BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF048E23

Length=568
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009590611.1|  PREDICTED: tobamovirus multiplication protei...    140   4e-37   Nicotiana tomentosiformis
ref|XP_009788106.1|  PREDICTED: tobamovirus multiplication protei...    140   5e-37   Nicotiana sylvestris
ref|XP_004245872.1|  PREDICTED: tobamovirus multiplication protei...    139   3e-36   Solanum lycopersicum
ref|XP_006358577.1|  PREDICTED: tobamovirus multiplication protei...    138   5e-36   Solanum tuberosum [potatoes]
gb|AIX10945.1|  putative tetraspanin family protein                     136   3e-35   Gardenia jasminoides
gb|KDO40489.1|  hypothetical protein CISIN_1g038963mg                   126   2e-33   Citrus sinensis [apfelsine]
gb|KJB37690.1|  hypothetical protein B456_006G215600                    127   3e-32   Gossypium raimondii
gb|EYU17845.1|  hypothetical protein MIMGU_mgv1a0219312mg               125   5e-32   Erythranthe guttata [common monkey flower]
gb|EYU33040.1|  hypothetical protein MIMGU_mgv1a011318mg                126   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_006485406.1|  PREDICTED: tobamovirus multiplication protei...    126   1e-31   Citrus sinensis [apfelsine]
gb|KHG08208.1|  Tetraspanin-33                                          126   2e-31   Gossypium arboreum [tree cotton]
gb|KHG01123.1|  hypothetical protein F383_00667                         125   2e-31   Gossypium arboreum [tree cotton]
gb|KDO36654.1|  hypothetical protein CISIN_1g033543mg                   121   3e-31   Citrus sinensis [apfelsine]
ref|XP_003517379.1|  PREDICTED: tobamovirus multiplication protei...    124   6e-31   Glycine max [soybeans]
gb|ACU24289.1|  unknown                                                 124   7e-31   Glycine max [soybeans]
gb|KHN42626.1|  hypothetical protein glysoja_018869                     124   8e-31   Glycine soja [wild soybean]
gb|KDP36200.1|  hypothetical protein JCGZ_10291                         124   1e-30   Jatropha curcas
gb|KJB51694.1|  hypothetical protein B456_008G228700                    124   1e-30   Gossypium raimondii
ref|XP_007039575.1|  Tobamovirus multiplication 2A isoform 1            123   2e-30   Theobroma cacao [chocolate]
ref|XP_011018623.1|  PREDICTED: tobamovirus multiplication protei...    123   2e-30   Populus euphratica
gb|KJB25374.1|  hypothetical protein B456_004G188200                    122   3e-30   Gossypium raimondii
ref|XP_008465936.1|  PREDICTED: tobamovirus multiplication protei...    122   3e-30   Cucumis melo [Oriental melon]
ref|XP_007156640.1|  hypothetical protein PHAVU_002G005000g             122   4e-30   Phaseolus vulgaris [French bean]
ref|XP_007156638.1|  hypothetical protein PHAVU_002G004900g             122   5e-30   Phaseolus vulgaris [French bean]
ref|XP_003539155.1|  PREDICTED: tobamovirus multiplication protei...    122   6e-30   Glycine max [soybeans]
gb|EPS67767.1|  hypothetical protein M569_07007                         121   8e-30   Genlisea aurea
gb|KCW71823.1|  hypothetical protein EUGRSUZ_E00307                     120   9e-30   Eucalyptus grandis [rose gum]
gb|EYU33039.1|  hypothetical protein MIMGU_mgv1a011319mg                121   9e-30   Erythranthe guttata [common monkey flower]
ref|XP_008375915.1|  PREDICTED: tobamovirus multiplication protei...    120   1e-29   
ref|XP_006368443.1|  GMFP4 family protein                               120   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_003524459.1|  PREDICTED: tobamovirus multiplication protei...    120   2e-29   
ref|XP_010053569.1|  PREDICTED: tobamovirus multiplication protei...    120   3e-29   Eucalyptus grandis [rose gum]
ref|XP_010055355.1|  PREDICTED: tobamovirus multiplication protei...    120   3e-29   Eucalyptus grandis [rose gum]
ref|XP_004148498.1|  PREDICTED: uncharacterized protein LOC101203030    120   3e-29   Cucumis sativus [cucumbers]
ref|XP_010269960.1|  PREDICTED: tobamovirus multiplication protei...    119   4e-29   Nelumbo nucifera [Indian lotus]
ref|XP_009345636.1|  PREDICTED: tobamovirus multiplication protei...    119   4e-29   Pyrus x bretschneideri [bai li]
ref|XP_002527636.1|  conserved hypothetical protein                     119   4e-29   Ricinus communis
ref|XP_011070225.1|  PREDICTED: tobamovirus multiplication protei...    119   6e-29   Sesamum indicum [beniseed]
gb|KEH31557.1|  tetraspanin family protein                              119   6e-29   Medicago truncatula
ref|XP_010677296.1|  PREDICTED: tobamovirus multiplication protei...    118   1e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010275310.1|  PREDICTED: tobamovirus multiplication protei...    117   2e-28   Nelumbo nucifera [Indian lotus]
gb|AFK40219.1|  unknown                                                 117   3e-28   Lotus japonicus
ref|XP_006415200.1|  hypothetical protein EUTSA_v10008423mg             117   3e-28   Eutrema salsugineum [saltwater cress]
ref|XP_006385612.1|  GMFP4 family protein                               117   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_002279170.2|  PREDICTED: tobamovirus multiplication protei...    116   5e-28   Vitis vinifera
ref|XP_009397919.1|  PREDICTED: tobamovirus multiplication protei...    116   6e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011028243.1|  PREDICTED: tobamovirus multiplication protei...    116   7e-28   Populus euphratica
ref|XP_006305496.1|  hypothetical protein CARUB_v10009959mg             115   1e-27   Capsella rubella
ref|XP_004300273.1|  PREDICTED: tobamovirus multiplication protei...    115   1e-27   Fragaria vesca subsp. vesca
ref|XP_010104372.1|  hypothetical protein L484_023325                   115   2e-27   
ref|XP_004511769.1|  PREDICTED: tetraspanin-20-like isoform X1          115   2e-27   Cicer arietinum [garbanzo]
ref|NP_001240069.1|  uncharacterized protein LOC100793680               115   2e-27   Glycine max [soybeans]
ref|XP_007156641.1|  hypothetical protein PHAVU_002G005100g             115   2e-27   Phaseolus vulgaris [French bean]
ref|XP_003611447.1|  GMFP4                                              114   4e-27   Medicago truncatula
ref|XP_003611445.1|  GMFP4                                              114   5e-27   
ref|XP_010518876.1|  PREDICTED: tobamovirus multiplication protei...    113   8e-27   Tarenaya hassleriana [spider flower]
ref|XP_010461064.1|  PREDICTED: tobamovirus multiplication protei...    113   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010538377.1|  PREDICTED: tobamovirus multiplication protei...    113   1e-26   Tarenaya hassleriana [spider flower]
ref|XP_010919853.1|  PREDICTED: tobamovirus multiplication protei...    113   1e-26   Elaeis guineensis
ref|XP_009151428.1|  PREDICTED: tobamovirus multiplication protei...    112   1e-26   Brassica rapa
emb|CDY48874.1|  BnaA05g35820D                                          114   1e-26   Brassica napus [oilseed rape]
emb|CDY32286.1|  BnaC05g28640D                                          114   2e-26   Brassica napus [oilseed rape]
ref|NP_564399.1|  tobamovirus multiplication 2A protein                 112   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007209447.1|  hypothetical protein PRUPE_ppa009704mg             111   4e-26   Prunus persica
ref|XP_008788690.1|  PREDICTED: tobamovirus multiplication protei...    111   4e-26   Phoenix dactylifera
ref|XP_008784675.1|  PREDICTED: tobamovirus multiplication protei...    111   4e-26   Phoenix dactylifera
