BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF048F22

Length=398
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AEG78310.1|  ubiquitin                                               211   4e-67   Cucurbita pepo
dbj|BAK19068.1|  ubiquitin                                              209   1e-66   Ipomoea nil [qian niu]
gb|AGV54749.1|  ubiquitin 11                                            214   2e-66   Phaseolus vulgaris [French bean]
gb|ABH06365.1|  ubiquitin                                               209   2e-66   Sorbus aucuparia [European mountain ash]
gb|AAC39466.1|  polyubiquitin                                           209   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003619702.1|  Ubiquitin-like protein                             213   2e-66   
ref|XP_006495490.1|  PREDICTED: polyubiquitin 4-like                    208   3e-66   Citrus sinensis [apfelsine]
gb|AFU90137.2|  polyubiquitin                                           210   3e-66   Paeonia lactiflora [common garden peony]
dbj|BAA76429.1|  polyubiquitin                                          207   4e-66   Cicer arietinum [garbanzo]
dbj|BAJ61942.1|  ubiquitin                                              209   5e-66   Nymphaea hybrid cultivar
gb|ACA58351.1|  ubiquitin-like protein                                  210   5e-66   Sandersonia aurantiaca [Chinese-lantern lily]
gb|AHI85710.1|  stress-induced protein 5                                209   6e-66   Capsicum annuum
sp|P0CG83.1|UBIQP_HORVU  RecName: Full=Polyubiquitin; Contains: R...    209   6e-66   Hordeum vulgare [barley]
gb|ABI84246.1|  polyubiquitin 10                                        210   6e-66   Arachis hypogaea [goober]
gb|AGZ80457.1|  ubiquitin-like protein                                  207   6e-66   Phaseolus vulgaris [French bean]
gb|AIY85428.1|  ubiquitin                                               208   6e-66   Elaeagnus umbellata [aki-gumi]
emb|CBI22349.3|  unnamed protein product                                213   7e-66   Vitis vinifera
gb|ABR25718.1|  polyubiquitin containing 7 ubiquitin monomers           209   8e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_007693173.1|  hypothetical protein COCMIDRAFT_109160             209   8e-66   Bipolaris oryzae ATCC 44560
gb|AFJ04519.1|  ubiquitin                                               209   9e-66   Vernicia fordii [tung oil tree]
gb|AAZ32851.1|  pentameric polyubiquitin                                209   9e-66   Medicago sativa [alfalfa]
ref|XP_004501591.1|  PREDICTED: polyubiquitin 4-like                    208   9e-66   Cicer arietinum [garbanzo]
tpg|DAA44273.1|  TPA: Ubiquitin fusion protein                          210   1e-65   
gb|AAZ82816.1|  ubiquitin monomer protein                               208   1e-65   Morus mongolica [Mongolian mulberry]
gb|AFC36452.1|  ubiquitin                                               210   1e-65   Anoectochilus roxburghii
gb|KJB69253.1|  hypothetical protein B456_011G016600                    208   1e-65   Gossypium raimondii
ref|XP_009758989.1|  PREDICTED: polyubiquitin                           208   1e-65   Nicotiana sylvestris
ref|XP_010931828.1|  PREDICTED: polyubiquitin                           208   1e-65   
ref|XP_004976899.1|  PREDICTED: polyubiquitin 3-like                    208   1e-65   Setaria italica
gb|ABF06579.2|  polyubiquitin                                           208   1e-65   Gladiolus grandiflorus
ref|XP_008246113.1|  PREDICTED: polyubiquitin                           208   1e-65   Prunus mume [ume]
ref|XP_004497490.1|  PREDICTED: polyubiquitin 4-like                    208   1e-65   Cicer arietinum [garbanzo]
gb|KDP23292.1|  hypothetical protein JCGZ_23125                         208   1e-65   Jatropha curcas
ref|NP_001190681.1|  ubiquitin 11                                       208   1e-65   Arabidopsis thaliana [mouse-ear cress]
gb|AAL25813.1|  polyubiquitin                                           208   1e-65   Prunus avium [gean]
pir||PS0380  ubiquitin precursor - rice (fragment)                      209   1e-65
ref|XP_006495477.1|  PREDICTED: polyubiquitin 3-like                    208   1e-65   Citrus sinensis [apfelsine]
emb|CAD27944.1|  polyubiquitin-like                                     210   1e-65   Oryza sativa [red rice]
gb|KJB69254.1|  hypothetical protein B456_011G016600                    208   1e-65   Gossypium raimondii
gb|AFK46460.1|  unknown                                                 207   1e-65   Medicago truncatula
gb|AFW66442.1|  putative ubiquitin family protein                       209   1e-65   
gb|AAB86858.1|  polyubiquitin                                           207   2e-65   Schizophyllum commune
ref|XP_009420214.1|  PREDICTED: polyubiquitin                           207   2e-65   
gb|AAM78180.1|  putative polyubiquitin                                  209   2e-65   Gossypium herbaceum [Arabian cotton]
gb|ACZ69386.1|  polyubiquitin UBQ14                                     209   2e-65   Cucumis sativus [cucumbers]
gb|AEW46688.1|  polyubiquitin                                           209   2e-65   Ulva linza
gb|AFP44113.1|  ubiquitin                                               208   2e-65   Lycoris longituba
gb|AAF31707.1|AF221858_1  polyubiquitin                                 209   2e-65   Euphorbia esula [wolf's milk]
ref|XP_007154494.1|  hypothetical protein PHAVU_003G1236001g            208   2e-65   Phaseolus vulgaris [French bean]
gb|ABH08754.1|  ubiquitin                                               209   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   209   3e-65   Camelina sativa [gold-of-pleasure]
gb|ABH08753.1|  ubiquitin                                               209   3e-65   Arabidopsis thaliana [mouse-ear cress]
gb|EEC81189.1|  hypothetical protein OsI_24195                          209   3e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    216   3e-65   
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      209   3e-65   Setaria italica
gb|ABR25697.1|  polyubiquitin containing 7 ubiquitin monomers           208   3e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_002317213.1|  polyubiquitin family protein                       209   3e-65   Populus trichocarpa [western balsam poplar]
gb|AEZ49160.1|  polyubiquitin                                           211   3e-65   Wolffia australiana
gb|AAB36546.1|  polyubiquitin                                           209   3e-65   Phaseolus vulgaris [French bean]
gb|ABH08755.1|  ubiquitin                                               209   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             209   3e-65   Elaeis guineensis
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                209   3e-65   Erythranthe guttata [common monkey flower]
gb|AET06143.1|  ubiquitin                                               209   3e-65   Papaver somniferum
gb|KJB62484.1|  hypothetical protein B456_009G418900                    209   3e-65   Gossypium raimondii
gb|ACJ85618.1|  unknown                                                 209   3e-65   Medicago truncatula
ref|XP_009412006.1|  PREDICTED: polyubiquitin 11-like                   209   3e-65   
ref|XP_001731772.1|  hypothetical protein MGL_1040                      207   3e-65   Malassezia globosa CBS 7966
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    209   3e-65   
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          209   3e-65   Sorghum bicolor [broomcorn]
ref|XP_009388149.1|  PREDICTED: polyubiquitin-like                      206   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC57955.1|  polyubiquitin                                          209   3e-65   Tripolium pannonicum [sea starwort]
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             209   3e-65   
gb|AFK41706.1|  unknown                                                 209   3e-65   Medicago truncatula
ref|XP_002389222.1|  hypothetical protein MPER_11681                    207   3e-65   
gb|ACJ85643.1|  unknown                                                 209   3e-65   Medicago truncatula
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             209   3e-65   
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   209   3e-65   Citrus sinensis [apfelsine]
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   209   3e-65   Citrus sinensis [apfelsine]
gb|AAQ84316.1|  fiber polyubiquitin                                     209   3e-65   Gossypium barbadense [Egyptian cotton]
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             215   3e-65   Phaseolus vulgaris [French bean]
emb|CAH59739.1|  polyubiquitin                                          209   4e-65   Plantago major [cart-track plant]
gb|KJB36627.1|  hypothetical protein B456_006G167800                    209   4e-65   Gossypium raimondii
emb|CAI51312.2|  polyubiquitin                                          206   4e-65   Capsicum chinense [bonnet pepper]
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             209   4e-65   Citrus clementina [clementine]
gb|AAP31578.1|  ubiquitin                                               209   4e-65   Hevea brasiliensis [jebe]
ref|NP_567286.1|  ubiquitin 11                                          209   4e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             210   4e-65   Brachypodium distachyon [annual false brome]
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             209   4e-65   Citrus clementina [clementine]
gb|AFK43392.1|  unknown                                                 209   4e-65   Medicago truncatula
gb|AGA61761.1|  polyubuquitin 10                                        207   4e-65   Cornus kousa [kousa dogwood]
gb|ACT82769.1|  polyubiquitin                                           207   4e-65   Nicotiana tabacum [American tobacco]
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    210   4e-65   
gb|KIK16797.1|  hypothetical protein PISMIDRAFT_686019                  205   4e-65   Pisolithus microcarpus 441
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             209   4e-65   
gb|AIZ74335.1|  polyubiquitin 3                                         209   4e-65   Pinus massoniana [Chinese red pine]
gb|AAR32784.1|  polyubiquitin                                           209   5e-65   Clusia minor [cupey de monte]
gb|KGU26596.1|  polyubiquitin                                           205   5e-65   Candida albicans P34048
ref|XP_003626479.1|  Ubiquitin-like protein                             210   5e-65   
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                212   5e-65   
gb|AAM64530.1|  ubiquitin homolog                                       209   5e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             209   5e-65   Brachypodium distachyon [annual false brome]
gb|AAO43308.1|  putative polyubiquitin                                  209   6e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010938173.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    209   6e-65   
gb|AFJ93197.1|  ubiquitin                                               206   6e-65   Eremosparton songoricum
ref|XP_008809849.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    206   6e-65   Phoenix dactylifera
gb|ABH10622.2|  ubiquitin                                               206   7e-65   Nicotiana tabacum [American tobacco]
dbj|GAC77607.1|  ubiquitin and ubiquitin-like proteins                  208   7e-65   Moesziomyces antarcticus T-34
ref|XP_010069740.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    208   7e-65   Eucalyptus grandis [rose gum]
dbj|GAC94856.1|  ubiquitin                                              208   7e-65   Pseudozyma hubeiensis SY62
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             209   7e-65   
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    216   8e-65   
ref|XP_011390959.1|  putative polyubiquitin                             208   8e-65   Ustilago maydis 521
gb|AAO43307.1|  putative polyubiquitin                                  209   8e-65   Arabidopsis thaliana [mouse-ear cress]
gb|EGA81850.1|  Ubi4p                                                   204   9e-65   Saccharomyces cerevisiae Lalvin QA23
gb|KIR83632.1|  polyubiquitin                                           207   9e-65   Cryptococcus gattii VGIV IND107
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  208   9e-65   Hypholoma sublateritium FD-334 SS-4
emb|CCO30213.1|  Polyubiquitin 3                                        208   1e-64   Rhizoctonia solani AG-1 IB
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 208   1e-64   Dacryopinax primogenitus
gb|AIS71924.1|  polyubiquitin                                           208   1e-64   Mangifera indica
gb|AAM63271.1|  unknown                                                 205   1e-64   Arabidopsis thaliana [mouse-ear cress]
emb|CAC94926.1|  putative ubiquitin                                     208   1e-64   Pleurotus sp. 'Florida' [Florida oyster mushroom]
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  208   1e-64   Piloderma croceum F 1598
gb|EGA85719.1|  Ubi4p                                                   204   1e-64   Saccharomyces cerevisiae VL3
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   208   1e-64   Piloderma croceum F 1598
gb|ABY60454.1|  putative polyubiquitin                                  209   1e-64   Adonis aestivalis var. palaestina
ref|XP_002447145.1|  hypothetical protein SORBIDRAFT_06g029360          205   1e-64   Sorghum bicolor [broomcorn]
emb|CDP08567.1|  unnamed protein product                                212   1e-64   Coffea canephora [robusta coffee]
gb|ACB87916.1|  polyubiquitin 1                                         207   1e-64   Malus domestica [apple tree]
ref|XP_003627152.1|  Ubiquitin                                          209   1e-64   
gb|EMS22298.1|  polyubiquitin                                           207   1e-64   Rhodotorula toruloides NP11
gb|AAF21992.1|  polyubiquitin                                           205   1e-64   Lilium longiflorum [Easter lily]
gb|AAC35858.1|  polyubiquitin                                           209   1e-64   Capsicum chinense [bonnet pepper]
ref|XP_011110054.1|  hypothetical protein H072_4094                     207   1e-64   
ref|XP_001701379.1|  bi-ubiquitin, major isoform                        205   2e-64   Chlamydomonas reinhardtii
gb|AAK68824.1|  Unknown protein                                         207   2e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54228.1|  polyubiquitin-like protein                              212   2e-64   Phaseolus vulgaris [French bean]
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     207   2e-64   Rhodotorula toruloides
ref|XP_002957068.1|  polyubiquitin                                      205   2e-64   Volvox carteri f. nagariensis
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  207   2e-64   Paxillus rubicundulus Ve08.2h10
gb|ABD96088.1|  polyubiquitin                                           209   2e-64   Malus domestica [apple tree]
gb|AIY27743.1|  polyubiquitin Ubi10                                     211   2e-64   Betula luminifera [liang ye hua]
gb|AGZ15412.1|  fiber polyubiquitin                                     207   2e-64   Phaseolus vulgaris [French bean]
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             210   2e-64   
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      210   2e-64   
gb|AES89865.2|  polyubiquitin 3                                         209   2e-64   Medicago truncatula
emb|CBY12791.1|  unnamed protein product                                203   2e-64   Oikopleura dioica
gb|EPS72031.1|  polyubiquitin                                           209   2e-64   Genlisea aurea
prf||1604470A  poly-ubiquitin                                           209   2e-64
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             209   2e-64   
gb|KIK81924.1|  hypothetical protein PAXRUDRAFT_736824                  207   2e-64   Paxillus rubicundulus Ve08.2h10
gb|AAO43309.1|  putative polyubiquitin                                  208   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   207   2e-64   Brassica rapa
gb|AAO42469.1|  putative polyubiquitin                                  209   2e-64   Arabidopsis lyrata [lyrate rockcress]
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      211   2e-64   Brachypodium distachyon [annual false brome]
ref|XP_007014924.1|  Polyubiquitin 3                                    209   2e-64   Theobroma cacao [chocolate]
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    209   2e-64   Phoenix dactylifera
gb|ABK94002.1|  unknown                                                 209   2e-64   Populus trichocarpa [western balsam poplar]
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  207   2e-64   Pisolithus microcarpus 441
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           213   2e-64   Eucalyptus grandis [rose gum]
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           209   2e-64   Brassica rapa
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           209   2e-64   Fragaria vesca subsp. vesca
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          209   2e-64   Sorghum bicolor [broomcorn]
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      209   3e-64   Brassica rapa
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             209   3e-64   
gb|AES89866.2|  polyubiquitin 3                                         209   3e-64   Medicago truncatula
dbj|BAJ85978.1|  predicted protein                                      209   3e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAB95250.1|  ubiquitin                                               209   3e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           209   3e-64   Nicotiana tomentosiformis
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                209   3e-64   Erythranthe guttata [common monkey flower]
emb|CAA48140.1|  ubiquitin                                              209   3e-64   Antirrhinum majus [garden snapdragon]
gb|ACB87917.1|  polyubiquitin 2                                         205   3e-64   Malus domestica [apple tree]
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   209   3e-64   Amanita muscaria Koide BX008
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      209   3e-64   Oryza brachyantha
ref|NP_851029.1|  polyubiquitin 3                                       209   3e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      209   3e-64   Citrus sinensis [apfelsine]
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            208   3e-64   Phaseolus vulgaris [French bean]
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             209   3e-64   
ref|XP_003590494.1|  Ubiquitin                                          209   3e-64   
gb|AFW66439.1|  putative ubiquitin family protein                       209   3e-64   
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             209   3e-64   Citrus clementina [clementine]
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      209   3e-64   Glycine max [soybeans]
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    209   3e-64   Linum usitatissimum
gb|EWZ87538.1|  ubiquitin C                                             204   3e-64   Fusarium oxysporum f. sp. lycopersici MN25
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             209   3e-64   
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             209   3e-64   
gb|KJB62487.1|  hypothetical protein B456_009G418900                    209   3e-64   Gossypium raimondii
ref|XP_003648495.1|  hypothetical protein Ecym_8408                     204   3e-64   Eremothecium cymbalariae DBVPG#7215
ref|NP_849292.1|  polyubiquitin 14                                      209   3e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             209   3e-64   
ref|XP_011465781.1|  PREDICTED: polyubiquitin-like                      205   3e-64   Fragaria vesca subsp. vesca
emb|CDP08569.1|  unnamed protein product                                209   3e-64   Coffea canephora [robusta coffee]
gb|EMS24129.1|  ubiquitin C                                             207   3e-64   Rhodotorula toruloides NP11
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             209   3e-64   Citrus clementina [clementine]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             209   3e-64   Citrus clementina [clementine]
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           209   3e-64   Nelumbo nucifera [Indian lotus]
emb|CBY46745.1|  polyubiquitin 10 protein                               209   3e-64   Lepidium appelianum [hairy whitetop]
ref|NP_564675.1|  ubiquitin-like                                        207   3e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006685644.1|  ubiquitin                                          207   3e-64   Yamadazyma tenuis ATCC 10573
emb|CAH59740.1|  polyubiquitin                                          209   3e-64   Plantago major [cart-track plant]
gb|KJB81823.1|  hypothetical protein B456_013G163500                    209   3e-64   Gossypium raimondii
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      209   3e-64   Camelina sativa [gold-of-pleasure]
dbj|BAC56573.1|  similar to polyubiquitin                               205   3e-64   Bos taurus [bovine]
gb|EWZ40370.1|  ubiquitin C                                             207   3e-64   Fusarium oxysporum Fo47
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      209   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      209   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_007873662.1|  hypothetical protein PNEG_01699                    204   4e-64   Pneumocystis murina B123
gb|EHN01342.1|  Ubi4p                                                   204   4e-64   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|EAX04506.1|  ubiquitin B, isoform CRA_e                              204   4e-64   Homo sapiens [man]
gb|AHC00631.1|  polyubiquitin                                           209   4e-64   Ganoderma lucidum
ref|XP_006381473.1|  polyubiquitin family protein                       209   4e-64   
ref|XP_007512209.1|  polyubiquitin                                      211   4e-64   Bathycoccus prasinos
dbj|GAK65396.1|  ubiquitin                                              210   4e-64   Moesziomyces antarcticus
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         209   4e-64   Jatropha curcas
gb|ACD31680.1|  ubiquitin                                               209   4e-64   Gossypium hirsutum [American cotton]
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         209   4e-64   Jatropha curcas
ref|XP_003687789.1|  hypothetical protein TPHA_0K02250                  204   4e-64   Tetrapisispora phaffii CBS 4417
gb|AES89856.2|  polyubiquitin 3                                         206   4e-64   Medicago truncatula
emb|CAA40323.1|  polyubiquitin protein                                  210   4e-64   Helianthus annuus
emb|CCF48657.1|  probable polyubiquitin                                 206   5e-64   Ustilago hordei
emb|CCK72367.1|  hypothetical protein KNAG_0J02880                      204   5e-64   Kazachstania naganishii CBS 8797
gb|AHA84132.1|  polyubiquitin                                           209   5e-64   Phaseolus vulgaris [French bean]
emb|CAA54603.1|  pentameric polyubiquitin                               210   5e-64   Nicotiana tabacum [American tobacco]
ref|XP_003082269.1|  polyubiquitin (ISS)                                208   5e-64   
prf||1101405A  ubiquitin precursor                                      205   5e-64
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             212   5e-64   
gb|AFY06654.1|  polyubiquitin                                           207   5e-64   Carica papaya [mamon]
gb|AAW73075.1|  polyubiquitin                                           202   5e-64   Collozoum sp. DDM-2005
