetase GS1                              80.1    7e-15   
gb|KHN41059.1|  Glutamine synthetase N-1                              79.3    7e-15   
ref|XP_010909363.1|  PREDICTED: glutamine synthetase nodule isozyme   80.1    7e-15   
ref|NP_001031240.1|  glutamine synthetase                             79.3    7e-15   
dbj|BAH56851.1|  AT1G66200                                            79.3    7e-15   
emb|CAA73366.1|  glutamine synthetase                                 80.1    7e-15   
ref|XP_007043312.1|  Glutamine synthetase 1,4                         80.1    7e-15   
ref|XP_009408415.1|  PREDICTED: glutamine synthetase nodule isozy...  80.1    7e-15   
gb|KJB43163.1|  hypothetical protein B456_007G187300                  80.1    7e-15   
emb|CAA54151.1|  glutamine                                            80.1    7e-15   
ref|XP_004490827.1|  PREDICTED: glutamine synthetase nodule isozy...  80.1    7e-15   
gb|ACD13217.1|  glutamine synthetase                                  80.1    8e-15   
emb|CDO98315.1|  unnamed protein product                              80.1    8e-15   
ref|XP_010450519.1|  PREDICTED: glutamine synthetase cytosolic is...  79.3    8e-15   
gb|ABU45501.1|  cytosolic glutamine synthetase                        80.1    8e-15   
emb|CAA73063.1|  cytosolic glutamine synthetase                       80.1    8e-15   
gb|ACF42116.1|  cytosolic glutamine synthetase                        80.1    8e-15   
ref|XP_004250194.1|  PREDICTED: glutamine synthetase                  80.1    8e-15   
emb|CBI33470.3|  unnamed protein product                              80.1    8e-15   
ref|NP_001268054.1|  glutamine synthetase cytosolic isozyme 2         80.1    8e-15   
ref|XP_002883089.1|  ATGSKB6                                          80.1    8e-15   
ref|XP_004299511.1|  PREDICTED: glutamine synthetase cytosolic is...  79.7    9e-15   
gb|AAW21273.1|  glutamine synthetase                                  79.7    9e-15   
ref|XP_007163376.1|  hypothetical protein PHAVU_001G229500g           79.7    9e-15   
ref|XP_007222176.1|  hypothetical protein PRUPE_ppa007771mg           79.7    9e-15   
dbj|BAA04994.1|  glutamine synthetase                                 79.7    9e-15   
ref|XP_010505938.1|  PREDICTED: glutamine synthetase cytosolic is...  79.7    9e-15   
ref|XP_010103463.1|  Glutamine synthetase nodule isozyme              79.7    9e-15   
ref|XP_010549036.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...  80.1    9e-15   
ref|XP_010465841.1|  PREDICTED: glutamine synthetase cytosolic is...  79.7    9e-15   
emb|CAA52448.1|  glutamate--ammonia ligase                            79.7    9e-15   
ref|XP_006352444.1|  PREDICTED: glutamine synthetase-like             79.7    1e-14   
ref|XP_008812466.1|  PREDICTED: glutamine synthetase nodule isozyme   79.7    1e-14   
ref|XP_002305885.1|  glutamate-ammonia ligase family protein          79.7    1e-14   
sp|P32289.1|GLNA_VIGAC  RecName: Full=Glutamine synthetase nodule...  79.7    1e-14   
ref|XP_010553887.1|  PREDICTED: glutamine synthetase nodule isozyme   79.7    1e-14   
ref|XP_006406687.1|  hypothetical protein EUTSA_v10021026mg           79.7    1e-14   
gb|AGC24234.1|  glutamine synthetase 1                                79.7    1e-14   
gb|ACU15915.1|  unknown                                               78.6    1e-14   
ref|XP_009145973.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...  79.7    1e-14   
ref|XP_006576095.1|  PREDICTED: glutamine synthetase nodule isozy...  79.0    1e-14   
gb|AID48673.1|  theanine synthetase                                   79.7    1e-14   
sp|P52783.1|GLNA_PINSY  RecName: Full=Glutamine synthetase cytoso...  79.7    1e-14   
ref|XP_003616263.1|  Glutamine synthetase                             79.7    1e-14   
ref|NP_176794.1|  glutamine synthetase                                79.7    1e-14   
gb|AAM63710.1|  glutamine synthetase, putative                        79.3    1e-14   
ref|XP_011002191.1|  PREDICTED: glutamine synthetase cytosolic is...  79.3    1e-14   
ref|XP_010271383.1|  PREDICTED: glutamine synthetase cytosolic is...  79.3    1e-14   
ref|NP_001284433.1|  glutamine synthetase cytosolic isozyme           79.3    1e-14   
ref|XP_010271347.1|  PREDICTED: glutamine synthetase cytosolic is...  79.3    1e-14   
ref|XP_006306121.1|  hypothetical protein CARUB_v10011565mg           79.3    1e-14   
dbj|BAE98486.1|  glutamine synthetase like protein                    79.3    1e-14   
sp|P38559.1|GLNA1_MAIZE  RecName: Full=Glutamine synthetase root ...  79.3    1e-14   
gb|KFK33302.1|  hypothetical protein AALP_AA6G357500                  79.3    1e-14   
gb|KDP24824.1|  hypothetical protein JCGZ_25308                       79.3    1e-14   
gb|AEH16645.1|  glutamine synthetase                                  79.3    1e-14   
ref|XP_010450518.1|  PREDICTED: glutamine synthetase cytosolic is...  79.3    1e-14   
ref|XP_006651743.1|  PREDICTED: glutamine synthetase cytosolic is...  79.3    1e-14   
ref|NP_001185327.1|  glutamine synthetase                             79.3    1e-14   
ref|XP_010062276.1|  PREDICTED: glutamine synthetase nodule isozy...  79.3    1e-14   
gb|KFK41041.1|  hypothetical protein AALP_AA2G077900                  79.3    1e-14   
gb|AGW24652.1|  cytosolic glutamine synthetase                        79.3    1e-14   
ref|XP_006405853.1|  hypothetical protein EUTSA_v10027817mg           79.3    1e-14   
emb|CAA57216.1|  glutamate--ammonia ligase                            79.3    1e-14   
ref|XP_008461372.1|  PREDICTED: glutamine synthetase nodule isozy...  79.3    1e-14   
gb|ACF74298.1|  glutamine synthetase GS56                             77.0    2e-14   
gb|AFW63835.1|  glutamine synthetase5                                 78.6    2e-14   
gb|AAR29057.1|  glutamine synthetase 1                                79.0    2e-14   
gb|AGW24651.1|  cytosolic glutamine synthetase                        79.3    2e-14   
dbj|BAD99525.1|  glutamine synthetase                                 79.0    2e-14   
gb|AAD52008.1|  cytosolic glutamine synthetase                        79.0    2e-14   
ref|XP_008358170.1|  PREDICTED: glutamine synthetase cytosolic is...  79.0    2e-14   
gb|EMS45858.1|  Glutamine synthetase cytosolic isozyme 1-3            79.0    2e-14   
gb|AIK03054.1|  glutamine synthetase                                  79.0    2e-14   
ref|XP_011022058.1|  PREDICTED: glutamine synthetase cytosolic is...  79.0    2e-14   
emb|CAA73064.1|  cytosolic glutamine synthetase                       79.0    2e-14   
gb|KHN07539.1|  Glutamine synthetase nodule isozyme                   79.0    2e-14   
gb|EMS46544.1|  Glutamine synthetase cytosolic isozyme 1-2            79.3    2e-14   
ref|XP_008365754.1|  PREDICTED: glutamine synthetase cytosolic is...  79.0    2e-14   
ref|XP_008221045.1|  PREDICTED: glutamine synthetase nodule isozy...  79.0    2e-14   
ref|NP_001242332.1|  cytosolic glutamine synthetase beta2             79.0    2e-14   
gb|ACR38147.1|  unknown                                               78.6    2e-14   
ref|NP_001105444.1|  glutamine synthetase root isozyme 4              78.6    2e-14   
gb|ABX79672.1|  glutamine synthetase                                  78.6    2e-14   
pdb|2D3A|A  Chain A, Crystal Structure Of The Maize Glutamine Syn...  78.6    2e-14   
dbj|BAD99526.1|  glutamine synthetase                                 78.6    2e-14   
ref|XP_010935533.1|  PREDICTED: glutamine synthetase nodule isozy...  78.6    2e-14   
gb|ACB06727.1|  glutamine synthetase                                  78.6    2e-14   
ref|XP_004297747.1|  PREDICTED: glutamine synthetase nodule isozy...  78.6    2e-14   
ref|NP_001241743.1|  glutamine synthetase root isozyme 3              78.6    2e-14   
ref|XP_008340445.1|  PREDICTED: glutamine synthetase PR-2             78.6    3e-14   
dbj|BAD11327.1|  glutamine synthetase                                 78.6    3e-14   
ref|XP_009351711.1|  PREDICTED: glutamine synthetase nodule isozy...  78.6    3e-14   
ref|XP_006372556.1|  glutamate-ammonia ligase family protein          78.6    3e-14   
pdb|4IS4|A  Chain A, The Glutamine Synthetase From The Dicotyledo...  78.6    3e-14   
ref|XP_009127475.1|  PREDICTED: glutamine synthetase cytosolic is...  77.4    3e-14   
emb|CDX75942.1|  BnaC03g40250D                                        78.6    3e-14   
ref|XP_003558466.1|  PREDICTED: glutamine synthetase cytosolic is...  78.2    3e-14   
gb|AAR84348.1|  glutamine synthetase isoform GSr2                     78.2    3e-14   
emb|CDX82343.1|  BnaA03g34780D                                        78.2    3e-14   
gb|EMT23121.1|  Glutamine synthetase cytosolic isozyme 1-2            78.6    3e-14   
gb|AAR84347.1|  glutamine synthetase isoform GSr1                     78.2    3e-14   
emb|CDY68590.1|  BnaAnng27730D                                        78.2    3e-14   
gb|AFK48742.1|  unknown                                               78.2    3e-14   
gb|ABK93921.1|  unknown                                               77.0    4e-14   
ref|XP_009135551.1|  PREDICTED: glutamine synthetase cytosolic is...  78.2    4e-14   
emb|CAA06383.1|  glutamine synthetase                                 78.2    4e-14   
ref|XP_009113719.1|  PREDICTED: glutamine synthetase cytosolic is...  78.2    4e-14   
gb|ABK51388.1|  cytosolic glutamine synthetase                        78.2    4e-14   
gb|AAB03492.1|  cytosolic glutamine synthetase                        77.8    4e-14   
ref|XP_009391413.1|  PREDICTED: glutamine synthetase nodule isozy...  78.2    4e-14   
ref|XP_007152660.1|  hypothetical protein PHAVU_004G148300g           78.2    4e-14   
gb|KHG00904.1|  Glutamine synthetase nodule isozyme                   77.8    4e-14   
gb|AGZ15411.1|  glutamine synthetase PR-2                             78.2    4e-14   
sp|Q43066.1|GLNA4_PEA  RecName: Full=Glutamine synthetase root is...  78.2    4e-14   
ref|XP_006387591.1|  hypothetical protein POPTR_0799s00200g           77.8    4e-14   
sp|P07694.1|GLNA3_PEA  RecName: Full=Glutamine synthetase root is...  77.8    5e-14   
gb|EYU45782.1|  hypothetical protein MIMGU_mgv1a009017mg              77.8    5e-14   
ref|XP_009127474.1|  PREDICTED: glutamine synthetase cytosolic is...  77.8    5e-14   
ref|XP_003528974.1|  PREDICTED: glutamine synthetase PR-2             77.8    5e-14   
ref|XP_001782920.1|  predicted protein                                77.8    5e-14   
gb|ACU19484.1|  unknown                                               77.8    5e-14   
ref|XP_004985157.1|  PREDICTED: glutamine synthetase root isozyme...  77.8    5e-14   
ref|XP_003519325.1|  PREDICTED: glutamine synthetase cytosolic is...  77.8    5e-14   
gb|AGV07415.1|  glutamine synthetase                                  77.8    6e-14   
emb|CDP01645.1|  unnamed protein product                              77.8    6e-14   
ref|XP_002318305.1|  glutamine synthetase family protein              77.8    6e-14   
ref|XP_006828438.1|  hypothetical protein AMTR_s00060p00109730        77.4    6e-14   
gb|AAP33169.1|  cytosolic glutamine synthetase                        77.4    6e-14   
gb|AFB69880.1|  glutamine synthetase isoform 1r                       77.4    6e-14   
ref|NP_001268175.1|  glutamine synthetase cytosolic isozyme 1         77.4    6e-14   
gb|ABK95973.1|  unknown                                               77.4    7e-14   
ref|XP_003619869.1|  Glutamine synthetase                             77.4    7e-14   
ref|XP_002972155.1|  hypothetical protein SELMODRAFT_270944           77.8    7e-14   
ref|XP_009393673.1|  PREDICTED: glutamine synthetase nodule isozyme   77.4    7e-14   
gb|AFP20991.1|  glutamine synthetase isozyme                          77.4    7e-14   
ref|XP_011007210.1|  PREDICTED: glutamine synthetase cytosolic is...  77.4    7e-14   
ref|XP_004512771.1|  PREDICTED: glutamine synthetase nodule isozy...  77.4    7e-14   
ref|XP_002310666.1|  glutamine synthetase family protein              77.4    8e-14   
ref|NP_001239821.1|  cytosolic glutamine synthetase alpha             77.0    8e-14   
emb|CAA57346.1|  glutamate--ammonia ligase                            77.0    9e-14   
ref|XP_002306385.1|  glutamine synthetase family protein              77.0    1e-13   
gb|ACN40288.1|  unknown                                               76.6    1e-13   
gb|ABK23723.1|  unknown                                               76.6    1e-13   
ref|XP_008789283.1|  PREDICTED: glutamine synthetase nodule isozy...  76.6    1e-13   
emb|CAL07995.1|  cytosolic glutamine synthetase                       75.5    1e-13   
ref|XP_010066985.1|  PREDICTED: glutamine synthetase cytosolic is...  76.3    1e-13   
sp|Q43785.1|GLNA3_MEDSA  RecName: Full=Glutamine synthetase nodul...  76.6    1e-13   
gb|ACR45960.1|  glutamine synthetase 1b                               76.3    2e-13   
pir||S18603  glutamate-ammonia ligase (EC 6.3.1.2), cytosolic (cl...  76.6    2e-13
ref|XP_010066984.1|  PREDICTED: glutamine synthetase cytosolic is...  76.3    2e-13   
gb|EPS73857.1|  glutamine synthetase                                  72.4    2e-13   
gb|AAN05339.1|  Putative GLN1_ORYSA GLUTAMINE SYNTHETASE ROOT ISO...  76.3    2e-13   
ref|XP_011035558.1|  PREDICTED: glutamine synthetase cytosolic is...  76.3    2e-13   
ref|XP_007036934.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...  74.7    2e-13   
ref|XP_006649656.1|  PREDICTED: glutamine synthetase cytosolic is...  75.9    2e-13   
ref|XP_010652433.1|  PREDICTED: glutamine synthetase isoform X1       75.9    2e-13   
ref|XP_006374208.1|  glutamine synthetase family protein              75.9    2e-13   
ref|NP_001049424.1|  Os03g0223400                                     75.9    2e-13   
ref|NP_001268104.1|  glutamine synthetase                             75.9    2e-13   
gb|AFX60876.1|  glutamine synthetase isoform GS1_2                    75.9    3e-13   
gb|ABK94916.1|  unknown                                               75.9    3e-13   
ref|XP_006844043.1|  hypothetical protein AMTR_s00006p00241880        75.5    3e-13   
ref|XP_011003750.1|  PREDICTED: glutamine synthetase nodule isozyme   75.5    3e-13   
ref|XP_010932552.1|  PREDICTED: glutamine synthetase nodule isozyme   75.5    4e-13   
ref|XP_007209293.1|  hypothetical protein PRUPE_ppa007728mg           75.5    4e-13   
ref|XP_001782914.1|  predicted protein                                75.5    4e-13   
ref|XP_002977477.1|  hypothetical protein SELMODRAFT_151817           75.5    4e-13   
gb|ACR38893.1|  glutamine synthetase                                  75.1    4e-13   
gb|AAD31899.1|AF145481_1  cytosolic glutamine synthetase              75.1    5e-13   
ref|XP_007036933.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...  75.1    5e-13   
ref|XP_011073176.1|  PREDICTED: glutamine synthetase nodule isozy...  75.1    7e-13   
gb|KDO50821.1|  hypothetical protein CISIN_1g018434mg                 73.2    7e-13   
gb|AAK08103.1|AF338444_1  glutamine synthetase                        74.3    9e-13   
ref|XP_010236151.1|  PREDICTED: glutamine synthetase cytosolic is...  74.3    9e-13   
gb|KDO50820.1|  hypothetical protein CISIN_1g018434mg                 73.2    1e-12   
dbj|BAM84282.1|  glutamine synthetase                                 73.6    2e-12   
gb|KDO50819.1|  hypothetical protein CISIN_1g018434mg                 73.2    2e-12   
sp|Q06378.1|GLNA3_HORVU  RecName: Full=Glutamine synthetase; AltN...  73.6    2e-12   
ref|XP_006828441.1|  hypothetical protein AMTR_s00060p00116070        73.6    2e-12   
pir||S30569  glutamate-ammonia ligase (EC 6.3.1.2), cytosolic - b...  73.6    2e-12
gb|KJB77351.1|  hypothetical protein B456_012G133400                  72.0    2e-12   
gb|KDP43303.1|  hypothetical protein JCGZ_24224                       73.2    2e-12   
ref|XP_006482120.1|  PREDICTED: glutamine synthetase nodule isozy...  73.2    2e-12   
ref|XP_008350820.1|  PREDICTED: glutamine synthetase nodule isozy...  73.2    2e-12   
ref|XP_010926111.1|  PREDICTED: glutamine synthetase cytosolic is...  73.2    2e-12   
ref|XP_006430603.1|  hypothetical protein CICLE_v10011785mg           73.9    2e-12   
ref|XP_008240120.1|  PREDICTED: glutamine synthetase nodule isozyme   73.2    3e-12   
gb|AJD14834.1|  glutamine synthetase                                  73.2    3e-12   
gb|AFB69879.1|  glutamine synthetase isoform 1-1                      73.2    3e-12   
ref|XP_008775534.1|  PREDICTED: glutamine synthetase nodule isozy...  72.8    3e-12   
gb|ACR45959.1|  glutamine synthetase 1a                               72.8    3e-12   
gb|AAQ16554.1|  glufosinate-resistant glutamine synthetase            71.2    3e-12   
ref|XP_009401139.1|  PREDICTED: glutamine synthetase nodule isozy...  72.8    3e-12   
gb|KCW52168.1|  hypothetical protein EUGRSUZ_J01606                   72.4    4e-12   
gb|KCW48621.1|  hypothetical protein EUGRSUZ_K02283                   71.2    4e-12   