ref|XP_008238361.1|  PREDICTED: tobamovirus multiplication protei...    111   4e-26   Prunus mume [ume]
ref|XP_010499788.1|  PREDICTED: tobamovirus multiplication protei...    111   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010478663.1|  PREDICTED: tobamovirus multiplication protei...    111   7e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006305495.1|  hypothetical protein CARUB_v10009959mg             109   2e-25   
ref|XP_010933519.1|  PREDICTED: tobamovirus multiplication protei...    109   3e-25   Elaeis guineensis
emb|CDX93836.1|  BnaA09g24360D                                          108   4e-25   
ref|XP_009114889.1|  PREDICTED: tobamovirus multiplication protei...    108   4e-25   Brassica rapa
ref|XP_002893721.1|  hypothetical protein ARALYDRAFT_473428             108   5e-25   
ref|XP_010934869.1|  PREDICTED: tobamovirus multiplication protei...    108   6e-25   
ref|XP_010934868.1|  PREDICTED: tobamovirus multiplication protei...    108   7e-25   Elaeis guineensis
ref|XP_009398578.1|  PREDICTED: tobamovirus multiplication protei...    107   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004509001.1|  PREDICTED: tetraspanin-20-like isoform X1          107   2e-24   Cicer arietinum [garbanzo]
emb|CDY01278.1|  BnaC05g24540D                                          105   5e-24   
ref|XP_009391069.1|  PREDICTED: tobamovirus multiplication protei...    105   7e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF81337.1|AC007767_17  Contains similarity to GMFP4 from Glyc...    103   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008352453.1|  PREDICTED: tobamovirus multiplication protei...  98.6    6e-22   
ref|XP_009371175.1|  PREDICTED: tobamovirus multiplication protei...  98.6    2e-21   Pyrus x bretschneideri [bai li]
ref|XP_006659267.1|  PREDICTED: tobamovirus multiplication protei...  98.6    3e-21   Oryza brachyantha
gb|EEC83268.1|  hypothetical protein OsI_28600                        93.2    7e-20   Oryza sativa Indica Group [Indian rice]
gb|EEE68396.1|  hypothetical protein OsJ_26735                        92.8    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009385932.1|  PREDICTED: tobamovirus multiplication protei...  92.8    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK22053.1|  unknown                                               92.4    4e-19   Picea sitchensis
ref|NP_001061444.1|  Os08g0282000                                     92.0    6e-19   
ref|XP_004983591.1|  PREDICTED: tetraspanin-18-like isoform X1        91.7    7e-19   
ref|XP_006850026.1|  hypothetical protein AMTR_s00022p00189290        90.5    2e-18   
ref|NP_001150827.1|  tetraspanin family protein                       90.1    2e-18   Zea mays [maize]
gb|ACG40574.1|  tetraspanin family protein                            90.1    2e-18   Zea mays [maize]
gb|AFW87795.1|  hypothetical protein ZEAMMB73_665682                  87.4    5e-18   
ref|XP_003611446.1|  GMFP4                                            87.4    1e-17   
gb|AFK47448.1|  unknown                                               87.4    1e-17   Medicago truncatula
ref|NP_001146619.1|  hypothetical protein                             86.3    5e-17   Zea mays [maize]
gb|EMS54049.1|  hypothetical protein TRIUR3_29725                     86.3    6e-17   Triticum urartu
dbj|BAJ85018.1|  predicted protein                                    82.8    1e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB51696.1|  hypothetical protein B456_008G228700                  84.3    1e-16   Gossypium raimondii
emb|CDP12960.1|  unnamed protein product                              84.3    1e-16   Coffea canephora [robusta coffee]
gb|EYU17843.1|  hypothetical protein MIMGU_mgv1a0124672mg             83.2    4e-16   Erythranthe guttata [common monkey flower]
ref|XP_006847670.1|  hypothetical protein AMTR_s00149p00039360        83.6    5e-16   Amborella trichopoda
gb|KCW71821.1|  hypothetical protein EUGRSUZ_E00307                   83.2    6e-16   Eucalyptus grandis [rose gum]
ref|XP_003573849.1|  PREDICTED: tobamovirus multiplication protei...  83.2    7e-16   Brachypodium distachyon [annual false brome]
dbj|BAK04010.1|  predicted protein                                    82.8    9e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006436787.1|  hypothetical protein CICLE_v10033213mg           73.6    1e-13   
emb|CBI33948.3|  unnamed protein product                              75.5    2e-13   Vitis vinifera
gb|AFW61168.1|  hypothetical protein ZEAMMB73_111506                  70.5    4e-12   
ref|NP_001146674.1|  uncharacterized protein LOC100280274             69.3    8e-12   
ref|XP_002443902.1|  hypothetical protein SORBIDRAFT_07g004040        70.9    1e-11   Sorghum bicolor [broomcorn]
ref|XP_003573463.1|  PREDICTED: tobamovirus multiplication protei...  70.5    2e-11   Brachypodium distachyon [annual false brome]
gb|ACN35034.1|  unknown                                               69.3    4e-11   Zea mays [maize]
gb|KCW77892.1|  hypothetical protein EUGRSUZ_D021562                  65.9    6e-11   Eucalyptus grandis [rose gum]
ref|XP_004972786.1|  PREDICTED: tetraspanin-20-like isoform X2        66.6    4e-10   Setaria italica
gb|KDP43415.1|  hypothetical protein JCGZ_16702                       65.9    4e-10   Jatropha curcas
gb|KHN21027.1|  hypothetical protein glysoja_034149                   65.5    8e-10   Glycine soja [wild soybean]
ref|XP_004972785.1|  PREDICTED: tetraspanin-20-like isoform X1        66.2    8e-10   
gb|KHG29161.1|  Stk31                                                 65.1    1e-09   Gossypium arboreum [tree cotton]
ref|NP_001061041.1|  Os08g0159100                                     63.9    4e-09   
gb|EEC82932.1|  hypothetical protein OsI_27894                        63.9    5e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_008788693.1|  PREDICTED: tobamovirus multiplication protei...  59.3    8e-08   
gb|KHN01670.1|  hypothetical protein glysoja_012981                   59.3    1e-07   Glycine soja [wild soybean]
gb|KCW77895.1|  hypothetical protein EUGRSUZ_D021561                  57.4    3e-07   Eucalyptus grandis [rose gum]
ref|XP_010672322.1|  PREDICTED: tobamovirus multiplication protei...  57.4    3e-07   
ref|XP_006659854.1|  PREDICTED: tobamovirus multiplication protei...  57.0    7e-07   
ref|XP_011083093.1|  PREDICTED: tetraspanin-18                        54.3    9e-06   Sesamum indicum [beniseed]
gb|ACG25649.1|  hypothetical protein                                  48.9    8e-05   Zea mays [maize]
ref|XP_002972323.1|  hypothetical protein SELMODRAFT_172827           51.2    1e-04   
gb|KCW77897.1|  hypothetical protein EUGRSUZ_D021561                  49.7    2e-04   Eucalyptus grandis [rose gum]
ref|XP_002984277.1|  hypothetical protein SELMODRAFT_229009           50.1    2e-04   Selaginella moellendorffii
ref|XP_006408938.1|  hypothetical protein EUTSA_v10002082mg           49.7    3e-04   Eutrema salsugineum [saltwater cress]
ref|XP_006854320.1|  hypothetical protein AMTR_s00039p00118150        49.7    4e-04   Amborella trichopoda
ref|XP_006350291.1|  PREDICTED: tetraspanin-20-like isoform X2        49.7    4e-04   
ref|XP_006350290.1|  PREDICTED: tetraspanin-20-like isoform X1        49.7    4e-04   Solanum tuberosum [potatoes]
ref|XP_009342640.1|  PREDICTED: tetraspanin-19                        48.5    7e-04   Pyrus x bretschneideri [bai li]
gb|AFK47805.1|  unknown                                               48.5    0.001   Medicago truncatula