emb|CAA25706.1|  unnamed protein product                                205   5e-64   Saccharomyces cerevisiae [brewer's yeast]
ref|XP_009609090.1|  PREDICTED: polyubiquitin 11                        204   5e-64   Nicotiana tomentosiformis
gb|AAO43303.1|  putative polyubiquitin                                  209   5e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAO43304.1|  putative polyubiquitin                                  209   5e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAO43305.1|  putative polyubiquitin                                  209   5e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         209   5e-64   
ref|XP_003607659.1|  Ubiquitin                                          207   5e-64   
gb|ACB87918.1|  polyubiquitin 3                                         204   6e-64   Malus domestica [apple tree]
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    211   6e-64   Hebeloma cylindrosporum h7
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           208   6e-64   Elaeis guineensis
gb|ADO60140.1|  ubiquitin                                               206   6e-64   Beauveria bassiana
gb|KIY97324.1|  ubiquitin C                                             204   6e-64   Monoraphidium neglectum
gb|AFW66438.1|  putative ubiquitin family protein                       210   7e-64   
emb|CAI77899.1|  polyubiquitine protein                                 202   7e-64   Collozoum inerme
gb|ACJ85658.1|  unknown                                                 206   7e-64   Medicago truncatula
dbj|BAF00213.1|  polyubiquitin 4 UBQ4                                   209   7e-64   Arabidopsis thaliana [mouse-ear cress]
emb|CCX04742.1|  Similar to Polyubiquitin; acc. no. P0CG74              206   7e-64   Pyronema omphalodes CBS 100304
gb|KJB14874.1|  hypothetical protein B456_002G147600                    209   8e-64   Gossypium raimondii
emb|CCL99875.1|  predicted protein                                      208   8e-64   Fibroporia radiculosa
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                208   8e-64   Serpula lacrymans var. lacrymans S7.3
gb|KIY53974.1|  polyubiquitin                                           208   8e-64   Fistulina hepatica ATCC 64428
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             208   8e-64   Capsella rubella
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            208   8e-64   Phaseolus vulgaris [French bean]
ref|XP_003030030.1|  polyubiquitin                                      208   9e-64   Schizophyllum commune H4-8
gb|KFM06793.1|  Polyubiquitin-B                                         203   9e-64   Aptenodytes forsteri
ref|XP_003619701.1|  Ubiquitin-like protein                             207   9e-64   
ref|XP_007366816.1|  polyubiquitin                                      208   9e-64   Dichomitus squalens LYAD-421 SS1
gb|KJB62485.1|  hypothetical protein B456_009G418900                    208   9e-64   Gossypium raimondii
gb|KIY45417.1|  ubiquitin                                               208   9e-64   Fistulina hepatica ATCC 64428
gb|KIR63773.1|  polyubiquitin                                           208   9e-64   Cryptococcus gattii CA1873
gb|KDB11907.1|  ubiquitin                                               208   9e-64   Ustilaginoidea virens
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   208   9e-64   Sphaerobolus stellatus SS14
ref|XP_001828882.1|  ubiquitin C                                        208   9e-64   Coprinopsis cinerea okayama7#130
ref|XP_001555417.1|  polyubiquitin                                      208   9e-64   Botrytis cinerea B05.10
emb|CBY16339.1|  unnamed protein product                                204   9e-64   Oikopleura dioica
emb|CEF99839.1|  Ubiquitin conserved site                               209   9e-64   Ostreococcus tauri
ref|XP_001931824.1|  ubiquitin                                          206   1e-63   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_001598085.1|  polyubiquitin                                      208   1e-63   Sclerotinia sclerotiorum 1980 UF-70
ref|NP_001058338.2|  Os06g0673500                                       204   1e-63   
gb|KIH51178.1|  ubiquitin family protein                                202   1e-63   Ancylostoma duodenale
pir||T02358  ubiquitin homolog T8F5.13 - Arabidopsis thaliana           208   1e-63
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  208   1e-63   Botryobasidium botryosum FD-172 SS1
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  205   1e-63   Naumovozyma dairenensis CBS 421
ref|XP_007339454.1|  ubiquitin                                          208   1e-63   
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  209   1e-63   Plicaturopsis crispa FD-325 SS-3
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    208   1e-63   Populus euphratica
emb|CAL30085.1|  polyubiquitin                                          203   1e-63   Globodera pallida
dbj|GAM41773.1|  Ubi4 homolog                                           205   1e-63   Talaromyces cellulolyticus
gb|KIR29996.1|  polyubiquitin                                           208   1e-63   Cryptococcus gattii VGII LA55
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              205   1e-63   Pseudocercospora fijiensis CIRAD86
ref|NP_176714.4|  ubiquitin 13                                          208   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005850582.1|  hypothetical protein CHLNCDRAFT_48528              205   1e-63   Chlorella variabilis
ref|XP_007763327.1|  polyubiquitin                                      208   1e-63   
gb|KIK93262.1|  hypothetical protein PAXRUDRAFT_145435                  205   1e-63   
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 208   1e-63   
ref|XP_001830230.1|  ubiquitin                                          208   1e-63   
ref|XP_006407638.1|  hypothetical protein EUTSA_v10022008mg             205   1e-63   
emb|CEP60563.1|  LALA0S01e13784g1_1                                     205   1e-63   
gb|EGA57707.1|  Ubi4p                                                   206   1e-63   
gb|KFX48439.1|  Polyubiquitin                                           205   1e-63   
gb|ACT66230.1|  polyubiquitin protein                                   204   1e-63   
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             205   1e-63   
gb|EKV18932.1|  hypothetical protein PDIP_25190                         205   1e-63   
gb|AFK47245.1|  unknown                                                 205   1e-63   
gb|AAP80690.1|  polyubiquitin                                           204   1e-63   
ref|XP_719867.1|  hypothetical protein CaO19.6771                       205   1e-63   
dbj|BAA76889.1|  ubiquitin                                              202   1e-63   
gb|EPX74297.1|  ubiquitin                                               205   1e-63   
ref|XP_001783045.1|  predicted protein                                  205   1e-63   
dbj|BAF81986.1|  polyubiquitin                                          202   1e-63   
ref|XP_002872109.1|  predicted protein                                  210   1e-63   
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    205   2e-63   
emb|CCT70325.1|  UBI4-Ubiquitin                                         207   2e-63   
gb|AAW73076.1|  polyubiquitin                                           201   2e-63   
gb|AAX40652.1|  polyubiquitin                                           209   2e-63   
ref|XP_002955196.1|  polyubiquitin                                      205   2e-63   
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      209   2e-63   
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                209   2e-63   
dbj|BAL61087.1|  polyubiquitin                                          205   2e-63   
ref|XP_010480024.1|  PREDICTED: polyubiquitin-like                      207   2e-63   
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         209   2e-63   
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                209   2e-63   
gb|ACS68205.1|  ubiquitin 10.2                                          209   2e-63   
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             209   2e-63   
gb|KDN44728.1|  polyubiquitin                                           205   2e-63   
ref|XP_001755431.1|  predicted protein                                  205   2e-63   
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      209   2e-63   
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        209   2e-63   
emb|CBY46746.1|  polyubiquitin 10 protein                               209   2e-63   
ref|NP_001105376.1|  polyubiquitin                                      209   2e-63   
ref|XP_002508175.1|  ubiquitin                                          209   2e-63   
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    209   2e-63   
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             209   2e-63   
ref|NP_001174480.1|  Os05g0504766                                       209   2e-63   
emb|CAI83757.1|  Polyubiqutin 4                                         203   2e-63   
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             209   2e-63   
gb|AAY86773.1|  polyubiquitin                                           209   2e-63   
ref|XP_010121056.1|  PREDICTED: ubiquitin isoform X5                    202   2e-63   
gb|ABU40645.1|  polyubiquitin                                           209   2e-63   
ref|NP_568397.1|  ubiquitin 4                                           209   2e-63   
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    209   2e-63   
ref|XP_008946169.1|  PREDICTED: polyubiquitin isoform X4                202   2e-63   
ref|NP_001148453.1|  LOC100282068                                       209   2e-63   
gb|AAF04147.1|  ubiquitin precursor                                     209   2e-63   
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         209   2e-63   
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      209   2e-63   
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                209   2e-63   
gb|EIE88012.1|  polyubiquitin                                           205   2e-63   
gb|ADD52202.1|  ubiquitin                                               209   2e-63   
ref|XP_003607667.1|  Multidrug resistance protein ABC transporter...    217   2e-63   
ref|XP_008597200.1|  Ubiquitin subgroup                                 204   2e-63   
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      209   2e-63   
gb|AAQ07453.1|  ubiquitin                                               209   2e-63   
emb|CDP05795.1|  unnamed protein product                                209   2e-63   
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    209   2e-63   
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             209   2e-63   
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    209   2e-63   
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         209   2e-63   
gb|AAB95252.1|  ubiquitin                                               209   2e-63   
ref|XP_006220138.1|  PREDICTED: polyubiquitin-A-like                    201   2e-63   
ref|NP_849300.4|  polyubiquitin 10                                      209   2e-63   
gb|EAW49110.1|  hCG1993742                                              202   2e-63   
gb|AAL33551.1|AF436850_1  polyubiquitin                                 202   2e-63   
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      211   2e-63   
ref|XP_006153239.1|  PREDICTED: polyubiquitin-B                         206   2e-63   
ref|XP_004156525.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    204   2e-63   
gb|KJB62483.1|  hypothetical protein B456_009G418900                    209   2e-63   
ref|XP_010456373.1|  PREDICTED: ubiquitin-like                          201   2e-63   
gb|AAL09741.1|  AT4g05320/C17L7_240                                     209   2e-63   
gb|KJB13592.1|  hypothetical protein B456_002G083000                    209   2e-63   
gb|KJB81825.1|  hypothetical protein B456_013G163500                    209   2e-63   
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      209   2e-63   
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    209   2e-63   
ref|XP_011166507.1|  PREDICTED: polyubiquitin                           201   2e-63   
emb|CDY70361.1|  BnaAnng33460D                                          200   2e-63   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    209   2e-63   
gb|EEC81160.1|  hypothetical protein OsI_24083                          205   2e-63   
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                209   2e-63   
gb|AAB68045.1|  polyubiquitin                                           209   2e-63   
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    209   2e-63   
ref|XP_003052575.1|  predicted protein                                  207   2e-63   
gb|KEH31155.1|  polyubiquitin 3                                         209   3e-63   
ref|XP_001420612.1|  predicted protein                                  209   3e-63   
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      209   3e-63   
gb|AAY33920.2|  polyubiquitin                                           209   3e-63   
gb|AAZ08412.1|  polyubiquitin                                           201   3e-63   
ref|XP_011175038.1|  PREDICTED: polyubiquitin                           202   3e-63   
gb|KJB62486.1|  hypothetical protein B456_009G418900                    209   3e-63   
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                209   3e-63   
gb|EIE85715.1|  polyubiquitin                                           204   3e-63   
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      209   3e-63   
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             207   3e-63   
gb|AAB36545.1|  ubiquitin-like protein                                  209   3e-63   
dbj|BAH71116.1|  ACYPI006410                                            202   3e-63   
emb|CCW69248.1|  unnamed protein product                                201   3e-63   
gb|KJB81824.1|  hypothetical protein B456_013G163500                    209   3e-63   
ref|XP_010135658.1|  PREDICTED: ubiquitin isoform X21                   201   3e-63   
gb|EFN65063.1|  Ubiquitin                                               201   3e-63   
dbj|BAH70616.1|  ACYPI007765                                            201   3e-63   
ref|XP_002953480.1|  polyubiquitin                                      206   3e-63   
emb|CAI77900.1|  polyubiquitine protein                                 200   3e-63   
gb|EMP26515.1|  Polyubiquitin-C                                         201   3e-63   
ref|XP_005524281.1|  PREDICTED: polyubiquitin-C isoform X3              200   3e-63   
ref|XP_007057728.1|  PREDICTED: polyubiquitin-C isoform X6              201   3e-63   
ref|XP_008555690.1|  PREDICTED: polyubiquitin                           201   4e-63   
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    204   4e-63   
ref|XP_004798165.1|  PREDICTED: polyubiquitin-C                         200   4e-63   
gb|AAZ42330.1|  ubiquitin protein 1                                     202   4e-63   
gb|EZF98642.1|  polyubiquitin                                           204   4e-63   
ref|XP_009171122.1|  hypothetical protein T265_07359                    201   4e-63   
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  204   4e-63   
ref|XP_011504237.1|  PREDICTED: polyubiquitin                           201   4e-63   
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   204   4e-63   
gb|ERG83124.1|  polyubiquitin-a                                         201   4e-63   
ref|XP_004934049.1|  PREDICTED: polyubiquitin-A-like                    201   4e-63   
emb|CDP08563.1|  unnamed protein product                                201   4e-63   
ref|XP_009093028.1|  PREDICTED: polyubiquitin-B isoform X1              202   4e-63   
ref|NP_001053957.1|  Os04g0628100                                       209   4e-63   
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                208   4e-63   
gb|EMS65864.1|  Polyubiquitin                                           209   4e-63   
ref|XP_010084934.1|  PREDICTED: ubiquitin isoform X5                    201   4e-63   
emb|CCA69433.1|  related to UBI4-Ubiquitin                              202   5e-63   
dbj|BAK61738.1|  ubiquitin                                              202   5e-63   
emb|CCA70326.1|  related to UBI4-Ubiquitin                              203   5e-63   
gb|KHJ83418.1|  ubiquitin family protein                                203   5e-63   
ref|XP_009983604.1|  PREDICTED: ubiquitin isoform X15                   201   5e-63   
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   204   6e-63   
ref|XP_005763036.1|  hypothetical protein EMIHUDRAFT_358059             201   6e-63   
gb|AFR98116.1|  polyubiquitin                                           208   6e-63   
ref|XP_005779770.1|  hypothetical protein EMIHUDRAFT_114700             201   6e-63   
gb|EMS60894.1|  Polyubiquitin                                           210   6e-63   
gb|EUC59758.1|  polyubiquitin                                           208   6e-63   
ref|XP_001880135.1|  ubiquitin                                          208   6e-63   
gb|AAO43310.1|  putative polyubiquitin                                  204   6e-63   
emb|CAE00783.1|  polyubiquitin homolog                                  202   6e-63   
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             207   6e-63   
gb|ACX46987.1|  ubiquitin                                               210   6e-63   
emb|CAI83758.1|  Polyubiqutin 5                                         203   6e-63   
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 208   6e-63   
gb|AAC67552.1|  polyubiquitin                                           208   6e-63   
ref|XP_008491507.1|  PREDICTED: ubiquitin isoform X4                    200   6e-63   
gb|AAX61165.1|  ubiquitin                                               201   6e-63   
dbj|BAN21697.1|  ubiquitin                                              202   7e-63   
gb|AAA82978.1|  polyubiquitin                                           208   7e-63   
gb|KHJ77263.1|  ubiquitin family protein                                202   7e-63   
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  208   7e-63   
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             208   7e-63   
ref|XP_003196661.1|  ATP-dependent protein binding protein              208   7e-63   
gb|KFK38370.1|  hypothetical protein AALP_AA3G105100                    204   7e-63   
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  208   7e-63   
gb|EPS29015.1|  hypothetical protein PDE_03961                          205   7e-63   
ref|XP_005525794.1|  PREDICTED: polyubiquitin-C-like isoform X3         201   7e-63   
ref|XP_007864655.1|  ubiquitin                                          208   7e-63   
gb|EJU00136.1|  ubiquitin                                               208   7e-63   
ref|XP_004929680.1|  PREDICTED: polyubiquitin-C-like isoform X1         201   7e-63   
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    208   8e-63   
ref|XP_011278191.1|  PREDICTED: polyubiquitin-B-like                    202   8e-63   
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  208   8e-63   
ref|XP_001227036.1|  polyubiquitin                                      206   8e-63   
gb|KIK16633.1|  hypothetical protein PISMIDRAFT_15706                   205   8e-63   
ref|XP_001210780.1|  ubiquitin                                          206   8e-63   
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  208   8e-63   
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              204   8e-63   
gb|KIW56414.1|  polyubiquitin                                           206   8e-63   
gb|AAV65292.1|  polyubiquitin                                           206   8e-63   
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        203   8e-63   
ref|XP_001764949.1|  predicted protein                                  206   8e-63   
ref|XP_002839703.1|  hypothetical protein                               206   8e-63   
gb|KEZ40313.1|  Polyubiquitin                                           206   9e-63   
ref|XP_002083532.1|  GD13313                                            202   9e-63   
sp|P62972.2|UBIQP_XENLA  RecName: Full=Polyubiquitin; Contains: R...    201   9e-63   
dbj|BAP70433.1|  Ubiquitin                                              206   9e-63   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          203   9e-63   
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    203   9e-63   
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           209   9e-63   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         206   9e-63   
ref|XP_002551324.1|  ubiquitin                                          205   9e-63   
gb|EEQ88150.1|  ubiquitin                                               205   9e-63   
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                210   9e-63   
ref|XP_008796191.1|  PREDICTED: polyubiquitin-like                      206   9e-63   
gb|AAV35212.1|  polyubiquitin-like protein                              201   9e-63   
gb|ETN78467.1|  ubiquitin family protein                                203   9e-63   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          203   9e-63   
ref|XP_009481652.1|  PREDICTED: polyubiquitin                           200   9e-63   
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           210   1e-62   
dbj|GAA55031.1|  ubiquitin C                                            203   1e-62   
ref|XP_002891806.1|  predicted protein                                  207   1e-62   
gb|KDR10312.1|  Ubiquitin                                               203   1e-62   
gb|KFP73354.1|  Polyubiquitin-B                                         201   1e-62   
ref|XP_009907852.1|  PREDICTED: polyubiquitin                           201   1e-62   
gb|EEH07231.1|  ubiquitin                                               205   1e-62   
ref|XP_002419618.1|  ubiquitin, putative                                205   1e-62   
gb|AAO43306.1|  putative polyubiquitin                                  206   1e-62   
ref|XP_011278194.1|  PREDICTED: polyubiquitin-B-like                    201   1e-62   
ref|XP_001755307.1|  predicted protein                                  205   1e-62   
dbj|BAK02501.1|  predicted protein                                      209   1e-62   
emb|CAA40324.1|  hexaubiquitin protein                                  209   1e-62   
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             205   1e-62   
gb|KFV20239.1|  Polyubiquitin-B                                         201   1e-62   
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                209   1e-62   
ref|NP_001045980.1|  Os02g0161900                                       209   1e-62   
dbj|BAK03691.1|  predicted protein                                      209   1e-62   
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      209   1e-62   
gb|EJW80596.1|  polyubiquitin                                           202   1e-62   
ref|XP_011269968.1|  hypothetical protein CAOG_08398                    202   1e-62   
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         209   1e-62   
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             209   1e-62   
gb|AAD03343.1|  ubiquitin                                               209   1e-62   
gb|KFQ61504.1|  Polyubiquitin                                           201   1e-62   
gb|AAB95251.1|  ubiquitin                                               209   1e-62   
emb|CAA64326.1|  ubiquitin                                              200   1e-62   
ref|XP_011203306.1|  PREDICTED: polyubiquitin-B                         202   1e-62   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     205   1e-62   