>gb|ACF17656.1| putative glutamine synthase 2 [Capsicum annuum]
Length=432

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPSAQWQMRMTK+ T+A+P+ SKMW SVV+K NK++AVKS+AKFRVFALQS N+T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDASPLTSKMWSSVVLKQNKKLAVKSSAKFRVFALQSDNAT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+EQLLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPVQH SELPKWNYDG
Sbjct  61   VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVQHASELPKWNYDG  117



>ref|XP_009629915.1| PREDICTED: glutamine synthetase, chloroplastic [Nicotiana tomentosiformis]
 gb|AAR86719.1| glutamine synthetase GS58 [Nicotiana attenuata]
Length=432

 Score =   206 bits (524),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPSAQWQMRMTK+ T+A P+ SKMW SVV+K NKR+AVKS+AKFRVFALQS + T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDANPLTSKMWSSVVLKQNKRLAVKSSAKFRVFALQSDSGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+EQLLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDG
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDG  117



>ref|XP_009773609.1| PREDICTED: glutamine synthetase, chloroplastic [Nicotiana sylvestris]
Length=432

 Score =   206 bits (524),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPSAQWQMRMTK+ T+A P+ SKMW SVV+K NKR+AVKS+AKFRVFALQS + T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDANPLTSKMWSSVVLKQNKRLAVKSSAKFRVFALQSDSGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+EQLLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDG
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDG  117



>ref|NP_001275177.1| glutamine synthetase, chloroplastic-like [Solanum tuberosum]
 gb|AAG40236.2| plastid glutamine synthetase GS2 [Solanum tuberosum]
Length=432

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPSAQWQMRMTK+ T+A+P+ SKMW SVV+K NKR+AVKS+AKFRVFALQS N T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDASPLTSKMWSSVVLKQNKRLAVKSSAKFRVFALQSDNGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+EQLLNLDVTPYT+KIIAEYIWIGG+GID RSKSRTISKPV+  SELPKWNYDG
Sbjct  61   VNRMEQLLNLDVTPYTDKIIAEYIWIGGTGIDVRSKSRTISKPVKDASELPKWNYDG  117



>ref|XP_004229461.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum]
 ref|XP_010322793.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum]
Length=432

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPSAQWQMRMTK+ T+A+P+ SKMW SVV+K NKR A+KS+AKFRVFALQS N T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDASPLTSKMWSSVVLKQNKRHALKSSAKFRVFALQSDNGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+EQLLNLDVTPYT+KIIAEYIWIGG+GID RSKSRTISKPV+  SELPKWNYDG
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGTGIDMRSKSRTISKPVKDASELPKWNYDG  117



>ref|XP_010105702.1| Glutamine synthetase leaf isozyme [Morus notabilis]
 gb|EXC05733.1| Glutamine synthetase leaf isozyme [Morus notabilis]
Length=433

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPN-KRVAVKSTAKFRVFALQSGNS  307
            MAQILAPS QWQMR+TK  T+A+PM SKMWGS+VMK N K+ A+KS+ KFRVFAL+S N 
Sbjct  1    MAQILAPSTQWQMRITKASTDASPMTSKMWGSLVMKQNNKKGAMKSSTKFRVFALKSDNG  60

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            T+NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSK+RTISKPV+HPSELPKWN+DG
Sbjct  61   TINRLEDLLNLDVTPYTDKIIAEYIWIGGSGIDVRSKARTISKPVEHPSELPKWNFDG  118



>emb|CDO98975.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR+TKNL + +P+ SKMW S+V+K +K+ A+K+++KF+V+ALQS N T
Sbjct  1    MAQILAPSPQWQMRVTKNLMDVSPLTSKMWSSLVLKQSKKGAIKTSSKFKVYALQSENGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+EQLLNLDVTPYT+KIIAEYIWIGGSG D RSKS+TISKPV+HPSELPKWNYDG
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGSGTDVRSKSKTISKPVEHPSELPKWNYDG  117



>ref|XP_011090823.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090824.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090825.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090827.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
Length=432

 Score =   192 bits (489),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MA ILAPSAQWQMR+ KN T+A+P+ SKMW S+V+K NK+ AVK++AKFRV A+QS N T
Sbjct  1    MAHILAPSAQWQMRIAKNSTDASPLTSKMWSSLVLKQNKKGAVKTSAKFRVLAVQSENGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+EQ+LNLDV+P T+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   INRMEQMLNLDVSPITDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDG  117



>gb|EYU45601.1| hypothetical protein MIMGU_mgv1a007136mg [Erythranthe guttata]
Length=418

 Score =   192 bits (488),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPSAQWQMR+ KN T+A+ + SKMW S+VMK NK+ +V+++AKFRVFA++S + T
Sbjct  1    MAQILAPSAQWQMRIGKNSTDASALNSKMWSSLVMKQNKKGSVRTSAKFRVFAVKSEDGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+EQLLNLDVTPYT+KIIAEYIWIGG+GID RSKSRT+SKPV+HPSELPKWNYDG
Sbjct  61   INRMEQLLNLDVTPYTDKIIAEYIWIGGTGIDVRSKSRTLSKPVEHPSELPKWNYDG  117



>ref|XP_011006593.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Populus 
euphratica]
Length=432

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS+QWQMR+ KN   A PM +KMW S+V+K NK+   KS+AKFRVFAL+S NST
Sbjct  1    MAQILAPSSQWQMRIAKNSAPACPMTAKMWSSLVLKQNKKGIAKSSAKFRVFALKSENST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TPYT+K IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDG
Sbjct  61   INRMEDLLNLDLTPYTDKFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDG  117



>ref|XP_002314425.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|EEF00596.1| glutamine synthetase family protein [Populus trichocarpa]
Length=432

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS+QWQMR+ KN   A PM +KMW S+V+K NK+   KS+AKFRVFAL+S NST
Sbjct  1    MAQILAPSSQWQMRIAKNSAPACPMTAKMWSSLVLKQNKKGIAKSSAKFRVFALKSENST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TPYT+K IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDG
Sbjct  61   INRMEDLLNLDLTPYTDKFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDG  117



>ref|XP_006380048.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
 gb|ERP57845.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
Length=306

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS+QWQMR+ KN   A+PM +KMW S+V+K NK+   KS+AKFRVFA++S N T
Sbjct  1    MAQILAPSSQWQMRIAKNSAPASPMTAKMWSSLVLKQNKKGTAKSSAKFRVFAVKSENGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TPYTN  IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDG
Sbjct  61   INRMEDLLNLDLTPYTNNFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDG  117



>ref|XP_007034566.1| Glutamine synthetase 2 [Theobroma cacao]
 gb|EOY05492.1| Glutamine synthetase 2 [Theobroma cacao]
Length=549

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  128  KMAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  307
            KMAQILAPS QWQMR+ K  T  +P+A+KMW S+V+K NK+ A KS  KFRVFALQS NS
Sbjct  117  KMAQILAPSTQWQMRLPKTSTYGSPIATKMWNSLVLKQNKQGAAKSCGKFRVFALQSENS  176

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            TVNR+E+LLN+D+TPYT+KIIAEYIWIGGSGID RSKS+TI+KPV+HPSELPKWNYDG
Sbjct  177  TVNRLEKLLNMDITPYTDKIIAEYIWIGGSGIDLRSKSKTIAKPVEHPSELPKWNYDG  234



>emb|CAA47373.2| glutamate--ammonia ligase [Nicotiana sylvestris]
Length=432

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS +WQMRMTK+ T+A P+ SKMW SVV+K  K +AVKS+AKFR FAL+S + T
Sbjct  1    MAQILAPSGEWQMRMTKSSTDANPLTSKMWSSVVLKIIKELAVKSSAKFRFFALESDSGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VN+ EQLLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDG
Sbjct  61   VNQSEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDG  117



>dbj|BAF62340.1| glutamine synthetase [Avicennia marina]
Length=432

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPSAQWQMR+ KN  +A+P+++K W S+++K NK+ AVKS  KFRV A++S NST
Sbjct  1    MAQILAPSAQWQMRIAKNSIDASPLSTKTWSSLILKQNKKEAVKSPGKFRVLAVKSENST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+EQ+LNLDVTPYT+KIIAEYIWIGGSGID RSKSRTI KPV+HPSELPKWNYDG
Sbjct  61   VNRLEQMLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTIPKPVEHPSELPKWNYDG  117



>ref|XP_011071523.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Sesamum indicum]
Length=429

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 106/117 (91%), Gaps = 3/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPSAQWQM ++K LT+ATP+ +KMWGS+ +K   + +VKS+AKF VFA++S NST
Sbjct  1    MAQILAPSAQWQMGISKGLTDATPLTTKMWGSLALK---QGSVKSSAKFGVFAVKSDNST  57

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+EQ+LNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  58   INRLEQMLNLDVTPYTDKIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDG  114



>pir||S22527 glutamate-ammonia ligase (EC 6.3.1.2) - tobacco
Length=432

 Score =   189 bits (481),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS +WQMRMTK+ T+A P+ SKMW SVV+K  K +AVKS+AKFRVFAL+S + T
Sbjct  1    MAQILAPSGEWQMRMTKSSTDANPLTSKMWSSVVIKIIKELAVKSSAKFRVFALESDSGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VN+ EQLLNLDVTPYT+ IIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDG
Sbjct  61   VNQSEQLLNLDVTPYTDLIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDG  117



>ref|XP_002312733.1| glutamine synthetase family protein [Populus trichocarpa]
 ref|XP_006380049.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
 gb|ABK94955.1| unknown [Populus trichocarpa]
 gb|EEE90100.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|ERP57846.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
Length=432

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS+QWQMR+ KN   A+PM +KMW S+V+K NK+   KS+AKFRVFA++S N T
Sbjct  1    MAQILAPSSQWQMRIAKNSAPASPMTAKMWSSLVLKQNKKGTAKSSAKFRVFAVKSENGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TPYTN  IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDG
Sbjct  61   INRMEDLLNLDLTPYTNNFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDG  117



>ref|XP_011009035.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Populus euphratica]
 ref|XP_011009036.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Populus euphratica]
Length=432

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS+QWQMR+ KN   A+PM +KMW S+V+K NK+   KS+AKFRVFA++S N T
Sbjct  1    MAQILAPSSQWQMRIPKNSAPASPMTAKMWSSLVLKQNKKGIAKSSAKFRVFAVKSENGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TPYTN  IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDG
Sbjct  61   INRVEDLLNLDLTPYTNSFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDG  117



>ref|XP_002516801.1| glutamine synthetase plant, putative [Ricinus communis]
 gb|EEF45415.1| glutamine synthetase plant, putative [Ricinus communis]
Length=432

 Score =   187 bits (474),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR+ KN   A+P+ +KMW S+++K NK+V  K++ + RVFAL+S NST
Sbjct  1    MAQILAPSPQWQMRLPKNSMPASPLTTKMWSSLLLKQNKKVTAKNSGRLRVFALKSENST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TPYT++IIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   INRLEDLLNLDITPYTDRIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDG  117



>sp|O22506.1|GLNA2_DAUCA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Daucus carota]
 gb|AAB71693.1| glutamine synthetase [Daucus carota]
Length=432

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR TKN TE + M SKMWGS+ +K NK+   +S+ K+R  A++S + T
Sbjct  1    MAQILAPSVQWQMRFTKNSTEVSSMTSKMWGSLFLKQNKKAPARSSTKYRALAVKSEDGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLDVTPYT+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  117



>gb|KDO74876.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=375

 Score =   183 bits (464),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMRM K    A+PM +KMW S++MK NK+   +S+AKFRV AL+S +ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+E LLNLD+TPYT+KIIAEYIWIGG+GID RSKS+TISKPV+HPSELPKWNYDG
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDG  117



>ref|XP_008223033.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Prunus 
mume]
Length=432

 Score =   184 bits (467),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAP++QWQMR+TK+ T A+PM +KMW S+++K NKR   KS+AKFRV A++S + T
Sbjct  1    MAQILAPTSQWQMRITKSSTTASPMTAKMWSSLLLKQNKRGPTKSSAKFRVLAVKSEDYT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T++IIAEYIWIGGSG+D RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEHPSELPKWNYDG  117



>ref|XP_008351243.1| PREDICTED: glutamine synthetase, chloroplastic-like [Malus domestica]
Length=180