>ref|XP_009590611.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana tomentosiformis]
 ref|XP_009590612.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana tomentosiformis]
Length=283

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MACKG  ECLLKLLNFLLTL GL MVGYGIYLFVEYKNHS SGDD+P+  P SS E+++L
Sbjct  1    MACKGFWECLLKLLNFLLTLVGLAMVGYGIYLFVEYKNHSSSGDDYPVA-PTSSAEVIEL  59

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+AVS   NIFD LPK WF+YLFIGIG +L V+SC GCIGA+TRNGCC
Sbjct  60   GRPMLMAVSVAENIFDKLPKAWFIYLFIGIGAVLVVVSCCGCIGAATRNGCC  111



>ref|XP_009788106.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana sylvestris]
 ref|XP_009788107.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana sylvestris]
Length=283

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MACKG  ECLLKLLNFLLTL GL MVGYGIYLFVEYKNHS SGDD+P+  P SS E+++ 
Sbjct  1    MACKGFWECLLKLLNFLLTLVGLAMVGYGIYLFVEYKNHSSSGDDYPVA-PTSSAEVIEF  59

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+AVS  +NIFD LPK WF+YLFIGIG +L V+SC GCIGA+TRNGCC
Sbjct  60   GRPMLIAVSLADNIFDKLPKAWFIYLFIGIGAVLVVVSCCGCIGAATRNGCC  111



>ref|XP_004245872.1| PREDICTED: tobamovirus multiplication protein 2A [Solanum lycopersicum]
Length=284

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MACKG  ECLLKLLNFLLTL GL MVGYGIYLFVEYKNHS SGDD+P+  PP SG++++ 
Sbjct  1    MACKGFWECLLKLLNFLLTLVGLTMVGYGIYLFVEYKNHSHSGDDYPVA-PPMSGDMIEF  59

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+AVS   NIFD LPK WF+YLFIGIG +L V+SC GCIGA+TRNGCC
Sbjct  60   GRPMLMAVSLAENIFDKLPKPWFIYLFIGIGAVLVVVSCCGCIGAATRNGCC  111



>ref|XP_006358577.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358578.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Solanum tuberosum]
Length=284

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MACKG  ECLLKLLNFLLTL GL MVGYGIYLFVEYKNHS SGDD+P+  PP SG++++ 
Sbjct  1    MACKGFWECLLKLLNFLLTLVGLTMVGYGIYLFVEYKNHSHSGDDYPVA-PPMSGDMIEF  59

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+AVS   NIFD LPK WF+YLFIGIG +L V+SC GCIGA+TRNGCC
Sbjct  60   GRPMLMAVSLAGNIFDKLPKPWFIYLFIGIGAVLVVVSCCGCIGAATRNGCC  111



>gb|AIX10945.1| putative tetraspanin family protein [Gardenia jasminoides]
Length=286

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 1/89 (1%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSYPNNIFDNLPKEWF  480
              VGYGIYLFVEYK  + SGDD  +P P S+ EL+QLGRPML+AVS  +N FD LPK WF
Sbjct  27   ATVGYGIYLFVEYKKSASSGDDSGVPVP-STEELIQLGRPMLMAVSLGDNFFDKLPKAWF  85

Query  481  LYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            +YLFIG+GV+LF+ISCFGCIGA+TRNGCC
Sbjct  86   IYLFIGVGVVLFIISCFGCIGAATRNGCC  114



>gb|KDO40489.1| hypothetical protein CISIN_1g038963mg [Citrus sinensis]
Length=117

 Score =   126 bits (317),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 92/114 (81%), Gaps = 7/114 (6%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  405
            MAC+GCLECLLKLLNFLLT+ GL MVGYGIYLFVEYK    SG   P+     SG+   V
Sbjct  1    MACRGCLECLLKLLNFLLTIVGLAMVGYGIYLFVEYKRADNSGTVSPV-----SGDEGFV  55

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            QLGRPML+AVS  ++IFD LPK WF+YLFIG+GV+LFVISC GCIGA+TRNGCC
Sbjct  56   QLGRPMLMAVSLADSIFDKLPKAWFIYLFIGVGVVLFVISCVGCIGATTRNGCC  109



>gb|KJB37690.1| hypothetical protein B456_006G215600 [Gossypium raimondii]
 gb|KJB37691.1| hypothetical protein B456_006G215600 [Gossypium raimondii]
Length=277

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 91/112 (81%), Gaps = 4/112 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MACKGCLECLLKLLNFL+TL GL MVGYGIYLFVEYK  +    D  +   P   + +QL
Sbjct  1    MACKGCLECLLKLLNFLMTLVGLAMVGYGIYLFVEYKRAA----DVAMLLSPVGTDQIQL  56

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+AVS  ++IFDNLPK WF+YLFIG+GV+LFVISCFGCIGASTRN CC
Sbjct  57   GRPMLMAVSLSSSIFDNLPKAWFIYLFIGVGVVLFVISCFGCIGASTRNLCC  108



>gb|EYU17845.1| hypothetical protein MIMGU_mgv1a0219312mg, partial [Erythranthe 
guttata]
Length=207

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MACKG  ECLLKLLNFLL L GLGM+GYG+YLFVEYKN S   D      PPS+   VQL
Sbjct  1    MACKGFWECLLKLLNFLLVLVGLGMIGYGVYLFVEYKNISSDDDGGDSALPPSTDAFVQL  60

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+AVS  +NIFD LPK WF+YLFIG+G ++  I+C GCIG +TRNGCC
Sbjct  61   GRPMLLAVSLADNIFDKLPKAWFIYLFIGLGGIVLFIACCGCIGTATRNGCC  112



>gb|EYU33040.1| hypothetical protein MIMGU_mgv1a011318mg [Erythranthe guttata]
Length=285

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MACKG  ECLLKLLNFLL L GLGM+GYG+YLFVEYKN S   D      PPS+ + VQL
Sbjct  1    MACKGFWECLLKLLNFLLVLVGLGMIGYGVYLFVEYKNISSDDDGGDSALPPSTDDFVQL  60

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+AVS  NNIFD LPK WF+YLFIG+G ++  ++C GCIG +TRNGCC
Sbjct  61   GRPMLLAVSLANNIFDKLPKAWFIYLFIGLGGIVLFVACCGCIGTATRNGCC  112



>ref|XP_006485406.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Citrus sinensis]
 ref|XP_006485407.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Citrus sinensis]
Length=279

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 92/114 (81%), Gaps = 7/114 (6%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  405
            MAC+GCLECLLKLLNFLLT+ GL MVGYGIYLFVEYK    SG   P+     SG+   V
Sbjct  1    MACRGCLECLLKLLNFLLTIVGLAMVGYGIYLFVEYKRADNSGTVSPV-----SGDEGFV  55

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            QLGRPML+AVS  ++IFD LPK WF+YLFIG+GV+LFVISC GCIGA+TRNGCC
Sbjct  56   QLGRPMLMAVSLADSIFDKLPKAWFIYLFIGVGVVLFVISCVGCIGATTRNGCC  109



>gb|KHG08208.1| Tetraspanin-33 [Gossypium arboreum]
Length=280

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 93/114 (82%), Gaps = 6/114 (5%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  405
            MAC+GCLECLLKLLNFL+TLAGL MVGYGIYLFVEYKN +    D  +   P  S  +L+
Sbjct  1    MACRGCLECLLKLLNFLMTLAGLAMVGYGIYLFVEYKNAA----DTAMLLSPVGSDRDLI  56

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            Q GRPML+AVS  ++IFDNLPK WFLYLFIG+G +LFVISCFGCIGA+TRN CC
Sbjct  57   QFGRPMLMAVSLSSSIFDNLPKAWFLYLFIGVGAVLFVISCFGCIGAATRNICC  110



>gb|KHG01123.1| hypothetical protein F383_00667 [Gossypium arboreum]
Length=278

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 90/112 (80%), Gaps = 4/112 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MACKGCLECLLKLLNFL+TL GL MVGYGIYLFVEYK  +    D  +   P   + +QL
Sbjct  1    MACKGCLECLLKLLNFLMTLVGLAMVGYGIYLFVEYKRAA----DVAMLLSPVGTDQIQL  56