>gb|AEG78310.1| ubiquitin, partial [Cucurbita pepo]
Length=141

 Score =   211 bits (537),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +LNL   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  8    STLNLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  62

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKE+TLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  63   IFAGKQLEDGRTLADYNIQKETTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  122

Query  379  AQIQDK  396
            A+IQDK
Sbjct  123  AKIQDK  128


 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 52/63 (83%), Gaps = 5/63 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  84   TTLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  138

Query  199  IFA  207
            IFA
Sbjct  139  IFA  141


 Score = 93.6 bits (231),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  241  DYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            DYNIQ+ESTL+LVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    DYNIQRESTLNLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  52



>dbj|BAK19068.1| ubiquitin [Ipomoea nil]
Length=121

 Score =   209 bits (532),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 112/124 (90%), Gaps = 5/124 (4%)
 Frame = +1

Query  25   LNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  204
            L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  1    LHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  55

Query  205  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQ  384
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+
Sbjct  56   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  115

Query  385  IQDK  396
            IQDK
Sbjct  116  IQDK  119


 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 41/52 (79%), Gaps = 5/52 (10%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  174
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG
Sbjct  75   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  121



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 115/130 (88%), Gaps = 4/130 (3%)
 Frame = +1

Query  19   CSLNL----FYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  186
            C+ NL    +    HS    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD
Sbjct  20   CNYNLGRREYGSHFHSFKPFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  79

Query  187  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTI  366
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTI
Sbjct  80   QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI  139

Query  367  DNRQAQIQDK  396
            DN +A+IQDK
Sbjct  140  DNVKAKIQDK  149


 Score =   208 bits (529),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  105  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  159

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  160  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  219

Query  379  AQIQDK  396
            A+IQDK
Sbjct  220  AKIQDK  225


 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  181  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  235

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  236  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  269



>gb|ABH06365.1| ubiquitin [Sorbus aucuparia]
Length=141

 Score =   209 bits (532),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  7    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  61

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  62   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  121

Query  379  AQIQDK  396
            A+IQDK
Sbjct  122  AKIQDK  127


 Score = 97.8 bits (242),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 53/64 (83%), Gaps = 5/64 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  83   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  137

Query  199  IFAG  210
            IFAG
Sbjct  138  IFAG  141


 Score = 95.1 bits (235),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  51



>gb|AAC39466.1| polyubiquitin [Arabidopsis thaliana]
Length=137

 Score =   209 bits (532),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  17   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  71

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TI+LEVESSDTIDN +
Sbjct  72   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTISLEVESSDTIDNVK  131

Query  379  AQIQDK  396
            A+IQDK
Sbjct  132  AKIQDK  137


 Score =   114 bits (286),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  214  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQD  393
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQD
Sbjct  1    QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  60

Query  394  K  396
            K
Sbjct  61   K  61



>ref|XP_003619702.1| Ubiquitin-like protein [Medicago truncatula]
Length=245

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +1

Query  46   RHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  225
            +H     KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  44   QHRSFQFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  103

Query  226  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  104  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  160


 Score =   210 bits (534),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  117  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  171

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A
Sbjct  172  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  231

Query  382  QIQDK  396
            +IQDK
Sbjct  232  KIQDK  236


 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 43/53 (81%), Gaps = 5/53 (9%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  180
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  193  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  240



>ref|XP_006495490.1| PREDICTED: polyubiquitin 4-like, partial [Citrus sinensis]
Length=120

 Score =   208 bits (530),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 50/61 (82%), Gaps = 5/61 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  I  201
            I
Sbjct  120  I  120



>gb|AFU90137.2| polyubiquitin, partial [Paeonia lactiflora]
Length=166

 Score =   210 bits (534),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  46   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  100

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  101  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  160

Query  379  AQIQDK  396
            A+IQDK
Sbjct  161  AKIQDK  166


 Score =   173 bits (439),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +1

Query  127  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  306
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  60

Query  307  FVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            FVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDK  90



>dbj|BAA76429.1| polyubiquitin [Cicer arietinum]
Length=108

 Score =   207 bits (527),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQD  393
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQD
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  108


 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  298  MQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            MQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  33



>dbj|BAJ61942.1| ubiquitin [Nymphaea hybrid cultivar]
Length=146

 Score =   209 bits (531),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 73/86 (85%), Gaps = 5/86 (6%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHL  276
            IFAGKQLEDGRTLADYNIQKEST  L
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTSTL  145



>gb|ACA58351.1| ubiquitin-like protein [Sandersonia aurantiaca]
Length=189

 Score =   210 bits (534),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (530),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 43/54 (80%), Gaps = 5/54 (9%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  180
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  189



>gb|AHI85710.1| stress-induced protein 5, partial [Capsicum annuum]
Length=169

 Score =   209 bits (532),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  5    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  59

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  60   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  119

Query  379  AQIQDK  396
            A+IQDK
Sbjct  120  AKIQDK  125


 Score =   156 bits (394),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  81   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  135

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  136  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  169


 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  49



>sp|P0CG83.1|UBIQP_HORVU RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Hordeum vulgare]
 emb|CAA27751.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=171

 Score =   209 bits (532),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  7    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  61

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  62   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  121