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAP++QWQM++T++ T A+PM +KMWGS+V+K NK+   +S+ KFRV A ++   T
Sbjct  1    MAQILAPNSQWQMKITRSSTTASPMTAKMWGSLVLKQNKKGPARSSTKFRVLATKAEGYT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T++IIAEYIWIGGSG+D RSKSRTISKPV+ PSELPKWNYDG
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEDPSELPKWNYDG  117



>gb|KHG04493.1| Glutamine synthetase leaf isozyme, chloroplastic [Gossypium arboreum]
Length=432

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR+ K+ T  +P+A+KMW S+++K N + A KS  KFRV AL S NST
Sbjct  1    MAQILAPSTQWQMRVPKSSTFGSPIATKMWSSLLLKQNMKGAAKSAGKFRVLALHSENST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR E+LLN+D+TPYT+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   VNRTEKLLNMDITPYTDKIIAEYIWIGGTGIDMRSKSRTISKPVEHPSELPKWNYDG  117



>ref|XP_006419778.1| hypothetical protein CICLE_v10005007mg [Citrus clementina]
 ref|XP_006489239.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X1 
[Citrus sinensis]
 ref|XP_006489240.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X2 
[Citrus sinensis]
 gb|ESR33018.1| hypothetical protein CICLE_v10005007mg [Citrus clementina]
Length=432

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMRM K    A+PM +KMW S++MK NK+   +S+AKFRV AL+S +ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+E LLNLD+TPYT+KIIAEYIWIGG+GID RSKS+TISKPV+HPSELPKWNYDG
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDG  117



>gb|KDO74872.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
 gb|KDO74873.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
 gb|KDO74874.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=432

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMRM K    A+PM +KMW S++MK NK+   +S+AKFRV AL+S +ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+E LLNLD+TPYT+KIIAEYIWIGG+GID RSKS+TISKPV+HPSELPKWNYDG
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDG  117



>ref|XP_010255852.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Nelumbo 
nucifera]
Length=432

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQ++MTKN + A P+ +KMW S+++   ++ A K +AKFRVFALQS +ST
Sbjct  1    MAQILAPSIQWQIKMTKNSSSARPITAKMWSSLLLNQKRKGAAKGSAKFRVFALQSESST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+E LL LD TPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   VNRLEDLLKLDTTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDG  117



>ref|XP_007222384.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica]
 gb|EMJ23583.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica]
Length=432

 Score =   182 bits (461),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAP++QWQMR+TK+ T A+PM +K+W S+++K NKR   KS+AKFRV A++S   T
Sbjct  1    MAQILAPTSQWQMRITKSSTTASPMTAKVWSSLLLKQNKRGPTKSSAKFRVLAVKSEGYT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T++IIAEYIWIGGSG+D RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEHPSELPKWNYDG  117



>gb|KDP40083.1| hypothetical protein JCGZ_02081 [Jatropha curcas]
Length=432

 Score =   181 bits (460),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR+ KN T  +P+ +KM+ S+ +K NK+   ++TA+ RVFA++S NST
Sbjct  1    MAQILAPSTQWQMRIQKNSTPMSPLTAKMFNSLFLKQNKKGTARNTARLRVFAMKSDNST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TPYT+KIIAEYIWIGGSGID RSKSRTISKPV HPSELPKWNYDG
Sbjct  61   INRLEDLLNLDITPYTDKIIAEYIWIGGSGIDVRSKSRTISKPVGHPSELPKWNYDG  117



>ref|XP_004174085.1| PREDICTED: glutamine synthetase, chloroplastic-like, partial 
[Cucumis sativus]
Length=196

 Score =   174 bits (442),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQ+R       ++P+  KMW S+++K NK+ AVKS++K+RV +++S   T
Sbjct  1    MAQILAPSTQWQLRTKLTPMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVRSEGGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDG  117



>gb|KJB37729.1| hypothetical protein B456_006G218100 [Gossypium raimondii]
Length=432

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQIL PS QWQMR+ K  T  +P+ +KMW S+++K N + A KS  KFRV AL S NST
Sbjct  1    MAQILVPSTQWQMRVPKCSTFGSPIVTKMWSSLLLKQNMKGAAKSAGKFRVLALHSENST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR E+LLN+D+TPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   VNRTEKLLNMDITPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVEHPSELPKWNYDG  117



>ref|XP_011462784.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=431

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAP++QWQMR+TK+   ++PM  KMW S+V+K NK+ A+KS+ KFRVFA +  + T
Sbjct  1    MAQILAPTSQWQMRITKSSIPSSPMTGKMWSSLVLKQNKKGAIKSS-KFRVFASKYEDYT  59

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  60   INRVEDLLNLDITPYTDKIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDG  116



>gb|AAN84538.1| putative plastidic glutamine synthetase [Spiraea nipponica]
Length=429

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MA ILAP+ QWQ R+TKN T A+PM +KMWGS+++K NK+   K++ KFRV A++S   T
Sbjct  1    MAHILAPTTQWQTRITKNATSASPMTAKMWGSLLLKQNKKGPTKTSTKFRVLAVKSEGYT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+G+D RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGTGVDVRSKSRTISKPVEHPSELPKWNYDG  117



>gb|KHN37551.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=434

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR++K+   ATP+ S MW S++ K NK+V++ S+AKFRV A++S NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWSSLLWKQNKKVSLTSSAKFRVLAIKSDNST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDG  117



>gb|AAD49734.1|AF169795_1 glutamine synthetase precursor [Juglans nigra]
Length=432

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MA IL P+ +WQMR+TKN   A+PM +KMWGS+++K NK+ + KS+AKFRVFA +S NST
Sbjct  1    MAHILTPTTRWQMRITKNSANASPMTAKMWGSLLLKQNKKGSSKSSAKFRVFATKSENST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNRIE+LLNLD+TPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   VNRIEKLLNLDLTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDG  117



>gb|KCW84320.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=322

 Score =   176 bits (447),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQI+AP+ Q QMR+TKN   A+PM +K W S+++K  K    KS +KFRV+AL+S NST
Sbjct  7    MAQIMAPTIQCQMRITKNSLTASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  66

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDG
Sbjct  67   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDG  123



>ref|XP_006593484.1| PREDICTED: glutamine synthetase precursor isoform X1 [Glycine 
max]
Length=432

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR++K+   ATP+ S MW S++ K NK+V+  S+AKFRV A++S NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWSSLLWKQNKKVSPTSSAKFRVLAIKSDNST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDG  117



>ref|XP_003546121.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006597566.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Glycine max]
 gb|KHN33081.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=432

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR++K+   A+P+ S MW S++ K NK+V+  S+AKFRV A++S NS 
Sbjct  1    MAQILAPSTQWQMRISKSSPNASPITSNMWSSLLWKQNKKVSPTSSAKFRVMAIKSDNSI  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  117



>ref|NP_001237784.1| glutamine synthetase precursor [Glycine max]
 gb|AAK43833.1|AF353620_1 glutamine synthetase precursor [Glycine max]
Length=432

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR++K+   A+P+ S MW S++ K NK+V+  S+AKFRV A++S NS 
Sbjct  1    MAQILAPSTQWQMRISKSSPNASPITSNMWSSLLWKQNKKVSPTSSAKFRVMAIKSDNSI  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  117



>gb|ACU18743.1| unknown [Glycine max]
Length=420

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR++K+   ATP+ S MW S++ K NK+V+  S+AKFRV A++S NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWSSLLWKQNKKVSPTSSAKFRVLAIKSDNST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDG  117



>gb|ACU24520.1| unknown [Glycine max]
Length=432

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR++K+   A+P+ S MW S++ K NK+V+  S+AKFRV A++S NS 
Sbjct  1    MAQILAPSTQWQMRISKSSPNASPITSNMWSSLLWKQNKKVSPTSSAKFRVMAIKSDNSI  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  117



>gb|KJB28233.1| hypothetical protein B456_005G035800 [Gossypium raimondii]
Length=431

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQ+LAPS QWQM + K  T  +P+A+KMW S+V+K NK+ A KS+ KF+V AL S NST
Sbjct  1    MAQLLAPSTQWQMTLPKTSTYGSPIATKMWSSLVLKQNKKGAAKSSGKFKVVAL-SENST  59

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+E LLN+DVTPYT+KIIAEY+WIGGSG+D RSKSRTISKPV+HPSELPKWNYDG
Sbjct  60   VNRLENLLNMDVTPYTDKIIAEYVWIGGSGLDMRSKSRTISKPVKHPSELPKWNYDG  116



>ref|XP_010035905.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 ref|XP_010035913.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW84321.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=432

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQI+AP+ Q QMR+TKN   A+PM +K W S+++K  K    KS +KFRV+AL+S NST
Sbjct  1    MAQIMAPTIQCQMRITKNSLTASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDG
Sbjct  61   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDG  117



>gb|ADK27329.1| plastid glutamine synthetase [Vigna radiata]
Length=429

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 100/117 (85%), Gaps = 3/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR+TK+   A+P+ S  W S++MK NK+    S+AKFRV A++S NST
Sbjct  1    MAQILAPSTQWQMRVTKSSLHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDNST  57

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  114



>ref|XP_010035896.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW84319.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=438

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQI+AP+ Q QMR+TKN   A+PM +K W S+++K  K    KS +KFRV+AL+S NST
Sbjct  7    MAQIMAPTIQCQMRITKNSLTASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  66

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDG
Sbjct  67   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDG  123



>ref|XP_009339932.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Pyrus 
x bretschneideri]
Length=432

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAP++QWQM++TK+   A+PM +KMWGS+V+K NK+   +S+ KFRV A +S   T
Sbjct  1    MAQILAPTSQWQMKVTKSSATASPMTAKMWGSLVLKQNKKGPTRSSTKFRVLATKSEGYT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGGSGID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGIDVRSKSRTISKPVEDPSELPKWNYDG  117



>ref|XP_010041422.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic isoform 
X1 [Eucalyptus grandis]
Length=432

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQI+AP+ Q QMR+TK+   A+PM +K W S+++K  K    KS +KFRV+AL+S NST
Sbjct  1    MAQIMAPTTQCQMRITKHSLNASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDG
Sbjct  61   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDG  117



>ref|XP_009352136.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Pyrus x bretschneideri]
Length=432

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAP++QWQM++TK+ T A+PM +KMWGS+V+K NK+   +S+ KFRV A ++   T
Sbjct  1    MAQILAPTSQWQMKITKSSTTASPMTAKMWGSLVLKQNKKGPARSSTKFRVLATKAEGYT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T++IIAEYIWIGGSG+D RSKSRTISKPV+ PSELPKWNYDG
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEDPSELPKWNYDG  117



>sp|P08281.2|GLNA2_PEA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Pisum sativum]
 gb|AAA33653.1| glutamine synthetase (chloroplast GS2) (EC 6.3.1.2) [Pisum sativum]
Length=430

 Score =   176 bits (447),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 97/117 (83%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR+TK    ATP+ SKMW S+VMK  K+VA   +AKFRV A+ S N T
Sbjct  1    MAQILAPSTQWQMRITKTSPCATPITSKMWSSLVMKQTKKVA--HSAKFRVMAVNSENGT  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV HPSE+PKWNYDG
Sbjct  59   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVSHPSEVPKWNYDG  115



>ref|XP_008361978.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=396

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAP++QWQM++TK+   A+PM +KMWGS+V+K NK+   +S+ KFRV A +S   T
Sbjct  1    MAQILAPTSQWQMKVTKSSATASPMTAKMWGSLVLKQNKKGPTRSSTKFRVLATKSEGYT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGGSGID RSKSRT SKPV+ PSELPKWNYDG
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGIDVRSKSRTXSKPVEDPSELPKWNYDG  117



>gb|AGV54414.1| glutamine synthetase [Phaseolus vulgaris]
Length=429

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 98/117 (84%), Gaps = 3/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR TK+   A+P+ S  W S++MK NK+    S+AKFRV A++S  ST
Sbjct  1    MAQILAPSTQWQMRFTKSSHHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDGST  57

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  114



>ref|XP_004486102.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Cicer arietinum]
Length=430

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 99/117 (85%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR+TK     TP+ SKMW S+V+K NK+VA   +AKFRV A++  NST
Sbjct  1    MAQILAPSTQWQMRITKTSPCVTPITSKMWSSLVVKQNKKVA--RSAKFRVMAIKPDNST  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  59   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDG  115



>gb|AAF17703.1|AF031082_1 glutamine synthetase [Canavalia lineata]
Length=430

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 99/117 (85%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR+TK    A+P+ S MW S++MK NK+    S+AKFRV A++S N T
Sbjct  1    MAQILAPSTQWQMRITKTSPNASPVTSNMWSSLLMKQNKKAT--SSAKFRVLAIKSENGT  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LL+LD+TPYT+KIIAEYIW+GG+GID RSKSRTI++PV+HPSELPKWNYDG
Sbjct  59   INRLENLLDLDITPYTDKIIAEYIWVGGTGIDVRSKSRTIARPVEHPSELPKWNYDG  115



>ref|XP_008390805.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=432

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAP++QWQM++T++ T A+PM +KMWGS+V+K NK+   +S+ KFRV A ++   T
Sbjct  1    MAQILAPNSQWQMKITRSSTTASPMTAKMWGSLVLKQNKKGPARSSTKFRVLATKAEGYT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T++IIAEYIWIGGSG+D RSKSRTISKPV+ PSELPKWNYDG
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEDPSELPKWNYDG  117



>ref|XP_002279497.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis 
vinifera]
 emb|CBI26165.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMRMTKN   A+P  +KMWGS+ +K   +   K + KFRV A +S +ST
Sbjct  1    MAQILAPSTQWQMRMTKNPANASPFTTKMWGSLFLKQKTKGTAKFSTKFRVCASKSESST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR++ LLN+D+ PYT+KIIAEY+WIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   VNRLDDLLNMDIRPYTDKIIAEYVWIGGTGIDLRSKSRTISKPVEHPSELPKWNYDG  117



>ref|XP_007147796.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 ref|XP_007147797.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 sp|P15102.1|GLNA4_PHAVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=Glutamate--ammonia ligase; AltName: Full=Isozyme 
delta; Flags: Precursor [Phaseolus vulgaris]
 emb|CAA31234.1| unnamed protein product [Phaseolus vulgaris]
 gb|ESW19790.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 gb|ESW19791.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
Length=429

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 98/117 (84%), Gaps = 3/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR TK+   A+P+ S  W S++MK NK+    S+AKFRV A++S  ST
Sbjct  1    MAQILAPSTQWQMRFTKSSRHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDGST  57

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  114



>prf||1601519A Gln synthetase
Length=429

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 98/117 (84%), Gaps = 3/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR TK+   A+P+ S  W S++MK NK+    S+AKFRV A++S  ST
Sbjct  1    MAQILAPSTQWQMRFTKSSRHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDGST  57

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  114



>ref|XP_008353244.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=432

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAP++QWQM++TK+   A+PM +KMWGS+V+K NK+   +S+ KFRV A +S   T
Sbjct  1    MAQILAPTSQWQMKVTKSSATASPMTAKMWGSLVLKQNKKGPTRSSTKFRVLATKSEGYT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGGSGID RSKSRT SKPV+ PSELPKWNYDG
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGIDVRSKSRTXSKPVEDPSELPKWNYDG  117



>ref|NP_001284439.1| glutamine synthetase leaf isozyme, chloroplastic [Cucumis melo]
 gb|AAX35343.1| glutamine synthetase [Cucumis melo]
Length=432

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQ+R       ++P+  KMW S+++K NK+ AVKS++K+RV +++S   T
Sbjct  1    MAQILAPSTQWQLRTKLTSMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVKSVGGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDG  117