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+AVS  ++IFDNLPK WF+YLFIG+GV+LF ISCFGCIGASTRN CC
Sbjct  57   GRPMLMAVSLSSSIFDNLPKAWFIYLFIGVGVVLFFISCFGCIGASTRNLCC  108



>gb|KDO36654.1| hypothetical protein CISIN_1g033543mg [Citrus sinensis]
 gb|KDO36655.1| hypothetical protein CISIN_1g033543mg [Citrus sinensis]
Length=117

 Score =   121 bits (303),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 91/114 (80%), Gaps = 7/114 (6%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  405
            MAC+GCLECLLKLLNFLLTLAGL MVGYGIYLFVEYK     G   P+     SG+   V
Sbjct  1    MACRGCLECLLKLLNFLLTLAGLAMVGYGIYLFVEYKRVDNLGTVSPV-----SGDEGFV  55

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            QLGRPML+AVS  ++IFD LPK WF+YLFIG+GV+LFVISC GCI A+TRNGCC
Sbjct  56   QLGRPMLMAVSLADSIFDKLPKAWFIYLFIGVGVVLFVISCVGCISATTRNGCC  109



>ref|XP_003517379.1| PREDICTED: tobamovirus multiplication protein 2A-like [Glycine 
max]
Length=283

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 91/114 (80%), Gaps = 4/114 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  405
            MAC+GC ECLLKL NF+LTL GL +VGYGIYLFVE+     S DD+     P S +  L+
Sbjct  1    MACRGCWECLLKLFNFILTLTGLAIVGYGIYLFVEF--SKASDDDNTPAISPVSDDSALI  58

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            QLGRP+L+AVS  N+ FDNLP+ WF+YLFIGIGV+LF+ISCFGCIGA+TRNGCC
Sbjct  59   QLGRPVLMAVSLSNDFFDNLPRAWFIYLFIGIGVVLFLISCFGCIGAATRNGCC  112



>gb|ACU24289.1| unknown [Glycine max]
Length=283

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 91/114 (80%), Gaps = 4/114 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  405
            MAC+GC ECLLKL NF+LTL GL +VGYGIYLFVE+     S DD+     P S +  L+
Sbjct  1    MACRGCWECLLKLFNFILTLTGLAIVGYGIYLFVEF--SKASDDDNTPAISPVSDDSALI  58

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            QLGRP+L+AVS  N+ FDNLP+ WF+YLFIGIGV+LF+ISCFGCIGA+TRNGCC
Sbjct  59   QLGRPVLMAVSLSNDFFDNLPRAWFIYLFIGIGVVLFLISCFGCIGAATRNGCC  112



>gb|KHN42626.1| hypothetical protein glysoja_018869 [Glycine soja]
Length=283

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 4/114 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  405
            MAC+GC ECLLKL NF+LTL GL +VGYGIYLFVE+     S DD+     P S +  L+
Sbjct  1    MACRGCWECLLKLFNFILTLTGLAIVGYGIYLFVEF--SKASDDDNTPAISPVSDDSALI  58

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            QLGRP+L+AVS  NN FDNLP+ WF+YLFIGIGV+LF+ SCFGCIGA+TRNGCC
Sbjct  59   QLGRPVLMAVSLSNNFFDNLPRAWFIYLFIGIGVVLFLFSCFGCIGAATRNGCC  112



>gb|KDP36200.1| hypothetical protein JCGZ_10291 [Jatropha curcas]
Length=279

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 89/112 (79%), Gaps = 3/112 (3%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GCLEC+LKLLNFLLTL GL MVGYGIYLFVEYK  +      P+       +L+QL
Sbjct  1    MACRGCLECILKLLNFLLTLVGLAMVGYGIYLFVEYKRAADGESLAPVS---GGSDLIQL  57

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+AVS+  +IFD LPK WF+YLFIG+GV+LFVISCFGCIG+ TRN CC
Sbjct  58   GRPMLMAVSFSESIFDKLPKAWFIYLFIGVGVILFVISCFGCIGSVTRNACC  109



>gb|KJB51694.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
 gb|KJB51695.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
Length=280

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 94/114 (82%), Gaps = 6/114 (5%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  405
            MAC+GCLECLLKLLNFL+T+AGL MVGYGIYLFV+YK+ +    D  +   P  S  +L+
Sbjct  1    MACRGCLECLLKLLNFLMTVAGLAMVGYGIYLFVKYKDAA----DTVMLLSPVGSDQDLI  56

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            QLGRPML+AVS  ++IFDNLPK WFLYLFIG+GV+LF+ISCFGCIG +TRN CC
Sbjct  57   QLGRPMLMAVSLSSSIFDNLPKAWFLYLFIGVGVVLFIISCFGCIGTATRNLCC  110



>ref|XP_007039575.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 ref|XP_007039576.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 ref|XP_007039577.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24076.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24077.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24078.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
Length=280

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 90/114 (79%), Gaps = 6/114 (5%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  405
            MAC+GCL CLLKLLN L+TL GL MVGYGIYLFVEY+  S    D  +   P  S  +L+
Sbjct  1    MACRGCLGCLLKLLNLLMTLVGLAMVGYGIYLFVEYEKAS----DTAMLLSPAGSDQDLI  56

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            QLGRPML+AVS  ++IFDNLPK WF+YLFIG+GV+L +ISCFGCIGA+TRN CC
Sbjct  57   QLGRPMLMAVSLSSSIFDNLPKAWFIYLFIGVGVVLVIISCFGCIGAATRNLCC  110



>ref|XP_011018623.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
 ref|XP_011018624.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
 ref|XP_011018625.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
Length=280

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 91/113 (81%), Gaps = 4/113 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  408
            MACKGCLECLLKLLNFLLTL GL M+GYGIYLFVEYK    + D+  +   PS G+ L  
Sbjct  1    MACKGCLECLLKLLNFLLTLVGLAMIGYGIYLFVEYKR---ADDNVGLVSTPSDGQGLTL  57

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRPML+AVS   +IFD LPK WF+YLFI +GV+LFVISCFGC+GA+TRNGCC
Sbjct  58   LGRPMLIAVSLSESIFDKLPKAWFIYLFIAVGVILFVISCFGCVGAATRNGCC  110



>gb|KJB25374.1| hypothetical protein B456_004G188200 [Gossypium raimondii]
Length=280

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 92/114 (81%), Gaps = 6/114 (5%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  405
            MAC+GCLECLLKLLNFL+TLAGL MVGYGIYLFVEYKN +    D  +   P  S  +L+
Sbjct  1    MACRGCLECLLKLLNFLMTLAGLAMVGYGIYLFVEYKNAA----DTAMLLSPVGSDQDLI  56

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            Q  RPML+AVS  ++IFDNLPK WF+YLFIG+G +LFVISCFGCIGA+TRN CC
Sbjct  57   QFRRPMLMAVSLSSSIFDNLPKAWFIYLFIGVGAVLFVISCFGCIGAATRNLCC  110



>ref|XP_008465936.1| PREDICTED: tobamovirus multiplication protein 2A [Cucumis melo]
Length=279

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 87/112 (78%), Gaps = 3/112 (3%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GC ECLLKLLNF L+L GL MVGYGIYL VEY     S  D P P      +LVQL
Sbjct  1    MACRGCFECLLKLLNFFLSLLGLAMVGYGIYLLVEYLQ---SSSDVPGPSLSGDHDLVQL  57

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+AVS  +NIFDNLPK WF+YLFI  GV++FV+SCFGCIGA+TR+GCC
Sbjct  58   GRPMLMAVSLSSNIFDNLPKAWFIYLFIATGVIVFVVSCFGCIGAATRSGCC  109



>ref|XP_007156640.1| hypothetical protein PHAVU_002G005000g [Phaseolus vulgaris]
 gb|ESW28634.1| hypothetical protein PHAVU_002G005000g [Phaseolus vulgaris]
Length=282