Query  379  AQIQDK  396
            A+IQDK
Sbjct  122  AKIQDK  127


 Score =   155 bits (393),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  83   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  137

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  138  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  170


 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  51



>gb|ABI84246.1| polyubiquitin 10 [Arachis hypogaea]
Length=192

 Score =   210 bits (534),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 46/57 (81%), Gaps = 5/57 (9%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  189
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  192



>gb|AGZ80457.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80458.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80459.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80460.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80461.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80462.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80463.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80464.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80465.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80466.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80467.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80468.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80469.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80470.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80471.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80472.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80473.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80474.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80475.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80476.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
 gb|AGZ80477.1| ubiquitin-like protein, partial [Phaseolus vulgaris]
Length=132

 Score =   207 bits (528),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  10   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  69

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  70   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  118


 Score = 97.8 bits (242),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 53/64 (83%), Gaps = 5/64 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  74   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  128

Query  199  IFAG  210
            IFAG
Sbjct  129  IFAG  132


 Score = 77.0 bits (188),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  271  HLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            HLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    HLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  42



>gb|AIY85428.1| ubiquitin, partial [Elaeagnus umbellata]
Length=148

 Score =   208 bits (530),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  20   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  74

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAG+QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  75   IFAGRQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  134

Query  379  AQIQDK  396
            A+IQDK
Sbjct  135  AKIQDK  140


 Score =   119 bits (297),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +1

Query  205  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQ  384
            AGKQ EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+
Sbjct  1    AGKQFEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  60

Query  385  IQDK  396
            IQDK
Sbjct  61   IQDK  64


 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 47/58 (81%), Gaps = 5/58 (9%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  192
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  96   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  148



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   213 bits (543),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = +1

Query  25   LNLFYH-LRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            L LF   L H     KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  12   LALFVSVLVHQPFPFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  71

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A
Sbjct  72   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  131

Query  382  QIQDK  396
            +IQDK
Sbjct  132  KIQDK  136


 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  92   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  146

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  147  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  206

Query  379  AQIQDK  396
            A+IQDK
Sbjct  207  AKIQDK  212


 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  168  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  222

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  223  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  282

Query  379  AQIQDK  396
            A+IQDK
Sbjct  283  AKIQDK  288


 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 42/53 (79%), Gaps = 5/53 (9%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  177
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG+
Sbjct  244  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGM  291



>gb|ABR25718.1| polyubiquitin containing 7 ubiquitin monomers [Oryza sativa Indica 
Group]
Length=178

 Score =   209 bits (532),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  14   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  68

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  69   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  128

Query  379  AQIQDK  396
            A+IQDK
Sbjct  129  AKIQDK  134


 Score =   156 bits (394),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  90   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  144

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  145  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  177


 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +1

Query  223  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  58



>ref|XP_007693173.1| hypothetical protein COCMIDRAFT_109160, partial [Bipolaris oryzae 
ATCC 44560]
 gb|EUC40302.1| hypothetical protein COCMIDRAFT_109160, partial [Bipolaris oryzae 
ATCC 44560]
Length=175

 Score =   209 bits (532),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  11   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  65

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  66   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  125

Query  379  AQIQDK  396
            A+IQDK
Sbjct  126  AKIQDK  131


 Score =   155 bits (393),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  87   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  141

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  142  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  174


 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  232  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  55



>gb|AFJ04519.1| ubiquitin, partial [Vernicia fordii]
Length=176

 Score =   209 bits (531),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  13   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  67

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A
Sbjct  68   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  127

Query  382  QIQDK  396
            +IQDK
Sbjct  128  KIQDK  132


 Score =   155 bits (393),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  89   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  143

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  144  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  176


 Score =   104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  229  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  56



>gb|AAZ32851.1| pentameric polyubiquitin [Medicago sativa]
Length=189

 Score =   209 bits (533),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  11   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  65

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  66   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  125

Query  379  AQIQDK  396
            A+IQDK
Sbjct  126  AKIQDK  131


 Score =   181 bits (460),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 96/108 (89%), Gaps = 5/108 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  87   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  141

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITL  342
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITL
Sbjct  142  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  189


 Score =   102 bits (254),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/55 (93%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  232  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  55



>ref|XP_004501591.1| PREDICTED: polyubiquitin 4-like [Cicer arietinum]
Length=152

 Score =   208 bits (529),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152



>tpg|DAA44273.1| TPA: Ubiquitin fusion protein [Zea mays]
Length=205

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   157 bits (396),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 5/93 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  153



>gb|AAZ82816.1| ubiquitin monomer protein [Morus mongolica]
Length=152

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (392),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLV+RLRGG
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVIRLRGG  152



>gb|AFC36452.1| ubiquitin, partial [Anoectochilus roxburghii]
Length=214

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  20   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  74

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  75   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  134

Query  379  AQIQDK  396
            A+IQDK
Sbjct  135  AKIQDK  140


 Score =   204 bits (520),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/124 (85%), Positives = 111/124 (90%), Gaps = 5/124 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  96   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  150

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  151  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  210

Query  379  AQIQ  390
            A+I+
Sbjct  211  AKIR  214


 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  205  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQ  384
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+
Sbjct  1    AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  60

Query  385  IQDK  396
            IQDK
Sbjct  61   IQDK  64



>gb|KJB69253.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=160

 Score =   208 bits (530),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   133 bits (335),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 73/87 (84%), Gaps = 5/87 (6%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVL  282
            FAGKQLEDGRTLADYNIQKE+ L +  
Sbjct  121  FAGKQLEDGRTLADYNIQKENRLFIWF  147



>ref|XP_009758989.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
Length=154

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152



>ref|XP_010931828.1| PREDICTED: polyubiquitin [Elaeis guineensis]
 gb|AFW66446.1| ubiquitin2 [Zea mays]
 gb|AFW70220.1| polyubiquitin-like protein [Zea mays]
Length=153

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152



>ref|XP_004976899.1| PREDICTED: polyubiquitin 3-like [Setaria italica]
Length=153

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   157 bits (396),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  153



>gb|ABF06579.2| polyubiquitin, partial [Gladiolus grandiflorus]
Length=162

 Score =   208 bits (530),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   176 bits (445),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 92/103 (89%), Gaps = 5/103 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  327
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  162



>ref|XP_008246113.1| PREDICTED: polyubiquitin [Prunus mume]
Length=153

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  153



>ref|XP_004497490.1| PREDICTED: polyubiquitin 4-like [Cicer arietinum]
Length=154

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152



>gb|KDP23292.1| hypothetical protein JCGZ_23125 [Jatropha curcas]
Length=153

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRT ADYNIQKESTLHLVLRLRGG+
Sbjct  120  IFAGKQLEDGRTHADYNIQKESTLHLVLRLRGGI  153



>ref|NP_001190681.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_003626480.1| Ubiquitin-like protein [Medicago truncatula]
 ref|XP_008345057.1| PREDICTED: polyubiquitin [Malus domestica]
 ref|XP_009358112.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358113.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009345196.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009345209.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 gb|AAR83856.1| hexameric polyubiquitin 6PU11 [Capsicum annuum]
 emb|CAN77120.1| hypothetical protein VITISV_031666 [Vitis vinifera]
 gb|ACJ85770.1| unknown [Medicago truncatula]
 gb|AEE82471.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFK33927.1| unknown [Medicago truncatula]
 gb|AFK34391.1| unknown [Lotus japonicus]
 gb|AFP43342.1| polyubiquitin [Arabidopsis thaliana]
 gb|EPS65462.1| hypothetical protein M569_09314 [Genlisea aurea]
 gb|AHW29561.1| polyubiquitin [Picrorhiza kurrooa]
 emb|CDY46367.1| BnaA09g19810D [Brassica napus]
Length=153

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  153



>gb|AAL25813.1| polyubiquitin, partial [Prunus avium]
Length=154

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  61

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  110


 Score =   152 bits (385),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 81/94 (86%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG PPDQQRL
Sbjct  66   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTPPDQQRL  120

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGG 
Sbjct  121  IFAGKQLEDGRTLADYNIQEESTLHLVLRLRGGF  154


 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  295  GMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            GMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  34



>pir||PS0380 ubiquitin precursor - rice (fragment)
 dbj|BAA02241.1| poly-ubiquitin [Oryza sativa Japonica Group]
Length=189

 Score =   209 bits (532),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  25   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  79

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  80   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  139

Query  379  AQIQDK  396
            A+IQDK
Sbjct  140  AKIQDK  145


 Score =   157 bits (396),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  101  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  189


 Score =   130 bits (326),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  190  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTID  369
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  370  NRQAQIQDK  396
            N +A+IQDK
Sbjct  61   NVKAKIQDK  69



>ref|XP_006495477.1| PREDICTED: polyubiquitin 3-like, partial [Citrus sinensis]
Length=164

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   177 bits (448),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 93/105 (89%), Gaps = 5/105 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXT  333
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG T
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  164



>emb|CAD27944.1| polyubiquitin-like [Oryza sativa]
Length=219

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   206 bits (524),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  73   QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  252
            QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI
Sbjct  2    QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  61

Query  253  QKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            QKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  62   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 69/84 (82%), Gaps = 5/84 (6%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI    +RL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIHQTSKRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTL  270
            IFAGKQLEDGRTLADYNIQKESTL
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTL  219



>gb|KJB69254.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=162

 Score =   208 bits (529),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   169 bits (429),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 89/100 (89%), Gaps = 5/100 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  318
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  159



>gb|AFK46460.1| unknown [Medicago truncatula]
Length=153

 Score =   207 bits (528),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 81/94 (86%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKE TLHLVLRLRGG 
Sbjct  120  IFAGKQLEDGRTLADYNIQKEFTLHLVLRLRGGF  153



>gb|AFW66442.1| putative ubiquitin family protein, partial [Zea mays]
Length=216

 Score =   209 bits (533),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 70/81 (86%), Gaps = 5/81 (6%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKE  261
            IFAGKQLEDGRTLADYNIQKE
Sbjct  196  IFAGKQLEDGRTLADYNIQKE  216



>gb|AAB86858.1| polyubiquitin, partial [Schizophyllum commune]
Length=139

 Score =   207 bits (526),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   129 bits (323),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 69/80 (86%), Gaps = 5/80 (6%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQK  258
            IFAGKQLEDGRTL+DYNIQK
Sbjct  120  IFAGKQLEDGRTLSDYNIQK  139



>ref|XP_009420214.1| PREDICTED: polyubiquitin [Musa acuminata subsp. malaccensis]
Length=153

 Score =   207 bits (527),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIF+KTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (393),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152



>gb|AAM78180.1| putative polyubiquitin [Gossypium herbaceum]
 gb|AAM78181.1| putative polyubiquitin [Gossypium raimondii]
 gb|AAM78182.1| putative polyubiquitin [Gossypium barbadense]
 gb|AAM78183.1| putative polyubiquitin, partial [Gossypium barbadense]
 gb|AAM78184.1| putative polyubiquitin [Gossypioides kirkii]
Length=204

 Score =   209 bits (531),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  40   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  94

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  95   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  154

Query  379  AQIQDK  396
            A+IQDK
Sbjct  155  AKIQDK  160


 Score =   161 bits (407),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +1

Query  145  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  324
            VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  1    VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  60

Query  325  GXTITLEVESSDTIDNRQAQIQDK  396
            G TITLEVESSDTIDN +A+IQDK
Sbjct  61   GKTITLEVESSDTIDNVKAKIQDK  84


 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  116  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  170

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  171  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  204



>gb|ACZ69386.1| polyubiquitin UBQ14 [Cucumis sativus]
Length=197

 Score =   209 bits (531),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  33   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  87

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  88   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  147

Query  379  AQIQDK  396
            A+IQDK
Sbjct  148  AKIQDK  153


 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  109  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  163

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  164  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  197


 Score =   148 bits (374),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 75/77 (97%), Gaps = 0/77 (0%)
 Frame = +1

Query  166  KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLE  345
            KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLE
Sbjct  1    KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  60

Query  346  VESSDTIDNRQAQIQDK  396
            VESSDTIDN +A+IQDK
Sbjct  61   VESSDTIDNVKAKIQDK  77



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   209 bits (533),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (530),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 80/91 (88%), Gaps = 5/91 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLR  291
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLR  226



>gb|AFP44113.1| ubiquitin, partial [Lycoris longituba]
Length=187

 Score =   208 bits (530),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  112


 Score =   206 bits (525),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 111/125 (89%), Gaps = 5/125 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  68   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  122

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVE SDTIDN +
Sbjct  123  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDTIDNVK  182

Query  379  AQIQD  393
            A+IQD
Sbjct  183  AKIQD  187


 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +1

Query  289  RGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            RGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  36



>gb|AAF31707.1|AF221858_1 polyubiquitin [Euphorbia esula]
Length=215

 Score =   209 bits (532),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  51   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  105

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  106  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  165

Query  379  AQIQDK  396
            A+IQDK
Sbjct  166  AKIQDK  171


 Score =   182 bits (461),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  112  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  291
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  292  GGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            GGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  95


 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  127  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  181

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  182  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  214



>ref|XP_007154494.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26488.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=193

 Score =   208 bits (530),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVE+SDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 47/58 (81%), Gaps = 5/58 (9%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  192
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQ
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQ  193



>gb|ABH08754.1| ubiquitin [Arabidopsis thaliana]
Length=220

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  55   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  109

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  110  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  169

Query  379  AQIQDK  396
            A+IQDK
Sbjct  170  AKIQDK  175


 Score =   188 bits (478),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/99 (96%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +1

Query  100  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  279
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  280  LRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            LRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  99


 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  131  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  185

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  186  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  218



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|ABH08753.1| ubiquitin [Arabidopsis thaliana]
Length=219

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  55   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  109

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  110  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  169

Query  379  AQIQDK  396
            A+IQDK
Sbjct  170  AKIQDK  175


 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/99 (96%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +1

Query  100  KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  279
            KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    KTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV  60

Query  280  LRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            LRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  99


 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  131  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  185

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  186  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  219



>gb|EEC81189.1| hypothetical protein OsI_24195 [Oryza sativa Indica Group]
Length=223

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  60   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  114

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A
Sbjct  115  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  174

Query  382  QIQDK  396
            +IQDK
Sbjct  175  KIQDK  179


 Score =   182 bits (462),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +1

Query  109  TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  288
            T EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL
Sbjct  8    TCEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  67

Query  289  RGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            RGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  68   RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  103


 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 82/92 (89%), Gaps = 5/92 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  136  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  190

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  191  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  222



>ref|XP_003607669.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=448

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +1

Query  31   LFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  210
            LF+ LR      KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  207  LFFLLRQFYDSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  266

Query  211  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQ  390
            KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQ
Sbjct  267  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  326

Query  391  DK  396
            DK
Sbjct  327  DK  328


 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  404


 Score =   154 bits (390),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/76 (100%), Positives = 76/76 (100%), Gaps = 0/76 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  372  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  431