>ref|XP_008438737.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Cucumis 
melo]
Length=432

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQ+R       ++P+  KMW S+++K NK+ AVKS++K+RV +++S   T
Sbjct  1    MAQILAPSTQWQLRTKLTSMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVKSVGGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDG  117



>ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57036.1| Glutamine synthetase [Cucumis sativus]
Length=432

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQ+R       ++P+  KMW S+++K NK+ AVKS++K+RV +++S   T
Sbjct  1    MAQILAPSTQWQLRTKLTPMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVRSEGGT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDG  117



>gb|AAN84537.1| putative plastidic glutamine synthetase [Crataegus crus-galli]
Length=432

 Score =   174 bits (440),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAP++QW+M++T++   A+PM +KMWGS+V+K NK+   +S+ KFRV A +S   T
Sbjct  1    MAQILAPTSQWRMKVTRSSATASPMTAKMWGSLVLKQNKKGPARSSTKFRVLATKSEGYT  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGGSG+D RSKSRTISKPV+ PSELPKWNYDG
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGVDVRSKSRTISKPVEDPSELPKWNYDG  117



>ref|XP_006593065.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Glycine max]
Length=198

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 101/128 (79%), Gaps = 11/128 (9%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR++K+   ATP+ S MWGS++ K NK+V++ S+AKFRV A++S NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWGSLLWKQNKKVSLTSSAKFRVLAIKSDNST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIW-----------IGGSGIDTRSKSRTISKPVQHPSE  457
            +NR+E LLNLD+TP+T+KIIAEYIW           + G GID RSKSRTISKPV+ PS+
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWYLKLIFFFETGLRGIGIDVRSKSRTISKPVEDPSK  120

Query  458  LPKWNYDG  481
            LP+WNYDG
Sbjct  121  LPRWNYDG  128



>gb|KDO74871.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=428

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 97/117 (83%), Gaps = 4/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMRM K    A+PM +KMW S++MK NK+   +S+AKFRV AL+S +ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+E LLNLD+TPYT+KIIAEYIWIGG+GID RSK    SKPV+HPSELPKWNYDG
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSK----SKPVEHPSELPKWNYDG  113



>gb|ACJ84875.1| unknown [Medicago truncatula]
Length=321

 Score =   169 bits (427),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 98/117 (84%), Gaps = 4/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS Q Q R+TK    ATP++SKMW S+VMK NK+VA   +AKFRV A+ SG  T
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVNSG--T  56

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  57   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  113



>gb|KDO74875.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=442

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 101/127 (80%), Gaps = 10/127 (8%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMRM K    A+PM +KMW S++MK NK+   +S+AKFRV AL+S +ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYI--------W--IGGSGIDTRSKSRTISKPVQHPSEL  460
            VNR+E LLNLD+TPYT+KIIAEYI        W  IGG+GID RSKS+TISKPV+HPSEL
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYICQNNTISCWNRIGGTGIDMRSKSKTISKPVEHPSEL  120

Query  461  PKWNYDG  481
            PKWNYDG
Sbjct  121  PKWNYDG  127



>gb|AAN84563.1| glutamine synthetase [Lotus japonicus]
Length=430

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 95/117 (81%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQ R+TK    A+P+ S MW S++ K NK+VA  S  KFRV A++S  ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVARAS--KFRVLAIKSDGST  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLDVTPYT+K IAEYIWIGG+G+D RSKSRTISKPV HPSELPKWNYDG
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIGGTGVDVRSKSRTISKPVSHPSELPKWNYDG  115



>sp|Q9XQ94.1|GLNA2_MEDSA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Medicago sativa]
 gb|AAD28443.1|AF124244_1 glutamine synthetase precursor [Medicago sativa]
Length=428

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 98/117 (84%), Gaps = 4/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS Q Q R+TK    ATP++SKMW S+VMK NK+VA   +AKFRV A+ SG  T
Sbjct  1    MAQILAPSIQCQTRITKTSPLATPISSKMWSSLVMKQNKKVA--RSAKFRVMAINSG--T  56

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  57   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  113



>gb|AAO85218.1| glutamine synthetase PR2 mutant [Lotus japonicus]
Length=430

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 95/117 (81%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQ R+TK    A+P+ S MW S++ K NK+VA  S  KFRV A++S  ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVARAS--KFRVLAIKSDGST  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLDVTPYT+K IAEYIWIGG+G+D RSKSRTISKPV HPSELPKWNYDG
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIGGTGVDVRSKSRTISKPVSHPSELPKWNYDG  115



>gb|AAL67439.1| glutamine synthetase precursor [Lotus japonicus]
Length=430

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 95/117 (81%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQ R+TK    A+P+ S MW S++ K NK+VA  S  KFRV A++S  ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVARAS--KFRVLAIKSDGST  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLDVTPYT+K IAEYIWIGG+G+D RSKSRTISKPV HPSELPKWNYDG
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIGGTGVDVRSKSRTISKPVSHPSELPKWNYDG  115



>gb|KEH36742.1| glutamine synthetase domain protein [Medicago truncatula]
Length=393

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 98/117 (84%), Gaps = 4/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS Q Q R+TK    ATP++SKMW S+VMK NK+VA   +AKFRV A+ SG  T
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVNSG--T  56

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  57   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  113



>gb|AAO37651.1| glutamine synthetase [Medicago truncatula]
 gb|KEH36741.1| glutamine synthetase domain protein [Medicago truncatula]
Length=428

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 98/117 (84%), Gaps = 4/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS Q Q R+TK    ATP++SKMW S+VMK NK+VA   +AKFRV A+ SG  T
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVNSG--T  56

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  57   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  113



>gb|AJD14836.1| plastid glutamine synthetase [Boehmeria nivea]
Length=430

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 99/117 (85%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS Q QMR+TK  +  +P+ SKMW S+V+K +KRV  K ++K++V  ++S + T
Sbjct  1    MAQILAPSTQMQMRITKASSSTSPLTSKMWSSIVLKQSKRV--KGSSKYKVLTVKSEHGT  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  59   INRLEDLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  115



>gb|AJI44225.1| plastid glutamine synthetase [Boehmeria nivea]
Length=430

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 99/117 (85%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS Q QMR+TK  +  +P+ SKMW S+V+K +KRV  K ++K++V  ++S + T
Sbjct  1    MAQILAPSTQMQMRITKASSSTSPLTSKMWSSIVLKQSKRV--KGSSKYKVLTVKSEHGT  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  59   INRLEDLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  115



>gb|KCW44355.1| hypothetical protein EUGRSUZ_L021751, partial [Eucalyptus grandis]
Length=165

 Score =   162 bits (409),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 99/150 (66%), Gaps = 33/150 (22%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQI+AP+ Q QMR+TK+   A+PM +K W S+++K  K    KS +KFRV+AL+S NST
Sbjct  1    MAQIMAPTTQCQMRITKHSLNASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  60

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIW---------------------------------IG  391
            +NR+E LLNLDVTPYT+KIIAEYIW                                 IG
Sbjct  61   INRLENLLNLDVTPYTDKIIAEYIWYVLMPETFDGGAQKDGNTRTVLYSKFAFFFNLLIG  120

Query  392  GSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            GSGID RSKSRTIS+PV+HPSELPKWNYDG
Sbjct  121  GSGIDLRSKSRTISRPVEHPSELPKWNYDG  150



>gb|ADM45299.1| chloroplast GS2b-alpha precursor [Medicago truncatula]
 gb|ADM45300.1| chloroplast GS2b-beta precursor [Medicago truncatula]
 gb|KEH36738.1| glutamine synthetase domain protein [Medicago truncatula]
Length=428

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 96/117 (82%), Gaps = 4/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS Q Q R+TK    ATP++SKMW S+VMK NK+VA   +A FR  A+ SG  T
Sbjct  1    MAQILAPSTQCQTRITKTSPFATPISSKMWSSLVMKQNKKVA--RSATFRAMAINSG--T  56

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  57   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  113



>gb|AAO85217.1| glutamine synthetase PR1 mutant [Lotus japonicus]
Length=430

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQ R+TK    A+P+ S MW S++ K NK+VA  S  KFRV A++S  ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVARAS--KFRVLAIKSDGST  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLDVTPYT+K IAEYIWI G+G+D RSKSRTISKPV HPSELPKWNYDG
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIRGTGVDVRSKSRTISKPVSHPSELPKWNYDG  115



>ref|XP_003594092.1| Glutamine synthetase [Medicago truncatula]
Length=1639

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 98/117 (84%), Gaps = 4/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS Q Q R+TK    ATP++SKMW S+VMK NK+VA   +AKFRV A+ SG  T
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVNSG--T  56

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  57   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  113


 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 96/117 (82%), Gaps = 4/117 (3%)
 Frame = +2

Query  131   MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
             MAQILAPS Q Q R+TK    ATP++SKMW S+VMK NK+VA   +A FR  A+ SG  T
Sbjct  1212  MAQILAPSTQCQTRITKTSPFATPISSKMWSSLVMKQNKKVA--RSATFRAMAINSG--T  1267

Query  311   VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  1268  INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDG  1324



>gb|ABL89188.2| plastid glutamine synthetase 2 [Spinacia oleracea]
Length=431

 Score =   164 bits (414),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 97/118 (82%), Gaps = 3/118 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFA-LQSGNS  307
            MAQILAPS Q QM+++K LT +  M    W S+++K  ++ ++K + KFRV A LQS + 
Sbjct  1    MAQILAPSMQCQMKLSKGLTSS--MTPSPWTSILLKQGQKGSIKCSTKFRVCASLQSDHG  58

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            TVNR+EQLLNLDVTPYT+KIIAEYIWIGG+GID RSKSRT+SKPV+HPSELPKWNYDG
Sbjct  59   TVNRVEQLLNLDVTPYTDKIIAEYIWIGGTGIDLRSKSRTLSKPVEHPSELPKWNYDG  116



>ref|XP_002274139.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis 
vinifera]
 emb|CBI32325.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (82%), Gaps = 3/119 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRM--TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGN  304
            MA I APS Q Q+R+  T + T A PM +K+W S+++   K+   +S+A+FRV ALQS +
Sbjct  1    MAHITAPSVQCQVRVVPTSSFT-ARPMTAKLWNSLLLNQRKKGTSRSSARFRVLALQSES  59

Query  305  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            STVNR++ LLNLD+TPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  60   STVNRLKDLLNLDITPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVKHPSELPKWNYDG  118



>ref|XP_010557680.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=434

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMAS-KMWGSVVMKPNKRVA-VKSTAKFRVFALQSGN  304
            MAQILAPS + QM + K+   ++P AS K+W SVV++ NK+   +  + KFRV ALQS +
Sbjct  1    MAQILAPSPKCQMGVPKHSVISSPAASSKLWSSVVLRQNKQSGKLNCSNKFRVLALQSDD  60

Query  305  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            STVNR+E LLNLD  PYT+KIIAEYIWIGGSGID RSKSRTI KPV+HPSELPKWNYDG
Sbjct  61   STVNRLEGLLNLDTKPYTDKIIAEYIWIGGSGIDLRSKSRTIEKPVEHPSELPKWNYDG  119



>gb|AFH88076.1| chloroplast glutamine synthetase protein, partial [Sesuvium portulacastrum]
Length=433

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFA-LQSGNS  307
            MAQILAPS Q QM + K+   A  +    W SVV+K +++ ++K++ KF+V A  +S +S
Sbjct  1    MAQILAPSMQLQMGIPKSSVLANSVMPNKWTSVVLKQSRKGSIKNSTKFKVCATFKSEDS  60

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            TVNR+EQLLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  61   TVNRVEQLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDG  118



>ref|XP_010542001.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010542002.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
Length=434

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMAS-KMWGSVVMKPNKRVA-VKSTAKFRVFALQSGN  304
            MAQILAPS + QM   K+    +P AS ++W SVV+K NK+   +K ++KFRV A+QS +
Sbjct  1    MAQILAPSPKCQMGAPKHSFITSPAASSRLWSSVVLKQNKQSGKLKYSSKFRVLAVQSDD  60

Query  305  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            STVNR+E LLNLD  PYT+KIIAEYIWIGGSGID RSKSRTI KPV+HPSELPKWNYDG
Sbjct  61   STVNRLEGLLNLDTKPYTDKIIAEYIWIGGSGIDLRSKSRTIEKPVEHPSELPKWNYDG  119



>gb|AAD31898.1|AF145480_1 glutamine synthetase leaf isozyme precursor [Mesembryanthemum 
crystallinum]
Length=433

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFA-LQSGNS  307
            MAQILAPS Q +M +TK+ T A+ M    W SVV+K +++ ++K++ KF+V A ++   S
Sbjct  1    MAQILAPSLQVKMSITKSSTPASSMLPNTWTSVVLKQSRKGSIKNSTKFKVCASIKPDVS  60

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
              NR+EQLLNLDVTP+T+KIIAEYIWIGG+GID RSKSRT+SKPV+HPSELPKWNYDG
Sbjct  61   VQNRVEQLLNLDVTPFTDKIIAEYIWIGGAGIDLRSKSRTLSKPVEHPSELPKWNYDG  118



>gb|AAY33511.1| glutamine synthetase precursor, partial [Lotus japonicus]
Length=104

 Score =   145 bits (365),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 84/106 (79%), Gaps = 2/106 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQ R+TK    A+P+ S MW S++ K NK+VA  S  KFRV A++S  ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVARAS--KFRVLAIKSDGST  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQH  448
            +NR+E LLNLDVTPYT+K IAEYIWIGG+G+D RSKSRTISKPV H
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIGGTGVDVRSKSRTISKPVSH  104



>ref|XP_010666333.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010666334.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 gb|AAK07678.1| glutamine synthetase GS2 [Beta vulgaris]
 gb|ACB45672.1| plastid glutamine synthetase [Beta vulgaris]
Length=431

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 98/118 (83%), Gaps = 3/118 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFA-LQSGNS  307
            MAQILAP+ Q QM+++K+LT +  M    W S+++K +++ ++K + KF+V A L++ + 
Sbjct  1    MAQILAPNMQCQMKLSKSLTNS--MIPNSWTSILLKGSQKGSIKCSTKFKVCAALKTEHG  58

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            TVNR+EQLLNLDVTP+T+KIIAEYIWIGGSGID RSKSRT+S+PV+ PSELPKWNYDG
Sbjct  59   TVNRMEQLLNLDVTPFTDKIIAEYIWIGGSGIDLRSKSRTLSRPVEDPSELPKWNYDG  116



>emb|CAN61808.1| hypothetical protein VITISV_014295 [Vitis vinifera]
Length=433

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 93/119 (78%), Gaps = 3/119 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRM--TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGN  304
            MA I APS Q Q+R+  T + T A  M +K+W S++    K+   +S+A+ RV ALQS +
Sbjct  1    MAHIXAPSVQCQVRVVPTSSFT-ARXMTAKLWNSLLXNQRKKGTSRSSARXRVLALQSES  59

Query  305  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             TVNR++ LLNLD+TPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDG
Sbjct  60   XTVNRLKDLLNLDITPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVKHPSELPKWNYDG  118



>ref|XP_010435449.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X3 [Camelina sativa]
 ref|XP_010435451.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X4 [Camelina sativa]
 ref|XP_010440748.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
Length=430

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 92/117 (79%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILA S   QMR+ K+ + ++ + +K+W SVV+K  K+ + K    FRVFALQS NST
Sbjct  1    MAQILAASPTCQMRVPKH-SSSSVITNKLWSSVVLKQKKQSSNKLRG-FRVFALQSDNST  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+E LLNLD  PY+++IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDG
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDG  115