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 89/113 (79%), Gaps = 3/113 (3%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  408
            MAC+GC ECLLKLLNF+L L GL +VGYGIYL VE+     S DD P   P S    L+Q
Sbjct  1    MACRGCWECLLKLLNFILNLTGLAIVGYGIYLLVEF--SKASDDDTPDISPVSDDSALIQ  58

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRP+L+AVS  N+ FDNLP+ WF+YLFIGIGV+LF+ISCFGCIGA+TRNGCC
Sbjct  59   LGRPILMAVSLSNSFFDNLPRAWFIYLFIGIGVVLFLISCFGCIGAATRNGCC  111



>ref|XP_007156638.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 ref|XP_007156639.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 gb|ESW28632.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 gb|ESW28633.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
Length=283

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 91/113 (81%), Gaps = 3/113 (3%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-ELVQ  408
            MAC+GC ECLLKLLNF+L++ GL +VGYGIYLFVE+   S   DD P   P S    L+Q
Sbjct  1    MACRGCWECLLKLLNFILSITGLAIVGYGIYLFVEFSKVS--DDDTPDISPVSDDYALIQ  58

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRPML+AVS  ++ FDNLP+ WF++LFIG+GV+LF+ISCFGCIGA+TRNGCC
Sbjct  59   LGRPMLMAVSLSDSFFDNLPRAWFIFLFIGVGVVLFLISCFGCIGAATRNGCC  111



>ref|XP_003539155.1| PREDICTED: tobamovirus multiplication protein 2A-like [Glycine 
max]
 gb|KHN34864.1| hypothetical protein glysoja_004630 [Glycine soja]
Length=283

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS-GELVQ  408
            MAC+GC ECLLKL NF+LTL GL +VGYGIYLFVE+   S   D+ P   P S    L+Q
Sbjct  1    MACRGCWECLLKLFNFILTLTGLAIVGYGIYLFVEFSKAS-DDDNMPAISPVSDDSSLIQ  59

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRP+L+AVS  N+ FDNLP+ WF+YLFIGIGV+LF+ISCFGCIGA+ RNGCC
Sbjct  60   LGRPVLMAVSLSNDFFDNLPRAWFIYLFIGIGVVLFLISCFGCIGAAARNGCC  112



>gb|EPS67767.1| hypothetical protein M569_07007 [Genlisea aurea]
Length=281

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 89/112 (79%), Gaps = 2/112 (2%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+G  +CLLKLLNFLL L GL M+GYGIYLFVEYKN +   DD P  FPPS+ ++V L
Sbjct  1    MACRGFFDCLLKLLNFLLILVGLAMIGYGIYLFVEYKNGASGDDDGP--FPPSNPDIVML  58

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+ +   ++IFDNLP+ WF+YLF GIGV++ VISCFGCIGAS RN CC
Sbjct  59   GRPMLMGLYLADSIFDNLPRAWFIYLFTGIGVVVLVISCFGCIGASIRNRCC  110



>gb|KCW71823.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=251

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 88/112 (79%), Gaps = 2/112 (2%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GCL C LKLLNFL TLAGL MVGYGIYL V Y N S   D   +    + G L++L
Sbjct  1    MACRGCLGCFLKLLNFLFTLAGLAMVGYGIYLLVMYLNSS--SDAVSVLPVGTGGNLIEL  58

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML AVS  ++IFD+LPK WF+YLF+G+GV+LFVISCFGCIGASTRNGCC
Sbjct  59   GRPMLTAVSLSDSIFDDLPKAWFIYLFMGVGVILFVISCFGCIGASTRNGCC  110



>gb|EYU33039.1| hypothetical protein MIMGU_mgv1a011319mg [Erythranthe guttata]
Length=285

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MACKG  ECLLKLLNFLL L GL M+GYG+YLFVEYKN S   D      PPS+   VQL
Sbjct  1    MACKGFWECLLKLLNFLLVLVGLCMIGYGVYLFVEYKNISSDDDGGDAALPPSTDAFVQL  60

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+AVS  +NIFD LPK WF+YLFIG+G ++  I+C GCIG +TRNGCC
Sbjct  61   GRPMLLAVSLADNIFDKLPKAWFIYLFIGLGGIVLFIACCGCIGTATRNGCC  112



>ref|XP_008375915.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=248

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 87/119 (73%), Gaps = 16/119 (13%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKN-------HSPSGDDHPIPFPPS  390
            MAC+GCLECLLKLLNF+LTL GL MVGYGIYL VEY          SP GD H       
Sbjct  1    MACRGCLECLLKLLNFVLTLVGLAMVGYGIYLLVEYLRAADTTVMSSPVGDVH-------  53

Query  391  SGELVQLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
              +LVQL RPML+ VS  +NI DNLPK WF+YLFIGIG ++FVISCFGC+GA TRNGCC
Sbjct  54   --DLVQLSRPMLMTVSLSDNILDNLPKAWFIYLFIGIGAIIFVISCFGCVGAMTRNGCC  110



>ref|XP_006368443.1| GMFP4 family protein [Populus trichocarpa]
 gb|ERP65012.1| GMFP4 family protein [Populus trichocarpa]
Length=280

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 90/113 (80%), Gaps = 4/113 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  408
            MACKGCLECLLKLLNFLLTL GL M+GYGIYLFVEY+    + D+  +   PS G+ L  
Sbjct  1    MACKGCLECLLKLLNFLLTLVGLAMIGYGIYLFVEYRR---ADDNVGLVSTPSDGQGLTL  57

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRPML+AVS   +I D LPK WF+YLFI +GV+LFVISCFGCIGA+TRNGCC
Sbjct  58   LGRPMLIAVSLSESILDKLPKAWFIYLFIAVGVILFVISCFGCIGAATRNGCC  110



>ref|XP_003524459.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Glycine 
max]
 ref|XP_006579675.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Glycine 
max]
 ref|XP_006579676.1| PREDICTED: tobamovirus multiplication protein 2A isoform X3 [Glycine 
max]
Length=277

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 88/117 (75%), Gaps = 15/117 (13%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPS-----GDDHPIPFPPSSG  396
            MAC+GC ECLLKLLNF+LTLAGL MVGYGIYLFVEY N +P      GDD          
Sbjct  1    MACRGCWECLLKLLNFILTLAGLAMVGYGIYLFVEY-NKTPDNTLTVGDDQT--------  51

Query  397  ELVQLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
             LVQLGRPMLVAVS  N+  D+LPK WF+YLFIGIG +LFVISCFGCI A TRNGCC
Sbjct  52   -LVQLGRPMLVAVSLSNSFLDDLPKAWFIYLFIGIGAVLFVISCFGCIAALTRNGCC  107



>ref|XP_010053569.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 ref|XP_010053570.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 ref|XP_010053571.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
Length=284

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 89/112 (79%), Gaps = 2/112 (2%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GCLEC+LKLLNFLLTL GL MVGYGIYLFVEYK  S SG     P     G  VQL
Sbjct  1    MACRGCLECVLKLLNFLLTLVGLAMVGYGIYLFVEYK-RSSSGTVGYSPIGADEGS-VQL  58

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRP+LV VS   +IFDNLPK WF++LFIG+GV+LF+ISCFGCIG+ TRNGCC
Sbjct  59   GRPLLVTVSLSASIFDNLPKAWFIFLFIGVGVVLFIISCFGCIGSVTRNGCC  110



>ref|XP_010055355.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 gb|KCW71822.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=279

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 88/112 (79%), Gaps = 2/112 (2%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GCL C LKLLNFL TLAGL MVGYGIYL V Y N S   D   +    + G L++L
Sbjct  1    MACRGCLGCFLKLLNFLFTLAGLAMVGYGIYLLVMYLNSS--SDAVSVLPVGTGGNLIEL  58