Query  250  IQKESTLHLVLRLRGG  297
            IQKESTLHLVLRLRGG
Sbjct  432  IQKESTLHLVLRLRGG  447



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|ABR25697.1| polyubiquitin containing 7 ubiquitin monomers [Oryza sativa Indica 
Group]
Length=201

 Score =   208 bits (530),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  37   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  91

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  92   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  151

Query  379  AQIQDK  396
            A+IQDK
Sbjct  152  AKIQDK  157


 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  113  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  167

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  168  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  200


 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/81 (94%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = +1

Query  154  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXT  333
            KIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFVKTLTG T
Sbjct  1    KIQDKEGIPPDQQRLIFAGKQLEDGRTLXDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  60

Query  334  ITLEVESSDTIDNRQAQIQDK  396
            ITLEVESSDTIDN +A+IQDK
Sbjct  61   ITLEVESSDTIDNVKAKIQDK  81



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  229



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   211 bits (537),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/116 (93%), Positives = 110/116 (95%), Gaps = 2/116 (2%)
 Frame = +1

Query  55   CSYL--KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  228
            C  L  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  14   CGRLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  73

Query  229  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  74   RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  129


 Score =   210 bits (534),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AQIQDK  396
            A+IQDK
Sbjct  200  AKIQDK  205


 Score =   207 bits (528),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  161  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  215

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEV SSDTIDN +
Sbjct  216  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVK  275

Query  379  AQIQDK  396
            A+IQDK
Sbjct  276  AKIQDK  281



>gb|AAB36546.1| polyubiquitin [Phaseolus vulgaris]
Length=215

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  51   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  105

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  106  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  165

Query  379  AQIQDK  396
            A+IQDK
Sbjct  166  AKIQDK  171


 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  112  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  291
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  1    LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  60

Query  292  GGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            GGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  95


 Score =   157 bits (396),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  127  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  181

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  182  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  215



>gb|ABH08755.1| ubiquitin [Arabidopsis thaliana]
Length=221

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  57   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  111

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  112  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  171

Query  379  AQIQDK  396
            A+IQDK
Sbjct  172  AKIQDK  177


 Score =   192 bits (489),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  94   TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  273
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  1    TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  60

Query  274  LVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            LVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  101


 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  133  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  187

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  188  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  221



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  229



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_009412006.1| PREDICTED: polyubiquitin 11-like [Musa acuminata subsp. malaccensis]
Length=231

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/111 (95%), Positives = 109/111 (98%), Gaps = 0/111 (0%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  243
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  111


 Score =   201 bits (511),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 106/118 (90%), Gaps = 5/118 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  67   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  121

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDN  372
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN
Sbjct  122  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  179


 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 69/93 (74%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNV             QQRL
Sbjct  143  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVXXXXXXXXXXXXXQQRL  197

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  198  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  230



>ref|XP_001731772.1| hypothetical protein MGL_1040 [Malassezia globosa CBS 7966]
 gb|EDP44558.1| hypothetical protein MGL_1040 [Malassezia globosa CBS 7966]
Length=154

 Score =   207 bits (526),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (392),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV  153



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVXRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   206 bits (524),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLV RLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (391),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQK+STLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGG  228



>ref|XP_009388149.1| PREDICTED: polyubiquitin-like, partial [Musa acuminata subsp. 
malaccensis]
Length=130

 Score =   206 bits (524),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+ QDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKTQDK  109


 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 59/71 (83%), Gaps = 5/71 (7%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGR  231
            IFAGKQLEDGR
Sbjct  120  IFAGKQLEDGR  130



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   157 bits (397),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_002389222.1| hypothetical protein MPER_11681 [Moniliophthora perniciosa FA553]
 gb|EEB90152.1| hypothetical protein MPER_11681 [Moniliophthora perniciosa FA553]
Length=153

 Score =   207 bits (526),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (391),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  152



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   206 bits (524),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   152 bits (383),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 81/94 (86%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   209 bits (532),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   206 bits (523),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   152 bits (385),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 81/94 (86%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTL LVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLPLVLRLRGGF  229



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 115/128 (90%), Gaps = 1/128 (1%)
 Frame = +1

Query  16   ICSLNLFYHLRHS-CSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  192
              +L    H+ H   S LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  30   FIALFFISHIFHRFISPLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  89

Query  193  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDN  372
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN
Sbjct  90   RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  149

Query  373  RQAQIQDK  396
             +A+IQDK
Sbjct  150  VKAKIQDK  157


 Score =   209 bits (532),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  113  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  167

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  168  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  227

Query  379  AQIQDK  396
            A+IQDK
Sbjct  228  AKIQDK  233


 Score =   209 bits (532),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  189  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  243

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  244  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  303

Query  379  AQIQDK  396
            A+IQDK
Sbjct  304  AKIQDK  309


 Score =   209 bits (532),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  265  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  319

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  320  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  379

Query  379  AQIQDK  396
            A+IQDK
Sbjct  380  AKIQDK  385


 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  341  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  395

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  396  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  429



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   158 bits (399),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 84/97 (87%), Gaps = 5/97 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  309
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+  F
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGLTGF  232



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CAI51312.2| polyubiquitin [Capsicum chinense]
Length=153

 Score =   206 bits (525),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLR RGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRFRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (391),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  250  IQKESTLHLVLRLRGGM  300
            IQKESTLHLVLRLRGG 
Sbjct  137  IQKESTLHLVLRLRGGF  153



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   207 bits (528),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 112/127 (88%), Gaps = 5/127 (4%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +C L  F   R       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  12   MCDLEDFLECRKM-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  66

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNR  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN 
Sbjct  67   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  126

Query  376  QAQIQDK  396
            +A+IQDK
Sbjct  127  KAKIQDK  133


 Score =   209 bits (532),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  90   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  144

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A
Sbjct  145  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  204

Query  382  QIQDK  396
            +IQDK
Sbjct  205  KIQDK  209


 Score =   155 bits (393),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 82/92 (89%), Gaps = 5/92 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  166  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  220

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  221  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  252



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   154 bits (390),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 81/93 (87%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGR LADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRNLADYNIQKESTLHLVLRLRGG  228



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   206 bits (524),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AGA61761.1| polyubuquitin 10, partial [Cornus kousa]
Length=172

 Score =   207 bits (527),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  36   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  90

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  91   IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  150

Query  379  AQIQDK  396
            A+IQDK
Sbjct  151  AKIQDK  156


 Score =   154 bits (388),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +1

Query  157  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTI  336
            IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TI
Sbjct  1    IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI  60

Query  337  TLEVESSDTIDNRQAQIQDK  396
            TLEVESSDTIDN +A+IQDK
Sbjct  61   TLEVESSDTIDNVKAKIQDK  80


 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 51/63 (81%), Gaps = 5/63 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG PPDQQRL
Sbjct  112  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTPPDQQRL  166

Query  199  IFA  207
            IFA
Sbjct  167  IFA  169



>gb|ACT82769.1| polyubiquitin [Nicotiana tabacum]
Length=188

 Score =   207 bits (528),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       +QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  11   STLHLVLRLRGG-----LQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  65

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  66   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  125

Query  379  AQIQDK  396
            A+IQDK
Sbjct  126  AKIQDK  131


 Score =   179 bits (455),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 95/107 (89%), Gaps = 5/107 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  87   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  141

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTIT  339
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TIT
Sbjct  142  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  188


 Score = 99.0 bits (245),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  232  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            TL DYNIQKESTLHLVLRLRGG+QIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    TLPDYNIQKESTLHLVLRLRGGLQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  55



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   210 bits (534),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   199 bits (505),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 107/122 (88%), Gaps = 5/122 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT TG TITLE ESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTXTGKTITLEXESSDTIDNVK  255

Query  379  AQ  384
            A+
Sbjct  256  AK  257



>gb|KIK16797.1| hypothetical protein PISMIDRAFT_686019, partial [Pisolithus microcarpus 
441]
Length=124

 Score =   205 bits (522),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLE ESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEAESSDTIDNVKAKIQDK  109


 Score = 98.2 bits (243),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 53/65 (82%), Gaps = 5/65 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLE ESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEAESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGK  213
            IFAGK
Sbjct  120  IFAGK  124



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   209 bits (532),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   147 bits (372),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 78/90 (87%), Gaps = 5/90 (6%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRL  288
            IFAGKQLEDGRTLADYNIQKESTLHLVLR 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRF  225



>gb|AIZ74335.1| polyubiquitin 3, partial [Pinus massoniana]
Length=244

 Score =   209 bits (533),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  54   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  108

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  109  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  168

Query  379  AQIQDK  396
            A+IQDK
Sbjct  169  AKIQDK  174


 Score =   199 bits (507),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 106/118 (90%), Gaps = 5/118 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  130  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  184

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDN  372
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVE+SDTIDN
Sbjct  185  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDN  242


 Score =   186 bits (471),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/98 (95%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +1

Query  103  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  282
            TITLE+ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  1    TITLELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60

Query  283  RLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            RLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  98


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 5/44 (11%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVK  150
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  206  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVK  244



>gb|AAR32784.1| polyubiquitin [Clusia minor]
Length=223

 Score =   209 bits (531),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  17   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  71

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  72   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  131

Query  379  AQIQDK  396
            A+IQDK
Sbjct  132  AKIQDK  137


 Score =   175 bits (443),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 92/103 (89%), Gaps = 5/103 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  93   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  147

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  327
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  148  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  190


 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = +1

Query  214  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQD  393
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQD
Sbjct  1    QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  60

Query  394  K  396
            K
Sbjct  61   K  61



>gb|KGU26596.1| polyubiquitin, partial [Candida albicans P34048]
 gb|KGU29736.1| polyubiquitin, partial [Candida albicans P75063]
Length=114

 Score =   205 bits (521),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  109


 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 44/55 (80%), Gaps = 5/55 (9%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  183
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPP
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP  114



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   210 bits (535),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/111 (95%), Positives = 109/111 (98%), Gaps = 0/111 (0%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  243
            +KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  47   IKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  106

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  107  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  157


 Score =   208 bits (530),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  114  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  228

Query  382  QIQDK  396
            +IQDK
Sbjct  229  KIQDK  233


 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  190  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  244

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  245  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  277



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   212 bits (540),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 114/127 (90%), Gaps = 4/127 (3%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +  + LF+H +       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  21   VGRVELFFHGQRGG----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  76

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNR  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN 
Sbjct  77   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  136

Query  376  QAQIQDK  396
            +A+IQDK
Sbjct  137  KAKIQDK  143


 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  99   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  153

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  154  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  213

Query  379  AQIQDK  396
            A+IQDK
Sbjct  214  AKIQDK  219


 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  175  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  229

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  230  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  289

Query  379  AQIQDK  396
            A+IQDK
Sbjct  290  AKIQDK  295


 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  251  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  305

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  306  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   209 bits (531),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLXLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVL LRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   209 bits (532),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   209 bits (532),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AQIQDK  396
            A+IQDK
Sbjct  124  AKIQDK  129


 Score =   206 bits (525),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AQIQDK  396
            A+IQDK
Sbjct  200  AKIQDK  205


 Score =   152 bits (385),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 81/93 (87%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  161  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  215

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG
Sbjct  216  IFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGG  248


 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  53



>ref|XP_010938173.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Elaeis 
guineensis]
Length=232

 Score =   209 bits (531),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (393),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 82/92 (89%), Gaps = 5/92 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152



>gb|AFJ93197.1| ubiquitin, partial [Eremosparton songoricum]
Length=142

 Score =   206 bits (523),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AQIQDK  396
             +IQDK
Sbjct  124  TKIQDK  129


 Score = 94.7 bits (234),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 50/52 (96%), Gaps = 0/52 (0%)
 Frame = +1

Query  241  DYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            DYNIQ+ESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  2    DYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  53


 Score = 93.2 bits (230),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 51/63 (81%), Gaps = 5/63 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  139

Query  199  IFA  207
            IFA
Sbjct  140  IFA  142



>ref|XP_008809849.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=153

 Score =   206 bits (524),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG PPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGXPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   158 bits (400),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  153



>gb|ABH10622.2| ubiquitin [Nicotiana tabacum]
Length=143

 Score =   206 bits (523),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/108 (96%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  73   QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  252
            QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI
Sbjct  1    QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  60

Query  253  QKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            QKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  108


 Score =   140 bits (353),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 74/85 (87%), Gaps = 5/85 (6%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  64   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  118

Query  199  IFAGKQLEDGRTLADYNIQKESTLH  273
            IFAGKQLEDGRTLADYNIQKESTLH
Sbjct  119  IFAGKQLEDGRTLADYNIQKESTLH  143



>dbj|GAC77607.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAK66521.1| ubiquitin domain containing protein [Pseudozyma antarctica]
Length=228

 Score =   208 bits (530),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  303
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG +
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  154



>ref|XP_010069740.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Eucalyptus 
grandis]
Length=232

 Score =   208 bits (530),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 82/92 (89%), Gaps = 5/92 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152



>dbj|GAC94856.1| ubiquitin [Pseudozyma hubeiensis SY62]
Length=228

 Score =   208 bits (530),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  303
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG +
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  154



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   209 bits (533),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (530),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   201 bits (510),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 106/118 (90%), Gaps = 5/118 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDN  372
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  253



>ref|XP_003607668.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=497

 Score =   216 bits (550),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +1

Query  31   LFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  210
            LF+ LR      KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  207  LFFLLRQFYDSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  266

Query  211  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQ  390
            KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQ
Sbjct  267  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  326

Query  391  DK  396
            DK
Sbjct  327  DK  328


 Score =   208 bits (530),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  285  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  339

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A
Sbjct  340  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  399

Query  382  QIQDK  396
            +IQDK
Sbjct  400  KIQDK  404


 Score =   182 bits (461),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 97/108 (90%), Gaps = 5/108 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  361  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  415

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLE  345
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLE
Sbjct  416  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  463



>ref|XP_011390959.1| putative polyubiquitin [Ustilago maydis 521]
 gb|KIS67457.1| putative polyubiquitin [Ustilago maydis 521]
Length=228

 Score =   208 bits (530),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  303
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG +
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  154



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   209 bits (532),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AQIQDK  396
            A+IQDK
Sbjct  124  AKIQDK  129


 Score =   209 bits (532),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AQIQDK  396
            A+IQDK
Sbjct  200  AKIQDK  205


 Score =   156 bits (394),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  161  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  215

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  216  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  248


 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  53



>gb|EGA81850.1| Ubi4p [Saccharomyces cerevisiae Lalvin QA23]
Length=123

 Score =   204 bits (520),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  109


 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 48/59 (81%), Gaps = 5/59 (8%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQ +
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQEV  119



>gb|KIR83632.1| polyubiquitin, partial [Cryptococcus gattii IND107]
Length=218

 Score =   207 bits (528),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  54   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  108

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  109  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  168