>ref|XP_010435447.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010435448.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
 ref|XP_010435454.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X7 [Camelina sativa]
 ref|XP_010440747.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
Length=441

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 92/117 (79%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILA S   QMR+ K+ + ++ + +K+W SVV+K  K+ + K    FRVFALQS NST
Sbjct  12   MAQILAASPTCQMRVPKH-SSSSVITNKLWSSVVLKQKKQSSNKLRG-FRVFALQSDNST  69

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+E LLNLD  PY+++IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDG
Sbjct  70   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDG  126



>dbj|BAH56878.1| AT5G35630 [Arabidopsis thaliana]
Length=278

 Score =   145 bits (365),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 88/117 (75%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILA S   QMR+ K+ +     +SK+W SVV+K  K+ +      FRV ALQS NST
Sbjct  1    MAQILAASPTCQMRVPKH-SSVIASSSKLWSSVVLK-QKKQSNNKVRGFRVLALQSDNST  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+E LLNLD  PY+++IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDG
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDG  115



>ref|XP_010450396.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Camelina sativa]
 ref|XP_010450397.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Camelina sativa]
Length=430

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 91/117 (78%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILA S   QMR+ K+ + ++ + +K+W SVV+K  K+ + K    FRV ALQS NST
Sbjct  1    MAQILAASPTCQMRVPKH-SSSSVITNKLWSSVVLKQKKQSSNKLRG-FRVLALQSDNST  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+E LLNLD  PY+++IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDG
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDG  115



>ref|XP_002868428.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44687.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 88/117 (75%), Gaps = 3/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILA S   QMR+ K+   +   +SK+W SVV+K  K+   K    FRV ALQS NST
Sbjct  1    MAQILAASPTCQMRVPKH--SSVIASSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  57

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+E LLNLD  PYT++IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDG
Sbjct  58   VNRVETLLNLDTKPYTDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDG  114



>ref|XP_009124267.1| PREDICTED: glutamine synthetase, chloroplastic [Brassica rapa]
 sp|Q42624.1|GLNAC_BRANA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Brassica napus]
 emb|CAA51280.1| glutamate--ammonia ligase precursor [Brassica napus]
 emb|CDX74644.1| BnaA04g07450D [Brassica napus]
Length=428

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 90/117 (77%), Gaps = 4/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILA S   QMR+TK  + A+   SK+W SVV+K  K+ + K    F+V ALQS NST
Sbjct  1    MAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKKQSSSK-VRSFKVMALQSDNST  56

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD  P+T++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDG
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDG  113



>emb|CDY33684.1| BnaC04g29670D [Brassica napus]
Length=489

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 3/119 (3%)
 Frame = +2

Query  125  VKMAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGN  304
            +KMAQILA S   QMR+TK  + A+   SK+W SVV+K  K+ +      F+V ALQS N
Sbjct  59   IKMAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKKQSSSSKVRSFKVMALQSDN  115

Query  305  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ST+NR+E LLNLD  P+T++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDG
Sbjct  116  STINRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDG  174



>ref|NP_198413.1| glutamine synthetase 2 [Arabidopsis thaliana]
 ref|NP_001031969.1| glutamine synthetase 2 [Arabidopsis thaliana]
 ref|NP_001078639.1| glutamine synthetase 2 [Arabidopsis thaliana]
 sp|Q43127.1|GLNA2_ARATH RecName: Full=Glutamine synthetase, chloroplastic/mitochondrial; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL16230.1|AF428461_1 AT5g35630/MJE4_9 [Arabidopsis thaliana]
 gb|AAL16249.1|AF428319_1 AT5g35630/MJE4_9 [Arabidopsis thaliana]
 gb|AAB20558.1| light-regulated glutamine synthetase isoenzyme [Arabidopsis thaliana]
 dbj|BAA88761.1| Glutamine Synthetase [Arabidopsis thaliana]
 dbj|BAB09304.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast 
(clone lambdaAtgsl1) [Arabidopsis thaliana]
 gb|AAL91141.1| glutamate-ammonia ligase, chloroplast [Arabidopsis thaliana]
 gb|AAM14064.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis 
thaliana]
 gb|AAM65763.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast 
[Arabidopsis thaliana]
 gb|AAM67510.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis 
thaliana]
 dbj|BAH19798.1| AT5G35630 [Arabidopsis thaliana]
 gb|AED93993.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED93994.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED93995.1| glutamine synthetase [Arabidopsis thaliana]
 prf||1804333A Gln synthetase
Length=430

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 88/117 (75%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILA S   QMR+ K+ +     +SK+W SVV+K  K+   K    FRV ALQS NST
Sbjct  1    MAQILAASPTCQMRVPKH-SSVIASSSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+E LLNLD  PY+++IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDG
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDG  115



>gb|ABY87178.1| chloroplast glutamine synthetase [Brassica rapa subsp. chinensis]
Length=428

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 90/117 (77%), Gaps = 4/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILA S   QMR+TK  + A+   SK+W SVV+K  ++ + K    F+V ALQS NST
Sbjct  1    MAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKEQSSSK-VRSFKVMALQSDNST  56

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD  P+T++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDG
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDG  113



>ref|XP_006395952.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 ref|XP_006395953.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 ref|XP_006395954.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33238.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33239.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33240.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
Length=426

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILA S   QMR+TK  + A+   SK+W SV++K  K+     +  FRV ALQS NST
Sbjct  1    MAQILAASPTCQMRVTKPSSIAS---SKLWSSVMLKQKKQ---SRSTSFRVMALQSDNST  54

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD  P+T++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDG
Sbjct  55   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDG  111



>emb|CDY49365.1| BnaA08g29950D [Brassica napus]
Length=394

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 92/118 (78%), Gaps = 6/118 (5%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMAS-KMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  307
            MAQILA S   QM++TK     +P+AS K+W SV++K  K+ + K  + F+V ALQS NS
Sbjct  1    MAQILAASPTCQMKLTK----PSPIASSKLWSSVMLKQKKQNSSKLRS-FKVMALQSDNS  55

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            T+NR+E LLNLD  P+T++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDG
Sbjct  56   TINRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDG  113



>ref|XP_008779349.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like, 
partial [Phoenix dactylifera]
Length=259

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATP-MASKMWGSVVMKPNKRVAVKSTAKFRVFALQS-GN  304
            MA +L PS Q +M +T N  +A P M +K W S++    +    KST+ F+V AL+S  N
Sbjct  1    MAHMLVPSMQCRMGITSNSIQARPIMTAKTWNSLLSNARRPKTKKSTSTFKVLALKSDNN  60

Query  305  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
              V+R+E LLNLD+TP+T+KIIAEYIWIGG+GID RSK+RT+ +PV+HPSELPKWNYDG
Sbjct  61   GAVSRLENLLNLDITPFTDKIIAEYIWIGGTGIDIRSKARTVPRPVEHPSELPKWNYDG  119



>ref|XP_009108017.1| PREDICTED: glutamine synthetase, chloroplastic-like [Brassica 
rapa]
Length=428

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 91/118 (77%), Gaps = 6/118 (5%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMAS-KMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  307
            MAQILA S   QM++TK     +P+AS K+W SV++K  K+ + K    F+V ALQS NS
Sbjct  1    MAQILAASPTCQMKLTK----PSPIASSKLWSSVMLKQKKQNSSKLRG-FKVMALQSDNS  55

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            T+NR+E LLNLD  P+T++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDG
Sbjct  56   TINRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDG  113



>emb|CAB72423.1| glutamine synthetase [Brassica napus]
Length=428

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 89/117 (76%), Gaps = 4/117 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILA S   QMR+TK  + A+   SK+W SVV+K  K+ + K    F+V A+QS NST
Sbjct  1    MAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKKQSSSK-VRSFKVMAIQSDNST  56

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E LLNLD  P+T++IIAEYIW GGSGID RSKSRT+ KPV+ PSELPKWNYDG
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWYGGSGIDLRSKSRTLEKPVEDPSELPKWNYDG  113



>ref|XP_010938796.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Elaeis 
guineensis]
Length=434

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPM-ASKMWGSVVMKPNKRVAVKSTAKFRVFALQ-SGN  304
            MA++L PS Q QM MT N  +A P+  +K W S+++   +    KST+ F+V AL+   N
Sbjct  1    MARMLVPSMQCQMGMTSNSIQARPIITTKSWNSLLLNSQRPKTKKSTSTFKVLALKYDNN  60

Query  305  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             TV+R+E LLN+D+TP+T+KIIAEYIWIGG+GID RSK RTI +PV+HPSELPKWNYDG
Sbjct  61   GTVSRLENLLNMDITPFTDKIIAEYIWIGGTGIDIRSKPRTIPRPVEHPSELPKWNYDG  119



>emb|CAA73062.1| plastidic glutamine synthetase precursor [Brassica napus]
Length=428

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 91/118 (77%), Gaps = 6/118 (5%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMAS-KMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  307
            MAQILA S   QM++TK     +P+AS K+W SV++K  K+ + K  + F+  ALQS NS
Sbjct  1    MAQILAASPTCQMKLTK----PSPIASSKLWSSVMLKQKKQNSSKLRS-FKAMALQSDNS  55

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            T+NR+E LLNLD  P+T++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDG
Sbjct  56   TINRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDG  113



>ref|XP_006282617.1| hypothetical protein CARUB_v10004865mg [Capsella rubella]
 gb|EOA15515.1| hypothetical protein CARUB_v10004865mg [Capsella rubella]
Length=429

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 90/118 (76%), Gaps = 5/118 (4%)
 Frame = +2

Query  131  MAQILAPS-AQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  307
            MAQILA S    QMR+ K+   ++ + +K+W SVV+K  K+ + K    FRV ALQS NS
Sbjct  1    MAQILAASPTTCQMRVPKH---SSVITNKLWSSVVLKQKKQSSNKHRG-FRVLALQSDNS  56

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            TVNR+E LLNLD  PY+++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDG
Sbjct  57   TVNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDG  114



>ref|XP_006850815.1| hypothetical protein AMTR_s00025p00120730 [Amborella trichopoda]
 gb|ERN12396.1| hypothetical protein AMTR_s00025p00120730 [Amborella trichopoda]
Length=433

 Score =   136 bits (343),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 88/121 (73%), Gaps = 4/121 (3%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVM--KPNKRVAVKSTAKFRVFALQ--S  298
            MAQILAPS Q QM   K   +A P+ +KMW S+V+  + + R + KS +KFR F+++  S
Sbjct  1    MAQILAPSMQCQMGSAKISIKAGPVTAKMWNSLVLNHRLSGRNSFKSASKFRAFSVKAAS  60

Query  299  GNSTVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  478
             N  VNR+E LL LD+TP T+KIIAEYIWIGGSG D RSKSRTIS+PV+    LPKWNYD
Sbjct  61   DNGVVNRLEDLLKLDLTPITDKIIAEYIWIGGSGTDLRSKSRTISRPVESALGLPKWNYD  120

Query  479  G  481
            G
Sbjct  121  G  121



>ref|XP_010435452.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X5 [Camelina sativa]
 ref|XP_010435453.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X6 [Camelina sativa]
 ref|XP_010440749.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X3 [Camelina sativa]
Length=418

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 84/105 (80%), Gaps = 2/105 (2%)
 Frame = +2

Query  167  MRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNSTVNRIEQLLNLDV  346
            MR+ K+ + ++ + +K+W SVV+K  K+ + K    FRVFALQS NSTVNR+E LLNLD 
Sbjct  1    MRVPKH-SSSSVITNKLWSSVVLKQKKQSSNKLRG-FRVFALQSDNSTVNRVETLLNLDT  58

Query  347  TPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             PY+++IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDG
Sbjct  59   KPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDG  103



>ref|XP_009391592.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009391594.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=433

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPM-ASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  307
            MA+++    Q QM    N  +  PM  SKMW S+++   +    +  + F+V A++S N 
Sbjct  1    MAKMMVSPMQCQMGFPSNSLQGRPMITSKMWNSLLLNAQRPKTRRGISAFKVLAVKSENG  60

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             V+R+E LLNLD TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+H SELPKWNYDG
Sbjct  61   VVSRLEDLLNLDTTPFTDKIIAEYIWIGGTGIDIRSKSRTISKPVEHASELPKWNYDG  118



>emb|CDX84116.1| BnaC08g07930D [Brassica napus]
Length=247

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = +2

Query  185  LTEATPMAS-KMWGSVVMKPNKRVAVKSTAKFRVFALQSGNSTVNRIEQLLNLDVTPYTN  361
            LT+ +P+AS K+W SV++K  K+ + K  + F+  ALQS NST+NR+E LLNLD  P+T+
Sbjct  3    LTKPSPIASSKLWSSVMLKQKKQNSSKLRS-FKAMALQSDNSTINRVESLLNLDTKPFTD  61

Query  362  KIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDG
Sbjct  62   RIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDG  101



>ref|XP_009417914.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009417915.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=428

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPM-ASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  307
            MAQ++    Q Q+R      +  PM  SKMW S+++   +    +S + F+V A++S N 
Sbjct  1    MAQMMVSPMQCQIRFPSKSLQGKPMITSKMWNSLLLNAQRFKTKRSVSAFKVLAVKSDNG  60

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             V+R+E LL LD+ P+T+KIIAEYIWIGG+GID RSKSRTI++PV++PSELPKWNYDG
Sbjct  61   VVSRLEDLLKLDMAPFTDKIIAEYIWIGGTGIDIRSKSRTITRPVEYPSELPKWNYDG  118



>ref|XP_003580719.1| PREDICTED: glutamine synthetase, chloroplastic [Brachypodium 
distachyon]
Length=430

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 83/121 (69%), Gaps = 10/121 (8%)
 Frame = +2

Query  131  MAQILAPSAQWQM-RMTKNLTEATPMAS--KMWGSVVMKPNKRVAVKSTAKFRVFALQSG  301
            MAQ + P+ Q QM  + K+   A P A+  ++WG       +R   + T+ F+V AL + 
Sbjct  1    MAQAVVPAMQCQMGALGKSAVRARPAAAGGRVWGV------RRSGARGTSGFKVLALGTE  54

Query  302  NS-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  478
             +  V R+EQLLN+D  PY++KIIAEYIW+GGSGID RSKSRTISKPV  PSELPKWNYD
Sbjct  55   TTGVVPRLEQLLNMDTKPYSDKIIAEYIWVGGSGIDIRSKSRTISKPVADPSELPKWNYD  114

Query  479  G  481
            G
Sbjct  115  G  115



>gb|KHN31946.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=190

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 79/117 (68%), Gaps = 23/117 (20%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILAPS QWQMR++K+   ATP+ S MWGS++ K NK+V++ S+AKFRV A++S NST
Sbjct  11   MAQILAPSTQWQMRISKSSPNATPITSNMWGSLLWKQNKKVSLTSSAKFRVLAIKSDNST  70

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +NR+E L                    G+GID RSKSR    PV+ PS+LP+WNYDG
Sbjct  71   INRLEGLR-------------------GTGIDVRSKSR----PVEDPSKLPRWNYDG  104



>prf||1804333B Gln synthetase
Length=430

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 81/117 (69%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILA S   QMR+ K+ +     +SK+W SVV+K  K+ +      FRV ALQS N +
Sbjct  1    MAQILAASPTCQMRVPKH-SSVIASSSKLWSSVVLK-QKKQSNNKVRGFRVLALQSDNMS  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +N  E LLNL  + Y ++IIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  59   LNSDEILLNLSDSTYKDRIIAEYIWVGGSGMDMRSKARTLPGPVTDPSQLPKWNYDG  115



>gb|AFB69878.1| chloroplast glutamine synthetase isoform 2-1 [Secale cereale]
Length=427