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML AVS  ++IFD+LPK WF+YLF+G+GV+LFVISCFGCIGASTRNGCC
Sbjct  59   GRPMLTAVSLSDSIFDDLPKAWFIYLFMGVGVILFVISCFGCIGASTRNGCC  110



>ref|XP_004148498.1| PREDICTED: uncharacterized protein LOC101203030 [Cucumis sativus]
 ref|XP_004170668.1| PREDICTED: uncharacterized protein LOC101226567 [Cucumis sativus]
 gb|KGN60424.1| hypothetical protein Csa_3G904130 [Cucumis sativus]
Length=279

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 89/113 (79%), Gaps = 5/113 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEY-KNHSPSGDDHPIPFPPSSGELVQ  408
            MAC+GC ECLLKLLNF L+L GL MVGYGIYL VEY ++HS    D P P      +LVQ
Sbjct  1    MACRGCFECLLKLLNFFLSLLGLAMVGYGIYLLVEYLQSHS----DVPGPSLSGDHDLVQ  56

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRPML+AVS  ++IFDNLPK WF+YLFI  GV +FV+SCFGCIGA+TR+GCC
Sbjct  57   LGRPMLMAVSLSSSIFDNLPKAWFIYLFIATGVTIFVVSCFGCIGAATRSGCC  109



>ref|XP_010269960.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269962.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269963.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269964.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
Length=280

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 87/113 (77%), Gaps = 4/113 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-ELVQ  408
            M+C+GC ECLLKLLNFLLTL GL MVGYGIYL VE+K  S   DD   P P S   E ++
Sbjct  1    MSCRGCFECLLKLLNFLLTLVGLAMVGYGIYLLVEWKRAS---DDTNSPSPLSDNHEFIE  57

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRPML+ VS  +NI D LPK WF+YLFI IGV++FVISCFGCIGA TRNGCC
Sbjct  58   LGRPMLLVVSLSSNILDKLPKAWFIYLFIAIGVVIFVISCFGCIGAVTRNGCC  110



>ref|XP_009345636.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009345644.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
Length=282

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 87/119 (73%), Gaps = 16/119 (13%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKN-------HSPSGDDHPIPFPPS  390
            MAC+GCLECLLKLLNF+LTL GL MVGYGIYL VEY          SP GD H       
Sbjct  1    MACRGCLECLLKLLNFVLTLVGLAMVGYGIYLLVEYLRAADTTVMSSPVGDVH-------  53

Query  391  SGELVQLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
              +LVQL RPML+ VS  +NI DNLPK WF+YLFIGIG ++FVISCFGC+GA TRNGCC
Sbjct  54   --DLVQLSRPMLMTVSLSDNILDNLPKAWFIYLFIGIGAIIFVISCFGCVGAMTRNGCC  110



>ref|XP_002527636.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34707.1| conserved hypothetical protein [Ricinus communis]
Length=280

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 88/112 (79%), Gaps = 2/112 (2%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GCLEC+LKLLN LLTL GL MVGYGIYLFVEY   +  G D  +    +   L+QL
Sbjct  1    MACRGCLECILKLLNLLLTLVGLAMVGYGIYLFVEYTRAA--GGDTLLAPATNDSSLIQL  58

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+AVS  +++ D LPK WF+YLFIG+G++LFVISCFGCIG+ TRNGCC
Sbjct  59   GRPMLMAVSLSDSLVDKLPKAWFIYLFIGVGLILFVISCFGCIGSVTRNGCC  110



>ref|XP_011070225.1| PREDICTED: tobamovirus multiplication protein 2A [Sesamum indicum]
 ref|XP_011070226.1| PREDICTED: tobamovirus multiplication protein 2A [Sesamum indicum]
Length=281

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 86/112 (77%), Gaps = 2/112 (2%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+G  ECLLKLLNFLL L GL M+GYG+YLFV YKN + + DD  +P  P+S + VQL
Sbjct  1    MACRGFWECLLKLLNFLLILVGLAMIGYGVYLFVGYKNAASTDDD--VPISPTSEQFVQL  58

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+ VS  +NIFD LPK WF+YLF GIG ++  I+C GCIG +TRNGCC
Sbjct  59   GRPMLLGVSLADNIFDKLPKAWFIYLFTGIGAVILFIACCGCIGTATRNGCC  110



>gb|KEH31557.1| tetraspanin family protein [Medicago truncatula]
Length=280

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 85/112 (76%), Gaps = 2/112 (2%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GC ECLLKLLNF+LT+ GL MVGYGIYL VE+   S   +   +  P     LVQL
Sbjct  1    MACRGCWECLLKLLNFILTITGLAMVGYGIYLLVEFSRAS--DNSMMLSAPSDDQTLVQL  58

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+A+   +NIFDNLPK WF+YLFIG+G +LFVISCFGCI + TRNGCC
Sbjct  59   GRPMLMALPLSDNIFDNLPKAWFIYLFIGVGAVLFVISCFGCIASMTRNGCC  110



>ref|XP_010677296.1| PREDICTED: tobamovirus multiplication protein 2A [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 70/91 (77%), Gaps = 7/91 (8%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LVQLGRPMLVAVSYPNNIFDNLPKE  474
             MVGYGIYLFV YK  SP         PP S E  ++QLGRP++++VS  N++FDNLPK 
Sbjct  24   AMVGYGIYLFVMYKQASPDTG-----LPPISPEETMIQLGRPLIMSVSLSNSVFDNLPKA  78

Query  475  WFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            WF+Y+FIGIG +LFVISCFGCIGAST+NGCC
Sbjct  79   WFIYMFIGIGAVLFVISCFGCIGASTKNGCC  109



>ref|XP_010275310.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275311.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275312.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275313.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
Length=280

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 87/113 (77%), Gaps = 4/113 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDD-HPIPFPPSSGELVQ  408
            MAC+GCLECLLKLLNFLLTL GL MVGYGIYL VE+K  S   D   P+     + E VQ
Sbjct  1    MACRGCLECLLKLLNFLLTLVGLAMVGYGIYLLVEWKKTSADTDSLSPLS---DNHEFVQ  57

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRPML+ VS  +NIFD LPK WF+YLFI +GV+LF+ISC GCIGA TRNGCC
Sbjct  58   LGRPMLLVVSLSSNIFDKLPKAWFIYLFIAVGVILFIISCCGCIGAVTRNGCC  110



>gb|AFK40219.1| unknown [Lotus japonicus]
Length=282

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 88/113 (78%), Gaps = 6/113 (5%)
 Frame = +1

Query  235  ACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LVQ  408
            AC+GC ECLLKLLNFLLTL GL MVGYGIYL VE+   S    D+ +     S +  LVQ
Sbjct  4    ACRGCWECLLKLLNFLLTLVGLAMVGYGIYLLVEFSKAS----DNTLSVSTVSDDQTLVQ  59

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRPML+AVS  N+ FD+LPK WF+YLFIGIGV+LFVISCFGCIGA TR+GCC
Sbjct  60   LGRPMLMAVSLSNSFFDDLPKAWFIYLFIGIGVVLFVISCFGCIGAMTRSGCC  112



>ref|XP_006415200.1| hypothetical protein EUTSA_v10008423mg [Eutrema salsugineum]
 dbj|BAJ34310.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33553.1| hypothetical protein EUTSA_v10008423mg [Eutrema salsugineum]
Length=280

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 91/114 (80%), Gaps = 6/114 (5%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGEL--V  405
            MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEYK  +    D+ + F P +G+   V
Sbjct  1    MACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYKRAT----DNSVTFNPVNGDQSYV  56

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
             LGRPML+AV+  +N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CC
Sbjct  57   SLGRPMLMAVALSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCC  110



>ref|XP_006385612.1| GMFP4 family protein [Populus trichocarpa]
 gb|ABK92751.1| unknown [Populus trichocarpa]
 gb|ERP63409.1| GMFP4 family protein [Populus trichocarpa]
Length=280