Query  379  AQIQDK  396
            A+IQDK
Sbjct  169  AKIQDK  174


 Score =   185 bits (470),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/98 (95%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +1

Query  103  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  282
            TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVL
Sbjct  1    TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVL  60

Query  283  RLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            RLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  98


 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  130  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  184

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  185  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  217



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   208 bits (529),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>emb|CCO30213.1| Polyubiquitin 3 [Rhizoctonia solani AG-1 IB]
Length=224

 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  93   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  152

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  153  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  201


 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 59/71 (83%), Gaps = 5/71 (7%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  157  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  211

Query  199  IFAGKQLEDGR  231
            IFAGKQLEDG 
Sbjct  212  IFAGKQLEDGH  222



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|AIS71924.1| polyubiquitin [Mangifera indica]
Length=229

 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  185


 Score =   206 bits (523),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLH VLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHRVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   113 bits (282),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 61/71 (86%), Gaps = 5/71 (7%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  202  FAGKQLEDGRT  234
            FAGKQLEDGRT
Sbjct  197  FAGKQLEDGRT  207



>gb|AAM63271.1| unknown [Arabidopsis thaliana]
Length=154

 Score =   205 bits (522),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152



>emb|CAC94926.1| putative ubiquitin [Pleurotus sp. 'Florida']
Length=243

 Score =   208 bits (530),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  46   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  100

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  101  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  160

Query  379  AQIQDK  396
            A+IQDK
Sbjct  161  AKIQDK  166


 Score =   201 bits (511),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 109/122 (89%), Gaps = 5/122 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  122  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  176

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  177  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  236

Query  379  AQ  384
            A+
Sbjct  237  AR  238


 Score =   172 bits (436),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/90 (94%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +1

Query  127  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  306
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  60

Query  307  FVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            FVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDK  90



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   206 bits (525),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|EGA85719.1| Ubi4p [Saccharomyces cerevisiae VL3]
Length=123

 Score =   204 bits (519),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  109


 Score = 90.1 bits (222),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 50/62 (81%), Gaps = 5/62 (8%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  202  FA  207
              
Sbjct  121  LC  122



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   208 bits (529),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   206 bits (525),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV  229



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   209 bits (533),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  76   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  130

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  131  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  190

Query  379  AQIQDK  396
            A+IQDK
Sbjct  191  AKIQDK  196


 Score =   209 bits (533),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  152  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  206

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  207  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  266

Query  379  AQIQDK  396
            A+IQDK
Sbjct  267  AKIQDK  272


 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  1    TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  55

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A
Sbjct  56   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  115

Query  382  QIQDK  396
            +IQDK
Sbjct  116  KIQDK  120


 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 48/59 (81%), Gaps = 5/59 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  228  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  281



>ref|XP_002447145.1| hypothetical protein SORBIDRAFT_06g029360 [Sorghum bicolor]
 gb|EES11473.1| hypothetical protein SORBIDRAFT_06g029360 [Sorghum bicolor]
Length=153

 Score =   205 bits (522),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL+DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG +ITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKSITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (391),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGK+ITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKSITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +    L  +L    S  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  36   LTHWQLRSYLVFCFSSHKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  95

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNR  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN 
Sbjct  96   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  155

Query  376  QAQIQDK  396
            +A+IQDK
Sbjct  156  KAKIQDK  162


 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  118  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  172

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  173  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  232

Query  379  AQIQDK  396
            A+IQDK
Sbjct  233  AKIQDK  238


 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  194  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  248

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  249  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  308

Query  379  AQIQDK  396
            A+IQDK
Sbjct  309  AKIQDK  314


 Score =   126 bits (316),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 67/78 (86%), Gaps = 5/78 (6%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  270  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  324

Query  199  IFAGKQLEDGRTLADYNI  252
            IFAGKQLEDGRTLADYNI
Sbjct  325  IFAGKQLEDGRTLADYNI  342



>gb|ACB87916.1| polyubiquitin 1 [Malus domestica]
Length=208

 Score =   207 bits (526),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG +ITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGESITLEVESSDTIDNVKAKIQDK  109


 Score =   203 bits (516),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTG++ITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGESITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGR+LADYNIQKESTLHLVLRLRGGM IFVK+LTG TITLEVESS+TIDN Q
Sbjct  120  IFAGKQLEDGRSLADYNIQKESTLHLVLRLRGGMHIFVKSLTGKTITLEVESSETIDNVQ  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 52/64 (81%), Gaps = 5/64 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       M IFVK+LTGKTITLEVESS+TIDNV+AKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MHIFVKSLTGKTITLEVESSETIDNVQAKIQDKEGIPPDQQRL  195

Query  199  IFAG  210
            IFAG
Sbjct  196  IFAG  199



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   209 bits (532),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   207 bits (528),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 97/109 (89%), Gaps = 5/109 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLE  345
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLE
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  244



>gb|EMS22298.1| polyubiquitin [Rhodosporidium toruloides NP11]
 emb|CDR43704.1| RHTO0S08e04698g1_1 [Rhodosporidium toruloides]
Length=212

 Score =   207 bits (527),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   164 bits (416),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 96/126 (76%), Gaps = 23/126 (18%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLR                  VESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLR------------------VESSDTIDNVK  161

Query  379  AQIQDK  396
            A+IQDK
Sbjct  162  AKIQDK  167


 Score =   125 bits (315),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +1

Query  106  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR  285
            + L VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLR
Sbjct  147  LRLRVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  206

Query  286  LRGG  297
            LRGG
Sbjct  207  LRGG  210



>gb|AAF21992.1| polyubiquitin [Lilium longiflorum]
Length=153

 Score =   205 bits (521),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDREGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            I KESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+I DK
Sbjct  61   IHKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIHDK  109


 Score =   132 bits (332),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 75/92 (82%), Gaps = 7/92 (8%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPP   RLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIHDKEGIPP-TTRLI  119

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            FAG   EDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  120  FAGTA-EDGRTLADYNIQKESTLHLVLRLRGG  150



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   209 bits (531),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  25   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  79

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  80   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  139

Query  379  AQIQDK  396
            A+IQDK
Sbjct  140  AKIQDK  145


 Score =   207 bits (526),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  101  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  379  AQIQDK  396
             +IQDK
Sbjct  216  TKIQDK  221


 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 81/94 (86%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  177  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  231

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  232  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  265


 Score =   130 bits (326),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  190  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTID  369
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  370  NRQAQIQDK  396
            N +A+IQDK
Sbjct  61   NVKAKIQDK  69



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   207 bits (528),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   206 bits (525),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   154 bits (390),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_001701379.1| bi-ubiquitin, major isoform [Chlamydomonas reinhardtii]
 gb|EDO97495.1| bi-ubiquitin, major isoform [Chlamydomonas reinhardtii]
Length=153

 Score =   205 bits (521),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTI+N +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDK  109


 Score =   155 bits (391),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  152



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 111/126 (88%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK L G TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   152 bits (384),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 80/94 (85%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVK L GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKPLPGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 2/118 (2%)
 Frame = +1

Query  49   HSCSYLK--MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  222
            H  S+L+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE
Sbjct  144  HLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  203

Query  223  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  204  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  261


 Score =   210 bits (534),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AQIQDK  396
            A+IQDK
Sbjct  332  AKIQDK  337


 Score =   208 bits (530),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 111/126 (88%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 81/93 (87%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  228



>ref|XP_002957068.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ41870.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=153

 Score =   205 bits (521),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTI+N +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDK  109


 Score =   155 bits (393),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  153



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   154 bits (390),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC  229



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AQIQDK  396
            A+IQDK
Sbjct  145  AKIQDK  150


 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AQIQDK  396
            A+IQDK
Sbjct  221  AKIQDK  226


 Score =   156 bits (394),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  182  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  236

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  237  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/74 (95%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  175  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVES  354
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  355  SDTIDNRQAQIQDK  396
            SDTIDN +A+IQDK
Sbjct  61   SDTIDNVKAKIQDK  74



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 114/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L + LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  63   STLHLVFRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  117

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV+TLTG TITLEVESSDT+DN +
Sbjct  118  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVK  177

Query  379  AQIQDK  396
            A+IQDK
Sbjct  178  AKIQDK  183


 Score =   209 bits (531),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRL
Sbjct  139  STLHLVLRLRGG-----MQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  193

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  194  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  253

Query  379  AQIQDK  396
            A+IQDK
Sbjct  254  AKIQDK  259


 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 108/121 (89%), Gaps = 5/121 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  215  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  269

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  270  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  329

Query  379  A  381
            A
Sbjct  330  A  330


 Score =   181 bits (458),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 99/109 (91%), Gaps = 2/109 (2%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVK L  KTITLEV+    IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  58

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLV RLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  107



>gb|AGZ15412.1| fiber polyubiquitin [Phaseolus vulgaris]
Length=229

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   206 bits (524),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 112/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVES DTIDN +A
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKA  180

Query  382  QIQDK  396
            +IQDK
Sbjct  181  KIQDK  185


 Score =   139 bits (351),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 76/93 (82%), Gaps = 5/93 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESFDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            FAGKQLEDG TLADYNIQKE TL LVL  RGG 
Sbjct  197  FAGKQLEDGCTLADYNIQKEFTLPLVLCFRGGF  229



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 40/51 (78%), Gaps = 5/51 (10%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  171
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK+
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKK  262



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/110 (96%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +1

Query  67   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  246
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  82   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  141

Query  247  NIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            NIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  142  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  191


 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  147  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  201

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  202  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  261

Query  379  AQIQDK  396
            A+IQDK
Sbjct  262  AKIQDK  267


 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  223  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  277

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  278  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  310


 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 90/115 (78%), Gaps = 6/115 (5%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL----  237
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  238  --ADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
               + +  +          R  MQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   FARNAHTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  115



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  382  QIQDK  396
            +IQDK
Sbjct  181  KIQDK  185


 Score =   208 bits (529),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/108 (88%), Positives = 97/108 (90%), Gaps = 5/108 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLE  345
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLE
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  244



>emb|CBY12791.1| unnamed protein product [Oikopleura dioica]
Length=112

 Score =   203 bits (517),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVE+SDTI+N +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDK  109


 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 40/52 (77%), Gaps = 5/52 (10%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  174
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKE 
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEA  111



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  34   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  88

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  89   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  148

Query  379  AQIQDK  396
            A+IQDK
Sbjct  149  AKIQDK  154


 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  110  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  164

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  165  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  224

Query  379  AQIQDK  396
            A+IQDK
Sbjct  225  AKIQDK  230


 Score =   156 bits (394),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  186  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  240

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  241  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  274


 Score =   150 bits (380),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/78 (95%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +1

Query  163  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITL  342
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  343  EVESSDTIDNRQAQIQDK  396
            EVESSDTIDN +A+IQDK
Sbjct  61   EVESSDTIDNVKAKIQDK  78



>prf||1604470A poly-ubiquitin
Length=272

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  32   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  86

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  87   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  146

Query  379  AQIQDK  396
            A+IQDK
Sbjct  147  AKIQDK  152


 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  108  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  162

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  163  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  222

Query  379  AQIQDK  396
            A+IQDK
Sbjct  223  AKIQDK  228


 Score =   155 bits (393),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  184  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  238

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  239  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  271


 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/75 (95%), Positives = 73/75 (97%), Gaps = 0/75 (0%)
 Frame = +1

Query  172  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVE  351
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  352  SSDTIDNRQAQIQDK  396
            SSDTIDN +A+IQDK
Sbjct  62   SSDTIDNVKAKIQDK  76



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 71/83 (86%), Gaps = 5/83 (6%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKEST  267
            IFAGKQLEDGRTLADYNIQKE+ 
Sbjct  272  IFAGKQLEDGRTLADYNIQKENA  294



>gb|KIK81924.1| hypothetical protein PAXRUDRAFT_736824 [Paxillus rubicundulus 
Ve08.2h10]
Length=235

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +1

Query  37   YHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ  216
            Y  R   +  +MQIFVKTLTGKTITLEV+SSD+IDNVKAKIQDKEGIPPDQQRLIFAGKQ
Sbjct  25   YQTRKPHASTRMQIFVKTLTGKTITLEVDSSDSIDNVKAKIQDKEGIPPDQQRLIFAGKQ  84

Query  217  LEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            LEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEV+SSD+IDN +A+IQDK
Sbjct  85   LEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVDSSDSIDNVKAKIQDK  144


 Score =   201 bits (511),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 111/126 (88%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEV+SSD+IDNVKAKIQDKEGIPPDQQRL
Sbjct  100  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVDSSDSIDNVKAKIQDKEGIPPDQQRL  154

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEV+ SDTI N +
Sbjct  155  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVDPSDTIGNVK  214

Query  379  AQIQDK  396
            A+IQDK
Sbjct  215  AKIQDK  220


 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 51/65 (78%), Gaps = 5/65 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEV+ SDTI NVKAKIQDKEGIPPDQQRL
Sbjct  176  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVDPSDTIGNVKAKIQDKEGIPPDQQRL  230

Query  199  IFAGK  213
            IFA K
Sbjct  231  IFARK  235



>gb|AAO43309.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   208 bits (529),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AQIQDK  396
            A+IQDK
Sbjct  124  AKIQDK  129


 Score =   206 bits (525),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AQIQDK  396
            A+IQDK
Sbjct  200  AKIQDK  205


 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ+RL
Sbjct  161  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQKRL  215

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG+
Sbjct  216  IFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGGI  249


 Score = 97.8 bits (242),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEV+SSDTIDN +A+IQDK
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDK  53



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   TNLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKE+ LHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 80/94 (85%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVK LTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKNLTGKTITLEVESSDTIDNVKAKIQDKEDIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>gb|AAO42469.1| putative polyubiquitin [Arabidopsis lyrata]
Length=289

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  56   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  110

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  111  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  170

Query  379  AQIQDK  396
            A+IQDK
Sbjct  171  AKIQDK  176


 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 103/117 (88%), Gaps = 5/117 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  132  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  186

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTID  369
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESS+  D
Sbjct  187  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSEIQD  243


 Score =   191 bits (484),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/100 (96%), Positives = 98/100 (98%), Gaps = 0/100 (0%)
 Frame = +1

Query  97   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  276
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  277  VLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            VLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  100


 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 74/93 (80%), Gaps = 13/93 (14%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESS+        IQDKEGIPPDQQRL
Sbjct  208  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSE--------IQDKEGIPPDQQRL  254

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  255  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  287



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   SCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  231
            S    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  31   SPRLPKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  90

Query  232  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  91   TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  145


 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  101  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  379  AQIQDK  396
            A+IQDK
Sbjct  216  AKIQDK  221


 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  177  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  231

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  232  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  291

Query  379  AQIQDK  396
            A+IQDK
Sbjct  292  AKIQDK  297


 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  253  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  307

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  308  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  340



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVES DTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   157 bits (396),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  7    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  61

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  62   IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  121