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 82/119 (69%), Gaps = 9/119 (8%)
 Frame = +2

Query  131  MAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  307
            MAQ + P+ Q Q+ +  ++   A   A ++WG        R   ++T+ F+V AL    +
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRLWGV-------RRTARATSGFKVLALGPETT  53

Query  308  TV-NRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             V  R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDG  112



>gb|AAZ30061.1| plastid glutamine synthetase isoform GS2b [Triticum aestivum]
Length=427

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 81/119 (68%), Gaps = 9/119 (8%)
 Frame = +2

Query  131  MAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQ-SGN  304
            MAQ + P+ Q Q+ +  ++   A   A ++WG        R   ++T+ F+V AL     
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARATSGFKVLALGPETT  53

Query  305  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
              + R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDG  112



>gb|AAZ30062.1| plastid glutamine synthetase isoform GS2c [Triticum aestivum]
 gb|AAZ80474.1| GS2 [Triticum aestivum]
 gb|ACT22493.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22495.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22498.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|AEH16638.1| glutamine synthetase [Triticum aestivum]
 gb|AEM42904.1| plastid glutamine synthetase isoform [Secale cereale x Triticum 
turgidum subsp. durum]
 gb|EMT11272.1| Glutamine synthetase leaf isozyme, chloroplastic [Aegilops tauschii]
Length=427

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 82/119 (69%), Gaps = 9/119 (8%)
 Frame = +2

Query  131  MAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  307
            MAQ + P+ Q Q+ +  ++   A   A ++WG        R   ++T+ F+V AL    +
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARATSGFKVLALGPETT  53

Query  308  TV-NRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             V  R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDG  112



>ref|XP_004960149.1| PREDICTED: glutamine synthetase, chloroplastic-like [Setaria 
italica]
Length=428

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 80/121 (66%), Gaps = 12/121 (10%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMAS---KMWGSVVMKPNKRVAVKSTAKFRVFALQSG  301
            MAQ + P+ Q Q+   K    A P A    ++WG        R   + T+ F+V A+ + 
Sbjct  1    MAQAVVPAMQCQVG-AKAAVRARPAAGAGGRVWGV-------RRTGRGTSGFKVMAISTA  52

Query  302  NS-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  478
            ++  V R+EQ+LNLD  PYT+KIIAEYIW+GGSGID RSKSRTI KPV+ PSELPKWNYD
Sbjct  53   STGVVPRLEQMLNLDTKPYTDKIIAEYIWVGGSGIDLRSKSRTIEKPVEDPSELPKWNYD  112

Query  479  G  481
            G
Sbjct  113  G  113



>gb|AAZ30060.1| plastid glutamine synthetase isoform GS2a [Triticum aestivum]
Length=427

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 81/119 (68%), Gaps = 9/119 (8%)
 Frame = +2

Query  131  MAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  307
            MAQ + P+ Q Q+ +  ++   A   A ++WG        R   ++T+ F V AL    +
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARATSGFEVLALGPETT  53

Query  308  TV-NRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             V  R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDG  112



>gb|ACT22500.1| plastid glutamine synthetase 2 [Triticum aestivum]
Length=427

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 81/119 (68%), Gaps = 9/119 (8%)
 Frame = +2

Query  131  MAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  307
            MAQ + P+ Q Q+ +  ++   A   A ++WG        R   ++ + F+V AL    +
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARAASGFKVLALGPETT  53

Query  308  TV-NRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             V  R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDG  112



>gb|ACT22496.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22497.1| plastid glutamine synthetase 2 [Triticum aestivum]
Length=427

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 81/119 (68%), Gaps = 9/119 (8%)
 Frame = +2

Query  131  MAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  307
            MAQ + P+ Q Q+ +  ++   A   A ++WG        R   ++ + F+V AL    +
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARAASGFKVLALGPETT  53

Query  308  TV-NRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             V  R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDG  112



>dbj|BAJ91545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 82/122 (67%), Gaps = 9/122 (7%)
 Frame = +2

Query  122  QVKMAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQS  298
            +  MAQ +  + Q Q+ +  +    A   A ++WG        R A ++T+ F+V AL  
Sbjct  6    ETTMAQAVVQAMQCQVGVRGRTAVPARQPAGRVWGV-------RRAARATSGFKVLALGP  58

Query  299  GNSTV-NRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNY  475
              + V  R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNY
Sbjct  59   ETTGVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNY  118

Query  476  DG  481
            DG
Sbjct  119  DG  120



>prf||1804333D Gln synthetase
Length=430

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILA S   QMR+ K+ +     +SK+W SVV+K  K+   K    FRV ALQS NST
Sbjct  1    MAQILAASPTCQMRVPKH-SSVIASSSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +   E LLNL      ++IIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  59   LLSDEVLLNLTDATGKDRIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDG  115



>dbj|BAJ95492.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 82/122 (67%), Gaps = 9/122 (7%)
 Frame = +2

Query  122  QVKMAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQS  298
            +  MAQ +  + Q Q+ +  +    A   A ++WG        R A ++T+ F+V AL  
Sbjct  6    ETTMAQAVVQAMQCQVGVRGRTAVPARQPAGRVWGV-------RRAARATSGFKVLALGP  58

Query  299  GNSTV-NRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNY  475
              + V  R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNY
Sbjct  59   ETTGVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNY  118

Query  476  DG  481
            DG
Sbjct  119  DG  120



>ref|NP_001241708.1| uncharacterized protein LOC100856886 [Zea mays]
 gb|ACF85271.1| unknown [Zea mays]
 gb|AFW59722.1| glutamine synthetase1 [Zea mays]
Length=380

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 81/118 (69%), Gaps = 11/118 (9%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS-  307
            MAQ + P+ Q ++ +          A ++W +   +  +  A   +  F+V A+ +G++ 
Sbjct  1    MAQAVVPAMQCRVGVKA-------AAGRVWSAGRTRTGRGGA---SPGFKVMAVSTGSTG  50

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             V R+EQLLN+D TPYT+K+IAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  51   VVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDG  108



>ref|XP_008662330.1| PREDICTED: glutamine synthetase, chloroplastic isoform X2 [Zea 
mays]
Length=512

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 86/133 (65%), Gaps = 15/133 (11%)
 Frame = +2

Query  86   PCHCYPISTDR*QVKMAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKS  265
            PC C P +       MAQ + P+ Q ++ +          A ++W +   +  +  A   
Sbjct  79   PCPC-PSTVGS---GMAQAVVPAMQCRVGVKA-------AAGRVWSAGRTRTGRGGA---  124

Query  266  TAKFRVFALQSGNS-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPV  442
            +  F+V A+ +G++  V R+EQLLN+D TPYT+K+IAEYIW+GGSGID RSKSRTISKPV
Sbjct  125  SPGFKVMAVSTGSTGVVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPV  184

Query  443  QHPSELPKWNYDG  481
            + PSELPKWNYDG
Sbjct  185  EDPSELPKWNYDG  197



>ref|XP_008662331.1| PREDICTED: glutamine synthetase, chloroplastic isoform X1 [Zea 
mays]
 gb|ACF83467.1| unknown [Zea mays]
 gb|ACN27769.1| unknown [Zea mays]
 gb|ACF86733.2| unknown [Zea mays]
 gb|AFW59720.1| glutamine synthetase1 isoform 1 [Zea mays]
 gb|AFW59721.1| glutamine synthetase1 isoform 2 [Zea mays]
Length=423

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 81/118 (69%), Gaps = 11/118 (9%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS-  307
            MAQ + P+ Q ++ +          A ++W +   +  +  A   +  F+V A+ +G++ 
Sbjct  1    MAQAVVPAMQCRVGVKA-------AAGRVWSAGRTRTGRGGA---SPGFKVMAVSTGSTG  50

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             V R+EQLLN+D TPYT+K+IAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  51   VVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDG  108



>ref|NP_001105725.1| glutamine synthetase, chloroplastic precursor [Zea mays]
 sp|P25462.1|GLNAC_MAIZE RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Zea mays]
 emb|CAA46724.1| glutamine synthetase [Zea mays]
Length=423

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 81/118 (69%), Gaps = 11/118 (9%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS-  307
            MAQ + P+ Q ++ +          A ++W +   +  +  A   +  F+V A+ +G++ 
Sbjct  1    MAQAVVPAMQCRVGVKA-------AAGRVWSAGRTRTGRGGA---SPGFKVMAVSTGSTG  50

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             V R+EQLLN+D TPYT+K+IAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  51   VVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDG  108



>prf||1804333C Gln synthetase
Length=430

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  310
            MAQILA S   QMR+ K+ +     +SK+W SVV+K  K+ +      FRV ALQS N +
Sbjct  1    MAQILAASPTCQMRVPKH-SSVIASSSKLWSSVVLK-QKKQSNNKVRGFRVLALQSDNMS  58

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +   E LLN+   P  ++IIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  59   LLADEVLLNISDNPEKDRIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDG  115



>gb|AAL87183.1|AF480497_11 putative precursor chloroplastic glutamine synthetase [Oryza 
sativa Japonica Group]
Length=451

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 79/120 (66%), Gaps = 10/120 (8%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKM--WGSVVMKPNKRVAVKSTAKFRVFALQSGN  304
            MAQ + P+ Q Q+   +    A   A+    WG        R   + T+ FRV A+ +  
Sbjct  1    MAQAVVPAMQCQVGAVRARPAAAAAAAGGRVWGV-------RRTGRGTSGFRVMAVSTET  53

Query  305  S-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  V R+EQLLN+D TP+T+KIIAEYIW+GG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   TGVVTRMEQLLNMDTTPFTDKIIAEYIWVGGTGIDLRSKSRTISKPVEDPSELPKWNYDG  113



>emb|CAA34131.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=426

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 8/93 (9%)
 Frame = +2

Query  206  ASKMWGSVVMKPNKRVAVKSTAKFRVFALQ-SGNSTVNRIEQLLNLDVTPYTNKIIAEYI  382
            A ++WG        R A ++T+ F+V AL       + R++QLL++D TP+T+KIIAEYI
Sbjct  26   AGRVWGV-------RRAARATSGFKVLALGPETTGVIQRMQQLLDMDTTPFTDKIIAEYI  78

Query  383  WIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            W+GGSGID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  79   WVGGSGIDLRSKSRTISKPVEDPSELPKWNYDG  111



>dbj|BAG88835.1| unnamed protein product [Oryza sativa Japonica Group]
Length=322

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 79/120 (66%), Gaps = 10/120 (8%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKM--WGSVVMKPNKRVAVKSTAKFRVFALQSGN  304
            MAQ + P+ Q Q+   +    A   A+    WG        R   + T+ FRV A+ +  
Sbjct  1    MAQAVVPAMQCQVGAVRARPAAAAAAAGGRVWGV-------RRTGRGTSGFRVMAVSTET  53

Query  305  S-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  V R+EQLLN+D TP+T+KIIAEYIW+GG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   TGVVTRMEQLLNMDTTPFTDKIIAEYIWVGGTGIDLRSKSRTISKPVEDPSELPKWNYDG  113



>ref|NP_001054133.1| Os04g0659100 [Oryza sativa Japonica Group]
 sp|P14655.1|GLNA2_ORYSJ RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=Glutamate--ammonia 
ligase; AltName: Full=OsGS2; Short=GS2; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAA32462.1| unnamed protein product [Oryza sativa]
 emb|CAE02885.2| OSJNBa0015K02.2 [Oryza sativa Japonica Group]
 emb|CAE54574.1| OSJNBa0011F23.15 [Oryza sativa Japonica Group]
 dbj|BAF16047.1| Os04g0659100 [Oryza sativa Japonica Group]
 emb|CAH67797.1| OSIGBa0132E09-OSIGBa0108L24.11 [Oryza sativa Indica Group]
 gb|EEC78171.1| hypothetical protein OsI_17756 [Oryza sativa Indica Group]
 gb|EEE61834.1| hypothetical protein OsJ_16481 [Oryza sativa Japonica Group]
Length=428

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 79/120 (66%), Gaps = 10/120 (8%)
 Frame = +2

Query  131  MAQILAPSAQWQMRMTKNLTEATPMASKM--WGSVVMKPNKRVAVKSTAKFRVFALQSGN  304
            MAQ + P+ Q Q+   +    A   A+    WG        R   + T+ FRV A+ +  
Sbjct  1    MAQAVVPAMQCQVGAVRARPAAAAAAAGGRVWGV-------RRTGRGTSGFRVMAVSTET  53

Query  305  S-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  V R+EQLLN+D TP+T+KIIAEYIW+GG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   TGVVTRMEQLLNMDTTPFTDKIIAEYIWVGGTGIDLRSKSRTISKPVEDPSELPKWNYDG  113



>dbj|BAD12057.1| plastidic glutamine synthetase [Phragmites australis]
 dbj|BAD12058.1| plastidic glutamine synthetase [Phragmites australis]
Length=429

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 82/121 (68%), Gaps = 11/121 (9%)
 Frame = +2

Query  131  MAQILAPSAQWQMRM-TKNLTEATPMAS--KMWGSVVMKPNKRVAVKSTAKFRVFALQSG  301
            MAQ + P+ Q Q+    K    A P  +  ++WG       KR   + T+ F+V A+ + 
Sbjct  1    MAQPVVPAMQCQVGARGKAAVRARPAGAGGRVWGV------KRSG-RGTSGFKVMAVSTE  53

Query  302  NS-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  478
            ++  V R+EQLLN+D  P+T+KIIAEYIW+GGSGID RSKSRT+SKPV+ PSELPKWNYD
Sbjct  54   STGVVPRLEQLLNMDTKPFTDKIIAEYIWVGGSGIDLRSKSRTLSKPVEDPSELPKWNYD  113

Query  479  G  481
            G
Sbjct  114  G  114



>dbj|BAD12059.1| plastidic glutamine synthetase [Phragmites australis]
Length=429

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 79/121 (65%), Gaps = 11/121 (9%)
 Frame = +2

Query  131  MAQILAPSAQWQMRM---TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFAL-QS  298
            MAQ + P+ Q Q+ +    +    A     ++WG        R + + T+ F+V A+  S
Sbjct  1    MAQAVVPAMQCQVGVKAAVRARPAAAGAGGRVWGV-------RRSGRGTSGFKVMAMGMS  53

Query  299  GNSTVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  478
             +  V R+EQLLN+D  PYT+ IIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYD
Sbjct  54   TSGVVPRLEQLLNMDTKPYTDNIIAEYIWVGGSGIDVRSKSRTISKPVEDPSELPKWNYD  113

Query  479  G  481
            G
Sbjct  114  G  114



>sp|P13564.2|GLNA2_HORVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Hordeum vulgare]
 emb|CAA37643.1| unnamed protein product [Hordeum vulgare]
Length=434

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 68/88 (77%), Gaps = 6/88 (7%)
 Frame = +2

Query  236  KPNKRV-----AVKSTAKFRVFALQSGNSTV-NRIEQLLNLDVTPYTNKIIAEYIWIGGS  397
            +P  RV     A ++T+ F+V AL    + V  R++QLL++D TP+T+KIIAEYIW+GGS
Sbjct  32   QPAGRVWGVSRAARATSGFKVLALGPETTGVIQRMQQLLDMDTTPFTDKIIAEYIWVGGS  91

Query  398  GIDTRSKSRTISKPVQHPSELPKWNYDG  481
            GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  92   GIDLRSKSRTISKPVEDPSELPKWNYDG  119