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 90/113 (80%), Gaps = 4/113 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  408
            MACKGCLECLLKLLNFLLTL GL MVG+GIYLFVEY   + + D+  +    S G+ L Q
Sbjct  1    MACKGCLECLLKLLNFLLTLVGLAMVGFGIYLFVEY---TRADDNVALVSTLSDGQGLTQ  57

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRPML+ +S  +NI D LPK WF+YLF+ +GV+LF+ISCFGCIGA+TRNGCC
Sbjct  58   LGRPMLMTMSLSDNILDKLPKAWFIYLFVAVGVILFIISCFGCIGAATRNGCC  110



>ref|XP_002279170.2| PREDICTED: tobamovirus multiplication protein 2A [Vitis vinifera]
Length=280

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 88/112 (79%), Gaps = 2/112 (2%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GCLECLLK+LNFLLTL GL MVGYGIYLFVEYK  S  G+   I       +++QL
Sbjct  1    MACRGCLECLLKILNFLLTLVGLAMVGYGIYLFVEYKKSS--GETLTISPVMGDSDVIQL  58

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRP+++AV+  ++I DNLPK WF+Y F  IGV+LFVISCFGC+GA TRNGCC
Sbjct  59   GRPVMMAVTLSSSILDNLPKAWFIYCFFAIGVILFVISCFGCVGAVTRNGCC  110



>ref|XP_009397919.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=284

 Score =   116 bits (291),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 89/114 (78%), Gaps = 3/114 (3%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG--ELV  405
            MACKG  ECLLKLLNF+LTLAGL MVGYG+YL VE+ N   SG D   P  P+S   E +
Sbjct  1    MACKGFWECLLKLLNFILTLAGLAMVGYGVYLLVEW-NKVASGSDGEDPASPTSSDSEFL  59

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            +LGRP+LVAVS  ++  D LPK WF+YLFIGIGV+LFVISCFGCIGA TRNGCC
Sbjct  60   KLGRPILVAVSLSSSFLDYLPKAWFIYLFIGIGVVLFVISCFGCIGAVTRNGCC  113



>ref|XP_011028243.1| PREDICTED: tobamovirus multiplication protein 2A-like [Populus 
euphratica]
Length=280

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 90/113 (80%), Gaps = 4/113 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  408
            MACKGCLECLLKLLNFLLTL GL M+G+GIYLFVEY   + + D+  +    + G+ L Q
Sbjct  1    MACKGCLECLLKLLNFLLTLVGLAMIGFGIYLFVEY---TRADDNVALVSTLNDGQGLTQ  57

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRPML+ VS  +NI D LPK WF+YLF+ +GV+LF+ISCFGCIGA+TRNGCC
Sbjct  58   LGRPMLMTVSLSDNILDKLPKAWFIYLFVAVGVILFIISCFGCIGAATRNGCC  110



>ref|XP_006305496.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
 gb|EOA38394.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
Length=280

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 89/114 (78%), Gaps = 6/114 (5%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  405
            MAC+GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +    D+ + F P +G+   V
Sbjct  1    MACRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRAT----DNSVTFDPVNGDQSFV  56

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
              GRPML+AV+  +N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CC
Sbjct  57   SFGRPMLMAVAMSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCC  110



>ref|XP_004300273.1| PREDICTED: tobamovirus multiplication protein 2A [Fragaria vesca 
subsp. vesca]
Length=271

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 85/113 (75%), Gaps = 4/113 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDH-PIPFPPSSGELVQ  408
            MAC+GCL  LLKLLNF+LTL GL MVGYGIYL VEY   + + + + P+     +  L+Q
Sbjct  1    MACRGCLVFLLKLLNFILTLVGLAMVGYGIYLLVEYMKVADTANVYSPVG---ETDALIQ  57

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRPML  VS   +  DNLPK WF+YLFIG+GV++FVISCFGCIGA TRNGCC
Sbjct  58   LGRPMLTTVSLSASFLDNLPKAWFIYLFIGVGVIIFVISCFGCIGAVTRNGCC  110



>ref|XP_010104372.1| hypothetical protein L484_023325 [Morus notabilis]
 gb|EXB99792.1| hypothetical protein L484_023325 [Morus notabilis]
Length=251

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 85/117 (73%), Gaps = 14/117 (12%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHS-----PSGDDHPIPFPPSSG  396
            MAC+GCLECLLKLLNFLLTL GL +VGYGIYL VEY   +     P GDDH         
Sbjct  1    MACRGCLECLLKLLNFLLTLVGLAIVGYGIYLLVEYTKSTDDTAPPVGDDH---------  51

Query  397  ELVQLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
              +QLGRPML+A S    IFD LPK WF+YLFIG+G +LFVISCFGC+GA TRNGCC
Sbjct  52   NSMQLGRPMLMAASMSAGIFDKLPKAWFIYLFIGLGAILFVISCFGCVGAVTRNGCC  108



>ref|XP_004511769.1| PREDICTED: tetraspanin-20-like isoform X1 [Cicer arietinum]
 ref|XP_004511770.1| PREDICTED: tetraspanin-20-like isoform X2 [Cicer arietinum]
 ref|XP_004511771.1| PREDICTED: tetraspanin-20-like isoform X3 [Cicer arietinum]
Length=281

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 87/113 (77%), Gaps = 3/113 (3%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  408
            MAC+G  ECLLKLLNF+LTL GL MVGYGIYLFV +     S DD P   P S    L+Q
Sbjct  1    MACRGFWECLLKLLNFILTLTGLAMVGYGIYLFVGFTK--ASDDDIPEISPVSDDSALIQ  58

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRPML+A+S  +++FD LPK WF+YLFIG+G +LFV+SCFGCIGA TRNGCC
Sbjct  59   LGRPMLLAMSLSDSLFDKLPKAWFIYLFIGVGAVLFVVSCFGCIGAKTRNGCC  111



>ref|NP_001240069.1| uncharacterized protein LOC100793680 [Glycine max]
 gb|ACU21254.1| unknown [Glycine max]
Length=277

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 83/112 (74%), Gaps = 5/112 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GC ECLLKLLNF+LTLAGL MVGYGIYLFVEY        D+ + F     E VQ 
Sbjct  1    MACRGCWECLLKLLNFILTLAGLAMVGYGIYLFVEYN----KAWDNTLNFSEDKTE-VQF  55

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPMLV VS  N+  D LPK WF+YLFIGIG +LFVISCFGCI A TRNGCC
Sbjct  56   GRPMLVVVSLSNSFLDELPKAWFIYLFIGIGAVLFVISCFGCIAALTRNGCC  107



>ref|XP_007156641.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 ref|XP_007156642.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 gb|ESW28635.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 gb|ESW28636.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
Length=279

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 89/114 (78%), Gaps = 5/114 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  405
            MAC+GC ECLLKLLNF+L+L GL +VGYGIYLFVE+   S + D   +   P S +  L+
Sbjct  1    MACRGCWECLLKLLNFILSLTGLAIVGYGIYLFVEF---SKASDGETLTTSPVSDDSALI  57

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            QLGRP+L+ VS  N+  DNLP  WF+++FIGIGV+LF+ISCFGCIGA+TRNGCC
Sbjct  58   QLGRPVLMTVSLSNSFLDNLPSAWFIFVFIGIGVVLFLISCFGCIGAATRNGCC  111



>ref|XP_003611447.1| GMFP4 [Medicago truncatula]
 gb|AES94405.1| tobamovirus multiplication protein 2A [Medicago truncatula]
Length=289

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 69/96 (72%), Gaps = 9/96 (9%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFP-----PSSGE--LVQLGRPMLVAVSYPNNIFD  459
             +VGYGIYL V +   S   DD P   P     P SG+  L+Q GRPML+AVS  +NIFD
Sbjct  25   AIVGYGIYLLVAFAKAS--DDDKPDISPTPDISPVSGDSALIQFGRPMLMAVSLSDNIFD  82

Query  460  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
             LPK WF+YLFIG+G +LFV+SCFGCIGA+TRNGCC
Sbjct  83   KLPKAWFIYLFIGVGAVLFVVSCFGCIGATTRNGCC  118