Query  379  AQIQDK  396
            A+IQDK
Sbjct  122  AKIQDK  127


 Score =   207 bits (528),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  83   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  137

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  138  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  197

Query  379  AQIQDK  396
            A+IQDK
Sbjct  198  AKIQDK  203


 Score =   155 bits (392),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  159  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  213

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  214  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  247


 Score = 94.7 bits (234),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/51 (92%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +1

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            YNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  51



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            + +L+ F   + S   +KMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQR
Sbjct  27   LGALSPFDLSKFSSLRVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQR  86

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNR  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN 
Sbjct  87   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  146

Query  376  QAQIQDK  396
            +A+IQDK
Sbjct  147  KAKIQDK  153


 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  109  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  163

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  164  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  223

Query  379  AQIQDK  396
            A+IQDK
Sbjct  224  AKIQDK  229


 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  185  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  239

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDT+DN +
Sbjct  240  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVK  299

Query  379  AQIQDK  396
            A+IQDK
Sbjct  300  AKIQDK  305


 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRL
Sbjct  261  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  315

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  316  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  375

Query  379  AQIQDK  396
            A+IQDK
Sbjct  376  AKIQDK  381


 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  337  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  391

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  392  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  425



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   157 bits (396),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (530),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   206 bits (524),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLED RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   156 bits (395),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   157 bits (396),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  305



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  56   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  110

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  111  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  170

Query  379  AQIQDK  396
            A+IQDK
Sbjct  171  AKIQDK  176


 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  132  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  186

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  187  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  246

Query  379  AQIQDK  396
            A+IQDK
Sbjct  247  AKIQDK  252


 Score =   191 bits (484),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/100 (96%), Positives = 98/100 (98%), Gaps = 0/100 (0%)
 Frame = +1

Query  97   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  276
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  277  VLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            VLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  100


 Score =   156 bits (395),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  208  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  262

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  263  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  296



>gb|ACB87917.1| polyubiquitin 2 [Malus domestica]
Length=177

 Score =   205 bits (522),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  34   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  88

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLR GMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  89   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRRGMQIFVKTLTGKTITLEVESSDTIDNVK  148

Query  379  AQIQDK  396
            A+IQDK
Sbjct  149  AKIQDK  154


 Score =   150 bits (379),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/78 (95%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +1

Query  163  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITL  342
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  343  EVESSDTIDNRQAQIQDK  396
            EVESSDTIDN +A+IQDK
Sbjct  61   EVESSDTIDNVKAKIQDK  78


 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 61/73 (84%), Gaps = 5/73 (7%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK+GIPPDQQ L
Sbjct  110  STLHLVLRLRRG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKDGIPPDQQTL  164

Query  199  IFAGKQLEDGRTL  237
            IFAGKQLEDGRTL
Sbjct  165  IFAGKQLEDGRTL  177



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQL+DGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLDDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   208 bits (530),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVE+SDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (530),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 47/58 (81%), Gaps = 5/58 (9%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  192
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  269



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  382  QIQDK  396
            +IQDK
Sbjct  181  KIQDK  185


 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 76/86 (88%), Gaps = 5/86 (6%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  202  FAGKQLEDGRTLADYNIQKESTLHLV  279
            FAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLV  222



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   193 bits (490),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 103/117 (88%), Gaps = 5/117 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTID  369
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSD  D
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDIQD  252


 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 74/93 (80%), Gaps = 13/93 (14%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSD        IQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSD--------IQDKEGIPPDQQRL  263

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  264  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  296



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AQIQDK  396
            A+IQDK
Sbjct  221  AKIQDK  226


 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  182  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  236

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  237  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  296

Query  379  AQIQDK  396
            A+IQDK
Sbjct  297  AKIQDK  302


 Score =   208 bits (529),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AQIQDK  396
            A+IQDK
Sbjct  145  AKIQDK  150


 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/74 (93%), Positives = 72/74 (97%), Gaps = 0/74 (0%)
 Frame = +1

Query  175  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVES  354
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTG TITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  355  SDTIDNRQAQIQDK  396
            SDTIDN +A+IQDK
Sbjct  61   SDTIDNVKAKIQDK  74


 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 42/53 (79%), Gaps = 5/53 (9%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  177
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  258  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  305



>gb|EWZ87538.1| ubiquitin C [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXM08999.1| ubiquitin C [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
Length=153

 Score =   204 bits (519),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  109


 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  152



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 81/92 (88%), Gaps = 5/92 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  294
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   206 bits (524),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   205 bits (522),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  109


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003648495.1| hypothetical protein Ecym_8408 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET41678.1| Hypothetical protein Ecym_8408 [Eremothecium cymbalariae DBVPG#7215]
Length=153

 Score =   204 bits (519),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  109


 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  152



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_011465781.1| PREDICTED: polyubiquitin-like, partial [Fragaria vesca subsp. 
vesca]
Length=173

 Score =   205 bits (521),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/108 (94%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = +1

Query  73   QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  252
            QIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI
Sbjct  6    QIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  65

Query  253  QKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            QKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A++QDK
Sbjct  66   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKVQDK  113


 Score =   132 bits (333),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 71/87 (82%), Gaps = 5/87 (6%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAK+QDKEGIPPDQQRLI
Sbjct  70   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKVQDKEGIPPDQQRLI  124

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVL  282
            FAGKQLEDGRTLADYNIQKES      
Sbjct  125  FAGKQLEDGRTLADYNIQKESPWWCWF  151



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   157 bits (396),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>gb|EMS24129.1| ubiquitin C [Rhodosporidium toruloides NP11]
Length=238

 Score =   207 bits (527),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   201 bits (510),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 113/134 (84%), Gaps = 13/134 (10%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXT--------ITLEVES  354
            IFAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIFVKTLTG T        ITLEVES
Sbjct  120  IFAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSITLEVES  179

Query  355  SDTIDNRQAQIQDK  396
            SDTIDN +A+IQDK
Sbjct  180  SDTIDNVKAKIQDK  193


 Score =   147 bits (371),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 81/101 (80%), Gaps = 13/101 (13%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESS--------DTIDNVKAKIQDKEG  174
             +L+L   LR       MQIFVKTLTGKTITLEVESS        DTIDNVKAKIQDKEG
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSITLEVESSDTIDNVKAKIQDKEG  195

Query  175  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  196  IPPDQQRLIFAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  236



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   206 bits (523),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   157 bits (396),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  68   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  122

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  123  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  182

Query  379  AQIQDK  396
            A+IQDK
Sbjct  183  AKIQDK  188


 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  144  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  258

Query  379  AQIQDK  396
            A+IQDK
Sbjct  259  AKIQDK  264


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  112


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  220  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  274

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  275  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  308


 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +1

Query  289  RGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            RGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  36



>ref|NP_564675.1| ubiquitin-like [Arabidopsis thaliana]
 sp|Q3E7K8.1|UBQ12_ARATH RecName: Full=Polyubiquitin 12; Contains: RecName: Full=Ubiquitin-related 
1; Contains: RecName: Full=Ubiquitin-related 2; 
Contains: RecName: Full=Ubiquitin-related 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE33181.1| polyubiquitin 12 [Arabidopsis thaliana]
Length=230

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L    R       MQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRL
Sbjct  65   STLHLLLRFRGG-----MQIFVKTLTGKTITLEVESSDTIDNLKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   191 bits (486),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIF+KTLTGKT  LEVESSDTIDNVKAKIQD EGIPPDQ RLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFLKTLTGKTKVLEVESSDTIDNVKAKIQDIEGIPPDQHRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            +Q++STLHL+LR RGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   VQEDSTLHLLLRFRGGMQIFVKTLTGKTITLEVESSDTIDNLKAKIQDK  109


 Score =   149 bits (377),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 80/93 (86%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI PDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGISPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQ EDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQHEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            ++IQDK
Sbjct  180  SKIQDK  185


 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  109


 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGC  305



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   206 bits (523),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   206 bits (525),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR 
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRF  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   206 bits (525),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQD+
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQ  109


 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>dbj|BAC56573.1| similar to polyubiquitin [Bos taurus]
Length=171

 Score =   205 bits (521),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 111/119 (93%), Gaps = 1/119 (1%)
 Frame = +1

Query  40   HLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  219
            HLR   S +KMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  1    HLR-IHSQVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL  59

Query  220  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            EDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVE SDTI+N +A+IQDK
Sbjct  60   EDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDK  118


 Score =   171 bits (432),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 91/103 (88%), Gaps = 5/103 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  74   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRL  128

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  327
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  129  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  171



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            ++IQDK
Sbjct  180  SKIQDK  185


 Score =   204 bits (519),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  109


 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   206 bits (525),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVES+DTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDK  109


 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_007873662.1| hypothetical protein PNEG_01699 [Pneumocystis murina B123]
 gb|EMR09940.1| hypothetical protein PNEG_01699 [Pneumocystis murina B123]
Length=153

 Score =   204 bits (519),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  109


 Score =   154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV  153



>gb|EHN01342.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EIW08781.1| Ubi4p [Saccharomyces cerevisiae CEN.PK113-7D]
Length=153

 Score =   204 bits (519),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  109


 Score =   153 bits (387),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  152



>gb|EAX04506.1| ubiquitin B, isoform CRA_e [Homo sapiens]
Length=152

 Score =   204 bits (519),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVE SDTI+N +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDK  109


 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 43/54 (80%), Gaps = 5/54 (9%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  183
            +L+L   LR       MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPP
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP  114



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/116 (92%), Positives = 110/116 (95%), Gaps = 2/116 (2%)
 Frame = +1

Query  55   CSYL--KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  228
            CS L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  8    CSLLAYSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  67

Query  229  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            RTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  68   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  123


 Score =   208 bits (530),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  79   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  133

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  134  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  193

Query  379  AQIQDK  396
            A+IQDK
Sbjct  194  AKIQDK  199


 Score =   208 bits (530),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  155  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  209

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  210  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  269

Query  379  AQIQDK  396
            A+IQDK
Sbjct  270  AKIQDK  275


 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  231  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  285

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  286  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  319



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  116  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  170

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  171  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  230

Query  379  AQIQDK  396
            A+IQDK
Sbjct  231  AKIQDK  236


 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  192  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  246

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  247  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  306

Query  379  AQIQDK  396
            A+IQDK
Sbjct  307  AKIQDK  312


 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 107/160 (67%), Gaps = 51/160 (32%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  174
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  175  --------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  276
                                      IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  277  VLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            VLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  160


 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  268  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  322

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  323  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  355



>dbj|GAK65396.1| ubiquitin [Pseudozyma antarctica]
Length=334

 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 114/127 (90%), Gaps = 6/127 (5%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +CS  LF  L+       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  18   LCSSALFPLLQ------AMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  71

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNR  375
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN 
Sbjct  72   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  131

Query  376  QAQIQDK  396
            +A+IQDK
Sbjct  132  KAKIQDK  138


 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  94   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  148

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  149  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  208

Query  379  AQIQDK  396
            A+IQDK
Sbjct  209  AKIQDK  214


 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  170  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  224

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  225  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  284

Query  379  AQIQDK  396
            A+IQDK
Sbjct  285  AKIQDK  290


 Score =   155 bits (391),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  246  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  300

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  301  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  333



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (533),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   162 bits (411),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 85/97 (88%), Gaps = 5/97 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  309
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI 
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIL  308



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   206 bits (523),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   154 bits (390),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 81/94 (86%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG 
Sbjct  272  IFAGKQLEDGRTLPDYNIQKESTLHLVLRLRGGF  305



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (532),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003687789.1| hypothetical protein TPHA_0K02250 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE65355.1| hypothetical protein TPHA_0K02250 [Tetrapisispora phaffii CBS 
4417]
Length=153

 Score =   204 bits (518),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  109


 Score =   153 bits (386),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC  153



>gb|AES89856.2| polyubiquitin 3 [Medicago truncatula]
Length=231

 Score =   206 bits (525),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   192 bits (488),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 108/126 (86%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFV TLTG TITL+VESSDTI + +
Sbjct  120  IFAGKQLEDGRTLGDYNIQKESTLHLVLRLRGGMQIFVNTLTGKTITLDVESSDTIADVK  179

Query  379  AQIQDK  396
              +++K
Sbjct  180  LTLEEK  185


 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 70/93 (75%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFV TLTGKTITL+VESSDTI +VK  +++K GIP DQ R+
Sbjct  141  STLHLVLRLRGG-----MQIFVNTLTGKTITLDVESSDTIADVKLTLEEKVGIPLDQVRV  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            + AGKQL+D  TLA YNIQKESTLH+VL++ GG
Sbjct  196  VIAGKQLKDSYTLAHYNIQKESTLHMVLQVFGG  228



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   204 bits (519),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 110/123 (89%), Gaps = 5/123 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AQI  387
            A+I
Sbjct  332  AKI  334



>emb|CCF48657.1| probable polyubiquitin [Ustilago hordei]
Length=228

 Score =   206 bits (525),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEPSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (391),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  303
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG +
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAK  154



>emb|CCK72367.1| hypothetical protein KNAG_0J02880 [Kazachstania naganishii CBS 
8797]
 gb|KGR16822.1| polyubiquitin [Candida albicans P37037]
Length=153

 Score =   204 bits (518),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  109


 Score =   153 bits (387),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  153



>gb|AHA84132.1| polyubiquitin [Phaseolus vulgaris]
Length=299

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  117  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  171

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A
Sbjct  172  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  231

Query  382  QIQDK  396
            +IQDK
Sbjct  232  KIQDK  236


 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  112  LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  291
            LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  66   LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  125

Query  292  GGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            GGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  126  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  160


 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 86/112 (77%), Gaps = 5/112 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ+LI
Sbjct  193  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQKLI  247

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESS  357
            FAGKQLEDGRTL DYNIQ+ S L  + +  GG QIF++ LTG TI L    S
Sbjct  248  FAGKQLEDGRTLGDYNIQRGSPLPFIFKAPGGRQIFIRPLTGKTIELVCCCS  299



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AQIQDK  396
            A+IQDK
Sbjct  332  AKIQDK  337


 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score = 76.3 bits (186),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 43/54 (80%), Gaps = 5/54 (9%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  180
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  341



>ref|XP_003082269.1| polyubiquitin (ISS) [Ostreococcus tauri]
Length=288

 Score =   208 bits (530),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  42   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  96

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  156

Query  382  QIQDK  396
            +IQDK
Sbjct  157  KIQDK  161


 Score =   208 bits (530),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  118  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  172

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A
Sbjct  173  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  232

Query  382  QIQDK  396
            +IQDK
Sbjct  233  KIQDK  237


 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/76 (93%), Positives = 74/76 (97%), Gaps = 0/76 (0%)
 Frame = +1

Query  169  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEV  348
            +GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEV
Sbjct  10   DGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  69