>gb|EPS57543.1| glutamine synthetase, partial [Genlisea aurea]
Length=222

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            VNR+++LLN D+TPYT+ IIAEYIWIGGSGID RSKSRTISKPVQHPSELPKWNYDG
Sbjct  1    VNRLDKLLNSDLTPYTDNIIAEYIWIGGSGIDIRSKSRTISKPVQHPSELPKWNYDG  57



>gb|EMS53309.1| Glutamine synthetase leaf isozyme, chloroplastic [Triticum urartu]
Length=535

 Score =   110 bits (276),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 53/93 (57%), Positives = 69/93 (74%), Gaps = 8/93 (9%)
 Frame = +2

Query  206  ASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS-TVNRIEQLLNLDVTPYTNKIIAEYI  382
            A ++WG        R   ++T+ F+V AL    +  + R++QLL++D TP+T+KIIAEYI
Sbjct  19   AGRVWGV-------RRTARATSGFKVLALGPETTGVIQRMQQLLDMDTTPFTDKIIAEYI  71

Query  383  WIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            W+GGSGID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  72   WVGGSGIDLRSKSRTISKPVEDPSELPKWNYDG  104



>emb|CAA29057.1| gluthamine synthetase [Pisum sativum]
Length=373

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            T+NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV HPSE+PKWNYDG
Sbjct  1    TINRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVSHPSEVPKWNYDG  58



>gb|ACG35376.1| glutamine synthetase [Zea mays]
Length=427

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +2

Query  260  KSTAKFRVFALQSGNS-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISK  436
            +  A  +   L +G++  V R+EQLLN+D TPYT+K+IAEYIW+GGSGID RSKSRTISK
Sbjct  38   RRLAGVQGHGLSTGSTGVVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISK  97

Query  437  PVQHPSELPKWNYDG  481
            PV+ PSELPKWNYDG
Sbjct  98   PVEDPSELPKWNYDG  112



>gb|ACG31728.1| hypothetical protein [Zea mays]
Length=382

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 1/67 (1%)
 Frame = +2

Query  284  FALQSGNS-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSEL  460
             A+ +G++  V R+EQLLN+D TPYT+K+IAEYIW+GGSGID RSKSRTISKPV+ PSEL
Sbjct  1    MAVSTGSTGXVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSEL  60

Query  461  PKWNYDG  481
            PKWNYDG
Sbjct  61   PKWNYDG  67



>ref|XP_006653841.1| PREDICTED: LOW QUALITY PROTEIN: glutamine synthetase, chloroplastic-like 
[Oryza brachyantha]
Length=410

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            V R+EQLLN+D  PYT+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  39   VTRLEQLLNMDTKPYTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDG  95



>gb|AHJ10962.1| chloroplast glutamine synthetase 2 isoform 2 [Lemna minor]
Length=424

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = +2

Query  134  AQILAPSAQWQMRMTKNLTEA-TPMASKMWGSVVMKPNKRVAVKSTAKFRVFA-LQSGNS  307
            AQI APS + +  +    + A  P+     GS   +    V  +    F V A L + N+
Sbjct  3    AQIPAPSLRCERSIAIRPSLARNPLMLAQRGSPASRKGGPVRYRG---FSVRAVLGNRNN  59

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             V+R+E LLNLD+ P+T KIIAEYIWIGGSGID RSKSRTIS+PV  PSELPKWNYDG
Sbjct  60   AVSRLEDLLNLDLNPHTEKIIAEYIWIGGSGIDVRSKSRTISRPVDDPSELPKWNYDG  117



>gb|AHJ10961.1| chloroplast glutamine synthetase 2 isoform 1 [Lemna minor]
Length=424

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = +2

Query  134  AQILAPSAQWQMRMTKNLTEA-TPMASKMWGSVVMKPNKRVAVKSTAKFRVFA-LQSGNS  307
            AQI APS + +  +    + A  P+     GS   +    V  +    F V A L + N+
Sbjct  3    AQIPAPSLRCERSIAIRPSLARNPLMLAQRGSPASRKGGPVRYRG---FSVRAVLGNRNN  59

Query  308  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             V+R+E LLNLD+ P+T KIIAEYIWIGGSGID RSKSRTIS+PV  PSELPKWNYDG
Sbjct  60   AVSRLEDLLNLDLNPHTEKIIAEYIWIGGSGIDVRSKSRTISRPVDDPSELPKWNYDG  117



>emb|CDY49656.1| BnaC09g41340D [Brassica napus]
Length=356

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD++ YT KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDG
Sbjct  1    MSALADLINLDLSDYTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDG  57



>gb|AFW89160.1| glutamine synthetase3 isoform 1 [Zea mays]
 gb|AFW89161.1| glutamine synthetase3 isoform 2 [Zea mays]
Length=88

 Score = 84.0 bits (206),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T++IIAEYIW+GGSGID RSK+RT+  P+  PS+LPKWNYDG
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWVGGSGIDLRSKARTVKGPITDPSQLPKWNYDG  57



>gb|KFK25875.1| hypothetical protein AALP_AA8G173600 [Arabis alpina]
Length=356

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD++  TN+IIAEYIWIGGSGID RSK+RT++ PV+ PSELPKWNYDG
Sbjct  1    MSALADLINLDLSDSTNQIIAEYIWIGGSGIDMRSKARTLAGPVKDPSELPKWNYDG  57



>gb|AAP33476.1| cytosolic glutamine synthetase [Securigera parviflora]
Length=98

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDG
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDG  57



>gb|EYU24513.1| hypothetical protein MIMGU_mgv1a008973mg [Erythranthe guttata]
Length=356

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T K IAEYIWIGGSG+D RSK+RT S P++HPSELPKWNYDG
Sbjct  4    LSDLINLDLSDTTEKTIAEYIWIGGSGMDLRSKARTFSGPIKHPSELPKWNYDG  57



>ref|XP_010492570.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like isoform 
X2 [Camelina sativa]
Length=272

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDG
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDG  57



>ref|XP_010420355.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 isoform 
X2 [Camelina sativa]
Length=355

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDG
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDG  57



>sp|P23712.2|GLNA_LACSA RecName: Full=Glutamine synthetase; AltName: Full=GS(1); AltName: 
Full=Glutamate--ammonia ligase [Lactuca sativa]
 emb|CAA42689.1| glutamine synthetase [Lactuca sativa]
Length=358

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PSELPKWNYDG
Sbjct  4    LSDLVNLDLSSITDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSELPKWNYDG  57



>ref|XP_010492569.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like isoform 
X1 [Camelina sativa]
Length=356

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDG
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDG  57



>ref|XP_010420354.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 isoform 
X1 [Camelina sativa]
Length=356

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDG
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDG  57



>ref|XP_010453820.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like [Camelina 
sativa]
Length=356

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDG
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDG  57



>ref|XP_006288043.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
 gb|EOA20941.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
Length=356

 Score = 85.9 bits (211),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDG
Sbjct  4    LADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDG  57



>ref|XP_006360384.1| PREDICTED: glutamine synthetase nodule isozyme-like [Solanum 
tuberosum]
Length=356

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            I  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDG
Sbjct  4    ISDLINLNLSECTKKIIAEYIWIGGSGMDLRSKARTLSGPVKDPSELPKWNYDG  57



>ref|XP_004162638.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
sativus]
Length=356

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD+  +T+KIIAEYIW+GGSG D RSK+RTIS P+  PS+LPKWNYDG
Sbjct  1    MSSLSDLINLDLCDFTDKIIAEYIWVGGSGKDVRSKARTISGPISDPSKLPKWNYDG  57



>gb|KGN51032.1| Glutamine synthetase [Cucumis sativus]
Length=356

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD+  +T+KIIAEYIW+GGSG D RSK+RTIS P+  PS+LPKWNYDG
Sbjct  1    MSSLSDLINLDLCDFTDKIIAEYIWVGGSGKDVRSKARTISGPISDPSKLPKWNYDG  57



>gb|AHJ10959.1| cytosolic glutamine synthetase 1 isoform 1 [Lemna minor]
Length=356

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L NL++T  T KIIAEYIWIGGSG+D RSK+RTISKPV  P ELPKWNYDG
Sbjct  4    LADLQNLNLTETTEKIIAEYIWIGGSGLDMRSKARTISKPVSDPKELPKWNYDG  57



>gb|AHJ10960.1| cytosolic glutamine synthetase 1 isoform 2 [Lemna minor]
Length=356

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L NL++T  T KIIAEYIWIGGSG+D RSK+RTISKPV  P ELPKWNYDG
Sbjct  4    LTDLQNLNLTETTEKIIAEYIWIGGSGLDMRSKARTISKPVSDPKELPKWNYDG  57



>ref|XP_004140309.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
sativus]
Length=368

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD+  +T+KIIAEYIW+GGSG D RSK+RTIS P+  PS+LPKWNYDG
Sbjct  1    MSSLSDLINLDLCDFTDKIIAEYIWVGGSGKDVRSKARTISGPISDPSKLPKWNYDG  57



>ref|XP_009121474.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 [Brassica 
rapa]
Length=356

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDG
Sbjct  1    MSALADLINLDLSDSTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDG  57



>emb|CDX69442.1| BnaA10g17910D [Brassica napus]
Length=356

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDG
Sbjct  4    LADLINLDLSDSTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDG  57



>ref|XP_004240034.1| PREDICTED: glutamine synthetase-like [Solanum lycopersicum]
Length=356

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            I  L+NL+++  T KIIAEYIWIGGSG D RSK+RT+S PV+ PSELPKWNYDG
Sbjct  4    ISDLINLNLSECTKKIIAEYIWIGGSGTDLRSKARTLSGPVKDPSELPKWNYDG  57



>ref|XP_002873784.1| GLN1_4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50043.1| GLN1_4 [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDG
Sbjct  1    MSSLADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDG  57



>ref|XP_010435596.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like isoform 
X2 [Camelina sativa]
Length=276

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+S PV+ PSELPKWNYDG
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGPVKDPSELPKWNYDG  57



>ref|XP_009629012.1| PREDICTED: glutamine synthetase-like [Nicotiana tomentosiformis]
Length=356

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL++T  T KIIAEYIWIGGSG+D RSK+RT+S PV+ PS+LPKWNYDG
Sbjct  4    LSDLINLNLTESTEKIIAEYIWIGGSGMDLRSKARTLSGPVKDPSQLPKWNYDG  57



>ref|XP_010440874.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Camelina 
sativa]
Length=356

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+S PV+ PSELPKWNYDG
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGPVKDPSELPKWNYDG  57



>ref|XP_010435595.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like isoform 
X1 [Camelina sativa]
Length=356

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+S PV+ PSELPKWNYDG
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGPVKDPSELPKWNYDG  57



>ref|XP_010419001.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like, partial 
[Camelina sativa]
Length=163

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDG  57



>ref|XP_002465624.1| hypothetical protein SORBIDRAFT_01g042450 [Sorghum bicolor]
 emb|CAQ86599.1| glutamine synthetase [Sorghum bicolor]
 gb|EER92622.1| hypothetical protein SORBIDRAFT_01g042450 [Sorghum bicolor]
Length=357

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T+KIIAEYIWIGGSGID RSK+RT+  P+  PS+LPKWNYDG
Sbjct  4    LTDLVNLDLSDCTDKIIAEYIWIGGSGIDLRSKARTVKGPITDPSQLPKWNYDG  57



>gb|AAW21274.1| glutamine synthetase [Saccharum officinarum]
Length=357

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T+KIIAEYIWIGGSGID RSK+RT+  P+  PS+LPKWNYDG
Sbjct  4    LTDLVNLDLSDCTDKIIAEYIWIGGSGIDLRSKARTVKGPITDPSQLPKWNYDG  57



>gb|ABK21449.1| unknown [Picea sitchensis]
 gb|ABK23372.1| unknown [Picea sitchensis]
Length=357

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  LLNLD++  T K+IAEYIWIGGSG+D RSK+R++S PV  P ELPKWNYDG
Sbjct  5    LADLLNLDLSDVTEKVIAEYIWIGGSGMDMRSKARSLSGPVSSPKELPKWNYDG  58



>emb|CDY38104.1| BnaC02g06690D [Brassica napus]
Length=356

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD++  + KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDG
Sbjct  1    MSALADLINLDLSDSSEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDG  57



>gb|AGC24244.1| glutamine synthetase 1, partial [Brassica napus]
Length=137

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  341  DVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            D++ YT KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDG
Sbjct  4    DLSDYTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDG  50



>ref|XP_009126124.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like [Brassica 
rapa]
Length=356

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD++  + KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDG
Sbjct  1    MSALADLINLDLSDSSEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDG  57



>gb|AGC24239.1| glutamine synthetase 1 [Brassica napus]
 emb|CDX85499.1| BnaA02g03140D [Brassica napus]
Length=356

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD++  + KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDG
Sbjct  1    MSALADLINLDLSDSSEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDG  57



>ref|XP_009800983.1| PREDICTED: glutamine synthetase-like [Nicotiana sylvestris]
Length=356

 Score = 83.2 bits (204),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL++T  T+KIIAEYIWIGGSG+D RSK+R++S PV+ PS+LPKWNYDG
Sbjct  4    LSDLINLNLTESTDKIIAEYIWIGGSGMDLRSKARSLSGPVEDPSKLPKWNYDG  57



>sp|P38563.2|GLNA5_MAIZE RecName: Full=Glutamine synthetase root isozyme 5; AltName: Full=GS117; 
AltName: Full=Glutamate--ammonia ligase [Zea mays]
Length=357

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T+KIIAEYIW+GGSGID RSK+RT+  P+  PS+LPKWNYDG
Sbjct  4    LTDLVNLDLSDCTDKIIAEYIWVGGSGIDLRSKARTVKGPITDPSQLPKWNYDG  57



>ref|XP_009785976.1| PREDICTED: glutamine synthetase isoform X1 [Nicotiana sylvestris]
Length=356

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PSELPKWNYDG
Sbjct  4    LSDLINLNLSDSTQKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSELPKWNYDG  57



>sp|O04867.1|GLNA1_ALNGL RecName: Full=Glutamine synthetase; AltName: Full=GS(1); AltName: 
Full=Glutamate--ammonia ligase [Alnus glutinosa]
 emb|CAA69937.1| glutamate synthetase [Alnus glutinosa]
Length=356

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+K+IAEYIWIGGSG D RSK+RT++ PV HPS+LPKWNYDG
Sbjct  4    LSDLINLNLSDATDKVIAEYIWIGGSGTDLRSKARTLTGPVNHPSKLPKWNYDG  57



>gb|ACN36710.1| unknown [Zea mays]
Length=217

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T++IIAEYIWIGG+GID RSK+RT+  P+  PS+LPKWNYDG
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDG  57



>ref|XP_009785977.1| PREDICTED: glutamine synthetase isoform X2 [Nicotiana sylvestris]
Length=356

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PSELPKWNYDG
Sbjct  4    LSDLINLNLSDSTQKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSELPKWNYDG  57



>gb|AFK46766.1| unknown [Medicago truncatula]
Length=211

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  4    LSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDG  57



>tpg|DAA44141.1| TPA: glutamine synthetase6 [Zea mays]
Length=363

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  302  NSTVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             S +  +  L+NLD++  T++IIAEYIWIGG+GID RSK+RT+  P+  PS+LPKWNYDG
Sbjct  4    GSVMASLTDLVNLDLSDCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDG  63



>dbj|BAA04995.1| glutamine synthetase [Raphanus sativus]
Length=356

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LTDLINLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSQLPKWNYDG  57



>ref|XP_011001555.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-like [Populus 
euphratica]
Length=356

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK RT+S PV  PS+LPKWNYDG
Sbjct  4    LSDLINLDLSDSTEKIIAEYIWVGGSGMDIRSKGRTLSGPVSDPSKLPKWNYDG  57



>gb|AAR86718.1| glutamine synthetase GS56 [Nicotiana attenuata]
Length=356

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  317  RIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RTIS PV  PS+LPKWNYDG
Sbjct  3    HLSDLVNLNLSDSTQKIIAEYIWIGGSGMDVRSKARTISGPVDDPSKLPKWNYDG  57



>emb|CCO25538.1| glutamine synthetase [Pinus pinaster]
Length=355

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+S PV  P +LPKWNYDG
Sbjct  4    LTDLINLDLSDVTEKIIAEYIWIGGSGMDIRSKARTLSHPVTDPKDLPKWNYDG  57



>gb|AAW21275.1| glutamine synthetase [Saccharum officinarum]
Length=367

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWN+DG
Sbjct  4    LSDLINLDLSDCTEKIIAEYIWVGGSGMDVRSKARTLSGPVDDPSKLPKWNFDG  57



>gb|AGT16433.1| glutamine synthetase [Saccharum hybrid cultivar R570]
Length=367

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWN+DG
Sbjct  4    LSDLINLDLSDCTEKIIAEYIWVGGSGMDVRSKARTLSGPVDDPSKLPKWNFDG  57



>ref|XP_008460506.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
melo]
Length=356

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NL++  +T+KIIAEYIW+GGSG D RSK+RTIS P   PS+LPKWNYDG
Sbjct  1    MSSLSDLINLNLCDFTDKIIAEYIWVGGSGTDVRSKARTISGPTSDPSKLPKWNYDG  57



>ref|XP_009385541.1| PREDICTED: glutamine synthetase nodule isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=356

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  4    LTDLINLDLSETTDKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDG  57



>gb|AAP33167.1| cytosolic glutamine synthetase [Securigera parviflora]
Length=356

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDG
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDG  57



>ref|XP_010415164.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X3 [Camelina sativa]
Length=276

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDG  57



>ref|XP_010470494.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X2 [Camelina sativa]
Length=275

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDG  57



>gb|ACG47508.1| glutamine synthetase root isozyme 5 [Zea mays]
Length=357

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T++IIAEYIW+GGSGID RSK+RT+  P+  PS+LPKWNYDG
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWVGGSGIDLRSKARTVKGPITDPSQLPKWNYDG  57



>ref|XP_009370058.1| PREDICTED: glutamine synthetase cytosolic isozyme-like [Pyrus 
x bretschneideri]
Length=356

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  4    VSDLINLDLSDSTKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDG  57



>gb|KJB10479.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
Length=309

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG  57



>sp|P08282.2|GLNA1_PEA RecName: Full=Glutamine synthetase nodule isozyme; AltName: Full=Cytosolic 
GS1; AltName: Full=Glutamate--ammonia ligase [Pisum 
sativum]
 gb|AAA33669.1| glutamine synthetase (cytosolic GS1) (EC 6.3.1.2) [Pisum sativum]
Length=355

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIWIGGSG+D R K+RT+  PV  PSELPKWNYDG
Sbjct  3    LSDLINLDLSGTTEKIIAEYIWIGGSGLDLRCKARTLPGPVTDPSELPKWNYDG  56



>emb|CAJ87510.1| putative glutamine synthetase [Pisum sativum]
Length=356

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIWIGGSG+D R K+RT+  PV  PSELPKWNYDG
Sbjct  4    LSDLINLDLSGTTEKIIAEYIWIGGSGLDLRCKARTLPGPVTDPSELPKWNYDG  57



>ref|XP_009338856.1| PREDICTED: glutamine synthetase cytosolic isozyme-like [Pyrus 
x bretschneideri]
Length=356

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  4    VSDLINLDLSDSTKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDG  57



>ref|NP_001105443.1| glutamine synthetase root isozyme 2 [Zea mays]
 sp|P38560.1|GLNA2_MAIZE RecName: Full=Glutamine synthetase root isozyme 2; AltName: Full=Glutamate--ammonia 
ligase [Zea mays]
 emb|CAA46720.1| glutamine synthetase [Zea mays]
Length=368

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWN+DG
Sbjct  4    LSDLINLDLSGRTGKIIAEYIWVGGSGMDVRSKARTLSGPVDDPSKLPKWNFDG  57



>ref|NP_001105297.1| glutamine synthetase root isozyme 5 [Zea mays]
 dbj|BAA03432.1| glutamine synthetase [Zea mays]
Length=357

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T++IIAEYIW+GGSGID RSK+RT+  P+  PS+LPKWNYDG
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWVGGSGIDLRSKARTVKGPITDPSQLPKWNYDG  57



>gb|KJB10478.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
 gb|KJB10480.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
Length=259

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG  57



>gb|AFW90613.1| glutamine synthetase GS1 [Solanum tuberosum]
Length=256

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  317  RIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             +  L+NL+++  ++KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  3    HLSDLVNLNLSDSSDKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDG  57



>gb|ACL54769.1| unknown [Zea mays]
 tpg|DAA51000.1| TPA: glutamine synthetase2 [Zea mays]
Length=369

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWN+DG
Sbjct  4    LSDLINLDLSGRTGKIIAEYIWVGGSGMDVRSKARTLSGPVDDPSKLPKWNFDG  57



>gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LSDLINLNLSDTTDKIIAEYIWIGGSGMDMRSKARTLSGPVSDPSKLPKWNYDG  57



>sp|P04078.1|GLNA1_MEDSA RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=Glutamate--ammonia ligase [Medicago sativa]
 emb|CAA27570.1| glutamine synthetase [Medicago sativa]
 prf||1211328A synthetase,Gln
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  4    LSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDG  57



>emb|CAA71317.1| glutamine synthetase [Medicago truncatula]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  4    LSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDG  57



>gb|ACF78695.1| unknown [Zea mays]
 tpg|DAA50999.1| TPA: glutamine synthetase2 [Zea mays]
Length=363

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWN+DG
Sbjct  4    LSDLINLDLSGRTGKIIAEYIWVGGSGMDVRSKARTLSGPVDDPSKLPKWNFDG  57



>gb|KDP25795.1| hypothetical protein JCGZ_22517 [Jatropha curcas]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG  57



>ref|XP_003600702.1| Glutamine synthetase [Medicago truncatula]
 gb|AES70953.1| glutamine synthetase domain protein [Medicago truncatula]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  4    LSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDG  57



>ref|XP_010511548.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2 [Camelina 
sativa]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDG  57



>ref|XP_010415162.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X1 [Camelina sativa]
 ref|XP_010415163.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X2 [Camelina sativa]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDG  57



>emb|CAG27625.1| putative glutamine synthetase [Populus x canadensis]
Length=72

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+N++++  T KIIAEYIWIGGSG+D RSK+RT+  PV  P++LPKWNYDG
Sbjct  4    LNDLININLSDTTEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPAKLPKWNYDG  57



>ref|XP_004288594.1| PREDICTED: glutamine synthetase nodule isozyme [Fragaria vesca 
subsp. vesca]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  4    LTDLINLDLSDSTDKIIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDG  57



>ref|NP_568335.1| glutamine synthetase 1;4 [Arabidopsis thaliana]
 sp|Q9FMD9.1|GLN14_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-4; AltName: 
Full=Glutamate--ammonia ligase GLN1;4; Short=GLN1;4 [Arabidopsis 
thaliana]
 dbj|BAB10184.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAL24414.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAM91149.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED92312.1| glutamine synthetase 1;4 [Arabidopsis thaliana]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  1    MSSLADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLPGPVTDPSQLPKWNYDG  57



>ref|XP_010470493.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X1 [Camelina sativa]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDG  57



>ref|XP_003544980.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Glycine 
max]
 sp|O82560.1|GLNA2_SOYBN RecName: Full=Glutamine synthetase cytosolic isozyme 2; AltName: 
Full=GS1-2; AltName: Full=Glutamate--ammonia ligase [Glycine 
max]
 gb|AAC97935.1| nodule-specific glutamine synthetase [Glycine max]
 gb|KHN39471.1| Glutamine synthetase cytosolic isozyme 2 [Glycine soja]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+K+IAEYIW+GGSG+D RSK+RT+S PV+ PS+LPKWNYDG
Sbjct  4    LSDLINLNLSDITDKVIAEYIWVGGSGMDMRSKARTLSGPVKDPSKLPKWNYDG  57



>ref|XP_004981993.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-3-like [Setaria 
italica]
Length=367

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWN+DG
Sbjct  4    LTDLVNLDLSDCTEKIIAEYIWVGGSGMDVRSKARTLSGPVDDPSKLPKWNFDG  57



>ref|XP_006300523.1| hypothetical protein CARUB_v10020543mg [Capsella rubella]
 gb|EOA33421.1| hypothetical protein CARUB_v10020543mg [Capsella rubella]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDG  57



>gb|ABW89464.1| glutamine synthetase [Gossypium hirsutum]
 gb|ABW89465.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG  57



>sp|P04770.1|GLNA1_PHAVU RecName: Full=Glutamine synthetase PR-1; AltName: Full=Gln isozyme 
beta; AltName: Full=Glutamate--ammonia ligase [Phaseolus 
vulgaris]
 emb|CAA27631.1| unnamed protein product [Phaseolus vulgaris]
 prf||1208270A synthetase R1,Gln
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T K+IAEYIWIGGSG+D RSK+RT+  PV++PSELPKWNYDG
Sbjct  4    LSDLINLNLSDTTEKVIAEYIWIGGSGLDLRSKARTLPGPVKNPSELPKWNYDG  57



>gb|ABW89460.1| glutamine synthetase [Gossypium herbaceum]
 gb|ABW89466.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG  57



>ref|XP_006400196.1| hypothetical protein EUTSA_v10013948mg [Eutrema salsugineum]
 dbj|BAJ34289.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41649.1| hypothetical protein EUTSA_v10013948mg [Eutrema salsugineum]
Length=356

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T +IIAEYIW+GGSG+D RSK+RT+  PV+ PSELPKWNYDG
Sbjct  4    LADLINLDLSNSTKQIIAEYIWVGGSGLDMRSKARTLPGPVKDPSELPKWNYDG  57



>ref|XP_010551131.1| PREDICTED: glutamine synthetase nodule isozyme-like [Tarenaya 
hassleriana]
Length=357

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T+K+IAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  5    LSDLINLDLSGSTDKLIAEYIWIGGSGMDIRSKARTLHGPVSDPSKLPKWNYDG  58



>gb|ABW89463.1| glutamine synthetase [Gossypium raimondii]
 gb|KJB10477.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
Length=356

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG  57



>tpg|DAA44139.1| TPA: glutamine synthetase6 [Zea mays]
Length=362

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T++IIAEYIWIGG+GID RSK+RT+  P+  PS+LPKWNYDG
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDG  57



>gb|KHG00636.1| Glutamine synthetase cytosolic isozyme 1 [Gossypium arboreum]
Length=356

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG  57



>ref|NP_001105538.1| glutamine synthetase root isozyme 1 [Zea mays]
 dbj|BAA03433.1| glutamine synthetase [Zea mays]
 gb|ACF84604.1| unknown [Zea mays]
 tpg|DAA44140.1| TPA: glutamine synthetase6 [Zea mays]
Length=357

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T++IIAEYIWIGG+GID RSK+RT+  P+  PS+LPKWNYDG
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDG  57



>sp|P14636.1|GLNA3_LUPAN RecName: Full=Glutamine synthetase nodule isozyme; AltName: Full=Glutamate--ammonia 
ligase, partial [Lupinus angustifolius]
 emb|CAA33605.1| unnamed protein product [Lupinus angustifolius]
Length=315

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LSDLINLNLSDTTEKIIAEYIWVGGSGVDLRSKARTLSGPVNDPSKLPKWNYDG  57



>gb|ABW89461.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG  57



>emb|CAA65173.1| glutamine synthetase [Nicotiana tabacum]
Length=356

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  317  RIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  3    HLSDLVNLNLSDSTQKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDG  57



>gb|ABW89462.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG  57



>ref|XP_010940335.1| PREDICTED: glutamine synthetase nodule isozyme-like [Elaeis guineensis]
Length=356

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +E L+N++++  T KIIAEY+WIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LEDLVNINLSDTTEKIIAEYVWIGGSGMDMRSKARTLSGPVSDPSKLPKWNYDG  57



>ref|XP_009614064.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Nicotiana 
tomentosiformis]
Length=356

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  317  RIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  3    HLSDLVNLNLSDSTQKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDG  57



>gb|AGI78873.1| glutamine synthetase [Vigna unguiculata]
 gb|AGI78874.1| glutamine synthetase [Vigna unguiculata]
 gb|AGI78875.1| glutamine synthetase [Vigna unguiculata]
Length=356

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDG
Sbjct  4    LSDLINLNLSDTTEKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDG  57



>gb|AGG19203.1| glutamine synthetase [Vigna unguiculata]
Length=360

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDG
Sbjct  4    LSDLINLNLSDTTEKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDG  57



>gb|AAT46062.1| glutamine synthetase GS2 [Apium graveolens Dulce Group]
Length=150

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +2

Query  365  IIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             IAEYIWIGG+G+D RSKSRTISKPV+HPSELPKWNYDG
Sbjct  5    FIAEYIWIGGTGVDVRSKSRTISKPVEHPSELPKWNYDG  43



>sp|P52782.1|GLNA_LUPLU RecName: Full=Glutamine synthetase nodule isozyme; Short=GS; 
AltName: Full=Glutamate--ammonia ligase [Lupinus luteus]
 emb|CAA50522.1| glutamate-ammonia ligase [Lupinus luteus]
 prf||2004276A Gln synthetase
Length=353

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LSDLINLNLSDTTEKIIAEYIWVGGSGVDLRSKARTLSGPVNDPSKLPKWNYDG  57



>ref|XP_007032111.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma 
cacao]
 gb|EOY03037.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma 
cacao]
Length=356

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  4    LSDLVNLNLSDCTEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDG  57



>ref|XP_006284008.1| hypothetical protein CARUB_v10005130mg [Capsella rubella]
 gb|EOA16906.1| hypothetical protein CARUB_v10005130mg [Capsella rubella]
Length=356

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  311  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            ++ +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDG
Sbjct  1    MSNLSDLINLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSELPKWNYDG  57



>dbj|BAA04996.1| glutamine synthetase [Raphanus sativus]
Length=356

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDG
Sbjct  4    LTDLINLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDG  57



>ref|XP_009370554.1| PREDICTED: glutamine synthetase cytosolic isozyme isoform X1 
[Pyrus x bretschneideri]
Length=356

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  4    LTDLINLDLSESTKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDG  57



>ref|XP_007215605.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica]
 gb|EMJ16804.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica]
Length=356

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T K+IAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  4    LSDLINLDLSDSTEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDG  57



>ref|XP_009772493.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Nicotiana 
sylvestris]
Length=356

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  317  RIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
             +  L+NL ++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDG
Sbjct  3    HLSDLVNLSLSDSTQKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDG  57



>emb|CAA65174.1| glutamine synthetase [Nicotiana tabacum]
Length=356

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L++L+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PSELPKWNYDG
Sbjct  4    LSDLISLNLSDSTQKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSELPKWNYDG  57



>ref|XP_006647853.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Oryza 
brachyantha]
Length=356

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RTIS PV  PS+LPKWNYDG
Sbjct  4    LTDLVNLNLSDTTEKIIAEYIWIGGSGMDLRSKARTISGPVTDPSKLPKWNYDG  57



>ref|XP_008353857.1| PREDICTED: glutamine synthetase cytosolic isozyme [Malus domestica]
Length=356

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +2

Query  320  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  481
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDG
Sbjct  4    LTDLINLDLSGSTKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDG  57



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564765596140