Query  349  ESSDTIDNRQAQIQDK  396
            ESSDTIDN +A+IQDK
Sbjct  70   ESSDTIDNVKAKIQDK  85


 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 59/69 (86%), Gaps = 5/69 (7%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  194  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  248

Query  202  FAGKQLEDG  228
            FAGKQLEDG
Sbjct  249  FAGKQLEDG  257



>prf||1101405A ubiquitin precursor
Length=191

 Score =   205 bits (521),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  27   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  81

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  82   IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  141

Query  379  AQIQDK  396
            ++IQDK
Sbjct  142  SKIQDK  147


 Score =   153 bits (387),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  103  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  157

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  158  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  190


 Score =   131 bits (330),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  184  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDT  363
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDT
Sbjct  1    DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  60

Query  364  IDNRQAQIQDK  396
            IDN +++IQDK
Sbjct  61   IDNVKSKIQDK  71



>ref|XP_006287868.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
 gb|EOA20766.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
Length=407

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 115/125 (92%), Gaps = 4/125 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            S NLF   R   S+ KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  14   SSNLF---RTILSF-KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  69

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A
Sbjct  70   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  129

Query  382  QIQDK  396
            +IQDK
Sbjct  130  KIQDK  134


 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  90   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  144

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  145  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  204

Query  379  AQIQDK  396
            A+IQDK
Sbjct  205  AKIQDK  210


 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  166  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  220

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  221  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  280

Query  379  AQIQDK  396
            A+IQDK
Sbjct  281  AKIQDK  286


 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  242  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  296

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  297  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  356

Query  379  AQIQDK  396
            A+IQDK
Sbjct  357  AKIQDK  362


 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  318  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  372

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  373  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  405



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   207 bits (528),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  100  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  154

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  155  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  214

Query  379  AQIQDK  396
            A+IQDK
Sbjct  215  AKIQDK  220


 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  36   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  95

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN + +IQDK
Sbjct  96   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDK  144


 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 82/94 (87%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  176  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  230

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  231  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  264


 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +1

Query  226  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  68



>gb|AAW73075.1| polyubiquitin [Collozoum sp. DDM-2005]
Length=112

 Score =   202 bits (514),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/109 (92%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITL+VE+SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLDVEASDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITL+VE+SDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLDVEASDTIDNVKAKIQDK  109


 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 42/53 (79%), Gaps = 5/53 (9%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  177
             +L+L   LR       MQIFVKTLTGKTITL+VE+SDTIDNVKAKIQDKEGI
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLDVEASDTIDNVKAKIQDKEGI  112



>emb|CAA25706.1| unnamed protein product [Saccharomyces cerevisiae]
Length=191

 Score =   205 bits (521),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  27   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  81

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  82   IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  141

Query  379  AQIQDK  396
            ++IQDK
Sbjct  142  SKIQDK  147


 Score =   151 bits (382),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 81/93 (87%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  103  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  157

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAG QLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  158  IFAGNQLEDGRTLSDYNIQKESTLHLVLRLRGG  190


 Score =   131 bits (330),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  184  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDT  363
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDT
Sbjct  1    DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  60

Query  364  IDNRQAQIQDK  396
            IDN +++IQDK
Sbjct  61   IDNVKSKIQDK  71



>ref|XP_009609090.1| PREDICTED: polyubiquitin 11, partial [Nicotiana tomentosiformis]
Length=174

 Score =   204 bits (520),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 110/123 (89%), Gaps = 5/123 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  57   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  111

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  112  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  171

Query  379  AQI  387
            A+I
Sbjct  172  AKI  174


 Score =   193 bits (491),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/101 (96%), Positives = 99/101 (98%), Gaps = 0/101 (0%)
 Frame = +1

Query  94   TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  273
            TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH
Sbjct  1    TGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLH  60

Query  274  LVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            LVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  101



>gb|AAO43303.1| putative polyubiquitin [Arabidopsis thaliana]
Length=325

 Score =   209 bits (532),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AQIQDK  396
            A+IQDK
Sbjct  124  AKIQDK  129


 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 110/126 (87%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  160  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRL  214

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTG TITLEVESS TIDN +
Sbjct  215  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSGTIDNVK  274

Query  379  AQIQDK  396
            A+IQDK
Sbjct  275  AKIQDK  280


 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 6/126 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  140  IFAGKQLEDGRTLAD-NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  198

Query  379  AQIQDK  396
            A+IQDK
Sbjct  199  AKIQDK  204


 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 80/93 (86%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVK LTGKTITLEVESS TIDNVKAKIQDKEGIPPDQQRL
Sbjct  236  STLHLVLRLRGG-----MQIFVKNLTGKTITLEVESSGTIDNVKAKIQDKEGIPPDQQRL  290

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  291  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  323


 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  53



>gb|AAO43304.1| putative polyubiquitin [Arabidopsis thaliana]
Length=325

 Score =   209 bits (532),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AQIQDK  396
            A+IQDK
Sbjct  124  AKIQDK  129


 Score =   204 bits (518),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 111/126 (88%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  160  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRL  214

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESS TIDN +
Sbjct  215  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSGTIDNVK  274

Query  379  AQIQDK  396
            A+IQDK
Sbjct  275  AKIQDK  280


 Score =   201 bits (512),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 6/126 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  140  IFAGKQLEDGRTLAD-NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  198

Query  379  AQIQDK  396
            A+IQDK
Sbjct  199  AKIQDK  204


 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 81/93 (87%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESS TIDNVKAKIQDKEGIPPDQQRL
Sbjct  236  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSGTIDNVKAKIQDKEGIPPDQQRL  290

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  291  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  323


 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  53



>gb|AAO43305.1| putative polyubiquitin [Arabidopsis thaliana]
Length=325

 Score =   209 bits (532),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AQIQDK  396
            A+IQDK
Sbjct  124  AKIQDK  129


 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  160  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  214

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESS TIDN +
Sbjct  215  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSGTIDNVK  274

Query  379  AQIQDK  396
            A+IQDK
Sbjct  275  AKIQDK  280


 Score =   201 bits (512),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 6/126 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  140  IFAGKQLEDGRTLAD-NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  198

Query  379  AQIQDK  396
            A+IQDK
Sbjct  199  AKIQDK  204


 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 81/93 (87%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESS TIDNVKAKIQDKEGIPPDQQRL
Sbjct  236  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSGTIDNVKAKIQDKEGIPPDQQRL  290

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  291  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  323


 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  53



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  17   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  71

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  72   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  131

Query  379  AQIQDK  396
            A+IQDK
Sbjct  132  AKIQDK  137


 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  93   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  147

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  148  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  207

Query  379  AQIQDK  396
            A+IQDK
Sbjct  208  AKIQDK  213


 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  169  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  223

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  224  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  283

Query  379  AQIQDK  396
            A+IQDK
Sbjct  284  AKIQDK  289


 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  245  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  299

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  300  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  332


 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +1

Query  253  QKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            QKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  61



>ref|XP_003607659.1| Ubiquitin [Medicago truncatula]
Length=259

 Score =   207 bits (527),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/110 (95%), Positives = 107/110 (97%), Gaps = 0/110 (0%)
 Frame = +1

Query  67   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  246
            +MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR LADY
Sbjct  28   QMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRILADY  87

Query  247  NIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            NIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  88   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  137


 Score =   192 bits (488),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 108/126 (86%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  93   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  147

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL DYNIQKESTLHLVLRLRGGMQIFV TLTG TITL+VESSDTI + +
Sbjct  148  IFAGKQLEDGRTLGDYNIQKESTLHLVLRLRGGMQIFVNTLTGKTITLDVESSDTIADVK  207

Query  379  AQIQDK  396
              +++K
Sbjct  208  LTLEEK  213


 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 70/93 (75%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFV TLTGKTITL+VESSDTI +VK  +++K GIP DQ R+
Sbjct  169  STLHLVLRLRGG-----MQIFVNTLTGKTITLDVESSDTIADVKLTLEEKVGIPLDQVRV  223

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            + AGKQL+D  TLA YNIQKESTLH+VL++ GG
Sbjct  224  VIAGKQLKDSYTLAHYNIQKESTLHMVLQVFGG  256



>gb|ACB87918.1| polyubiquitin 3 [Malus domestica]
Length=188

 Score =   204 bits (520),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  61   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  115

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ+FVKTLTG TITLEVE+SDTIDN +
Sbjct  116  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQMFVKTLTGNTITLEVETSDTIDNVK  175

Query  379  AQIQDK  396
             +IQDK
Sbjct  176  DKIQDK  181


 Score =   199 bits (506),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 101/105 (96%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  82   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  261
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  262  STLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            STLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  105


 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 44/57 (77%), Gaps = 5/57 (9%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  189
             +L+L   LR       MQ+FVKTLTG TITLEVE+SDTIDNVK KIQDKEGIPPDQ
Sbjct  137  STLHLVLRLRGG-----MQMFVKTLTGNTITLEVETSDTIDNVKDKIQDKEGIPPDQ  188



>gb|KIM48035.1| hypothetical protein M413DRAFT_16078 [Hebeloma cylindrosporum 
h7]
Length=381

 Score =   211 bits (536),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 114/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L + LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVFRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AQIQDK  396
            A+IQDK
Sbjct  332  AKIQDK  337


 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 106/109 (97%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLV RLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  348  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  380



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   208 bits (530),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIF+KTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 112/126 (89%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
             +IQDK
Sbjct  256  TKIQDK  261


 Score =   154 bits (389),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 81/93 (87%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|ADO60140.1| ubiquitin [Beauveria bassiana]
Length=215

 Score =   206 bits (523),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            ++IQDK
Sbjct  180  SKIQDK  185


 Score =   204 bits (519),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/109 (94%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  109


 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 69/80 (86%), Gaps = 5/80 (6%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQK  258
            IFAGKQLEDGRTL+DYNIQK
Sbjct  196  IFAGKQLEDGRTLSDYNIQK  215



>gb|KIY97324.1| ubiquitin C, partial [Monoraphidium neglectum]
Length=186

 Score =   204 bits (520),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTI+N +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVK  179

Query  379  AQIQDK  396
            ++IQDK
Sbjct  180  SKIQDK  185


 Score =   203 bits (516),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/109 (93%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTI+N +++IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDK  109


 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 5/51 (10%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  171
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKE
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKE  186



>gb|AFW66438.1| putative ubiquitin family protein, partial [Zea mays]
 gb|AFW66447.1| ubiquitin2, partial [Zea mays]
Length=349

 Score =   210 bits (534),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  186  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  240

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  241  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  300

Query  379  AQIQDK  396
            A+IQDK
Sbjct  301  AKIQDK  306


 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 111/124 (90%), Gaps = 5/124 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQ  390
            A+IQ
Sbjct  180  AKIQ  183


 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  262  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  316

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  317  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  349



>emb|CAI77899.1| polyubiquitine protein [Collozoum inerme]
Length=112

 Score =   202 bits (513),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/109 (93%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITL+VESSDTI NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLDVESSDTISNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVE SDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIDNVKAKIQDK  109


 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 41/53 (77%), Gaps = 5/53 (9%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  177
             +L+L   LR       MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGI
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVEPSDTIDNVKAKIQDKEGI  112



>gb|ACJ85658.1| unknown [Medicago truncatula]
Length=228

 Score =   206 bits (523),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 111/126 (88%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            +FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTG TITLEVESSDTIDN +
Sbjct  120  VFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKALTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/109 (94%), Positives = 105/109 (96%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTI LEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTIILEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN + +IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDK  109


 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 66/87 (76%), Gaps = 6/87 (7%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVK LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKALTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLV  279
            IFAG  L  G  L+   IQKESTLHLV
Sbjct  196  IFAGNNLRMG-GLSLIYIQKESTLHLV  221



>dbj|BAF00213.1| polyubiquitin 4 UBQ4 [Arabidopsis thaliana]
Length=351

 Score =   209 bits (533),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  186  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  240

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  241  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  300

Query  379  AQIQDK  396
            A+IQDK
Sbjct  301  AKIQDK  306


 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 111/124 (90%), Gaps = 5/124 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQ  390
            A+IQ
Sbjct  180  AKIQ  183


 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  262  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  316

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  317  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  349



>emb|CCX04742.1| Similar to Polyubiquitin; acc. no. P0CG74 [Pyronema omphalodes 
CBS 100304]
Length=247

 Score =   206 bits (525),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  118  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  172

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  173  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  232

Query  379  AQIQDK  396
            ++IQDK
Sbjct  233  SKIQDK  238


 Score =   197 bits (502),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/102 (96%), Positives = 101/102 (99%), Gaps = 0/102 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNR  375
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN+
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNQ  102


 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 43/54 (80%), Gaps = 5/54 (9%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  180
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIP
Sbjct  194  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIP  242


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  298  MQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            MQIFVKTLTG TITLEVESSDTIDN +++IQDK
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDK  33



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   209 bits (533),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AQIQDK  396
            A+IQDK
Sbjct  145  AKIQDK  150


 Score =   209 bits (533),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AQIQDK  396
            A+IQDK
Sbjct  221  AKIQDK  226


 Score =   209 bits (533),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  182  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  236

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  237  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  296

Query  379  AQIQDK  396
            A+IQDK
Sbjct  297  AKIQDK  302


 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 81/92 (88%), Gaps = 5/92 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  258  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  312

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  294
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  313  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  344


 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 72/109 (66%), Gaps = 35/109 (32%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLE                                   DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLE-----------------------------------DGRTLADYN  25

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  74



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   208 bits (530),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  72   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  126

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  127  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  186

Query  379  AQIQDK  396
            A+IQDK
Sbjct  187  AKIQDK  192


 Score =   208 bits (530),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  148  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  202

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  203  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  262

Query  379  AQIQDK  396
            A+IQDK
Sbjct  263  AKIQDK  268


 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  52   SCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  231
            + S   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  2    TISSSNMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  61

Query  232  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            TL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  62   TLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  116


 Score =   156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  224  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  278

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  279  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  312



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   208 bits (530),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (530),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 76/88 (86%), Gaps = 5/88 (6%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVL  282
            IFAGKQLEDGRTL+DYNIQKESTLHLV 
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVF  299



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   208 bits (529),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTL+DY+IQKESTLHLVLRLRGG+
Sbjct  272  IFAGKQLEDGRTLSDYSIQKESTLHLVLRLRGGL  305



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   208 bits (529),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQ+K
Sbjct  180  AKIQEK  185


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 82/93 (88%), Gaps = 5/93 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  297
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   208 bits (529),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVE+SDTIDN +
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179

Query  379  AQIQDK  396
            A+IQDK
Sbjct  180  AKIQDK  185


 Score =   208 bits (529),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 113/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQ  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AQIQDK  396
            A+IQDK
Sbjct  256  AKIQDK  261


 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGXTITLEVESSDTIDNRQAQIQDK  396
            IQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDN +A+IQDK
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  109


 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 83/94 (88%), Gaps = 5/94 (5%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  300
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556972490900