>ref|XP_003611445.1| GMFP4 [Medicago truncatula]
Length=294

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 69/96 (72%), Gaps = 9/96 (9%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFP-----PSSGE--LVQLGRPMLVAVSYPNNIFD  459
             +VGYGIYL V +   S   DD P   P     P SG+  L+Q GRPML+AVS  +NIFD
Sbjct  25   AIVGYGIYLLVAFAKAS--DDDKPDISPTPDISPVSGDSALIQFGRPMLMAVSLSDNIFD  82

Query  460  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
             LPK WF+YLFIG+G +LFV+SCFGCIGA+TRNGCC
Sbjct  83   KLPKAWFIYLFIGVGAVLFVVSCFGCIGATTRNGCC  118



>ref|XP_010518876.1| PREDICTED: tobamovirus multiplication protein 2A [Tarenaya hassleriana]
 ref|XP_010518877.1| PREDICTED: tobamovirus multiplication protein 2A [Tarenaya hassleriana]
Length=279

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 84/112 (75%), Gaps = 3/112 (3%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GCLECLLK LNFLL L GLGMVGYGIYLFVEY+    + + H +      G  V  
Sbjct  1    MACRGCLECLLKFLNFLLALVGLGMVGYGIYLFVEYQR--ATDNSHMVTQTGDDG-YVSF  57

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+ V+  N+IFD LPK WF+YLFIGIGV+LFV+SC GC+G  TRNGCC
Sbjct  58   GRPMLMVVALSNDIFDKLPKAWFIYLFIGIGVVLFVVSCCGCVGTCTRNGCC  109



>ref|XP_010461064.1| PREDICTED: tobamovirus multiplication protein 2A-like [Camelina 
sativa]
Length=280

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 87/114 (76%), Gaps = 6/114 (5%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  405
            MAC+GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +    D+ + F P  S    V
Sbjct  1    MACRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRAT----DNSVTFDPVNSDQSYV  56

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
              GRP+L+AV+  +N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CC
Sbjct  57   SFGRPLLMAVTLSSNVFDNLPKAWFIYLFIGIGVTLFVISCCGCVGTCSRSVCC  110



>ref|XP_010538377.1| PREDICTED: tobamovirus multiplication protein 2A-like [Tarenaya 
hassleriana]
 ref|XP_010538378.1| PREDICTED: tobamovirus multiplication protein 2A-like [Tarenaya 
hassleriana]
Length=280

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 86/112 (77%), Gaps = 3/112 (3%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GCLECLLKLLNFLL L GLGMVGYGIYLFVEY+  +   D+  +    S    + L
Sbjct  1    MACRGCLECLLKLLNFLLALVGLGMVGYGIYLFVEYQRAT---DNSHMVAQTSGDGYISL  57

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+AVS  N+IFD LPK WF+YLFIGIGV+LFV+SC GC+G  TRN CC
Sbjct  58   GRPMLMAVSLSNDIFDKLPKPWFIYLFIGIGVILFVVSCCGCLGVCTRNVCC  109



>ref|XP_010919853.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
 ref|XP_010919854.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
Length=282

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+G  ECLLKLLNFLL L GL MVGYG YL VE+   S S DD PI     + EL++L
Sbjct  1    MACRGFWECLLKLLNFLLMLTGLAMVGYGAYLLVEWMKISSSEDDDPISPVGDNYELLKL  60

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML   +  ++I D LPK WF+YLFIGIGV+LF+ISCFGCIG   RNGCC
Sbjct  61   GRPMLAVATLSDSILDKLPKAWFIYLFIGIGVILFIISCFGCIGVVMRNGCC  112



>ref|XP_009151428.1| PREDICTED: tobamovirus multiplication protein 2A [Brassica rapa]
Length=279

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 87/112 (78%), Gaps = 3/112 (3%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEY+  +   D++ + F       V  
Sbjct  1    MACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYQRAT---DNNSLNFTRDDQSHVSF  57

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML++++  +N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +RN CC
Sbjct  58   GRPMLMSLALSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRNVCC  109



>emb|CDY48874.1| BnaA05g35820D [Brassica napus]
Length=344

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 87/113 (77%), Gaps = 3/113 (3%)
 Frame = +1

Query  229  NMACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQ  408
             MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEY+    + D++ + F       V 
Sbjct  65   KMACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYQR---ATDNNSLNFTRDDQSYVS  121

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
             GRPML++++  +N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +RN CC
Sbjct  122  FGRPMLMSLALSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRNVCC  174



>emb|CDY32286.1| BnaC05g28640D [Brassica napus]
Length=370

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 87/113 (77%), Gaps = 3/113 (3%)
 Frame = +1

Query  229  NMACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQ  408
             MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEY+  +   D++ + F       V 
Sbjct  91   KMACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYQRAT---DNNSLNFTGDDQSYVS  147

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
             GRPML++V+  +N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +RN CC
Sbjct  148  FGRPMLMSVALSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRNICC  200



>ref|NP_564399.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 ref|NP_973952.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 ref|NP_001031127.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 sp|Q9C5W7.1|TOM2A_ARATH RecName: Full=Tobamovirus multiplication protein 2A; Short=AtTOM2A 
[Arabidopsis thaliana]
 gb|AAG50101.1|AF334723_1 unknown protein [Arabidopsis thaliana]
 gb|AAK60280.1|AF385687_1 At1g32400/F5D14_22 [Arabidopsis thaliana]
 gb|AAM66092.1| unknown [Arabidopsis thaliana]
 dbj|BAC24019.1| tobamovirus multiplication 2A [Arabidopsis thaliana]
 gb|AEE31476.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 gb|AEE31477.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 gb|AEE31478.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
Length=280

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 90/114 (79%), Gaps = 6/114 (5%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGEL--V  405
            MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEYK  +    D+ + F  ++G+   V
Sbjct  1    MACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYKRVT----DNSVTFDLTNGDQSYV  56

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
              GRP+L+AVS  +NIFDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CC
Sbjct  57   SFGRPILMAVSLSSNIFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCC  110



>ref|XP_007209447.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 ref|XP_007209448.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 gb|EMJ10646.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 gb|EMJ10647.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
Length=281

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 84/119 (71%), Gaps = 16/119 (13%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPS-------GDDHPIPFPPS  390
            MAC+GC EC+LKLLNF+LTL GL MVGYGIYL VEY   + +       GD+        
Sbjct  1    MACRGCWECVLKLLNFVLTLVGLAMVGYGIYLLVEYLKAADTVAMSSLVGDNQA------  54

Query  391  SGELVQLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
               L+QL RPML+ VS  +NI DNLPK WF+YLFIGIG ++FVISCFGC+ A TRNGCC
Sbjct  55   ---LIQLSRPMLMTVSLSSNIVDNLPKAWFIYLFIGIGAIIFVISCFGCVAAMTRNGCC  110



>ref|XP_008788690.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008788691.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008788692.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
Length=279

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GC ECLLKLLNF+LT+AGL MVGYG+YL VE+   S  G + PI     +  ++ L
Sbjct  1    MACRGCFECLLKLLNFVLTVAGLAMVGYGVYLLVEWNKVSAGGGEDPISPDSDNPAMLTL  60

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+ V    +  D LPK WF+YLFIGIGV+LF+ISC GC+GA+TRNGCC
Sbjct  61   GRPMLLVVPVSTSFVDQLPKAWFIYLFIGIGVILFIISCCGCVGATTRNGCC  112



>ref|XP_008784675.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
 ref|XP_008784676.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
 ref|XP_008784677.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
Length=282

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+G  ECLLKLLNFLL L GL MVGYG YL VE+   S   DD PI     + EL++L
Sbjct  1    MACRGFWECLLKLLNFLLMLTGLAMVGYGAYLLVEWIKISSGQDDGPISPVSDNYELLKL  60

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML  V+   +I D LPK WF+YLFIGIGV+LF+ISCFGCIG   RNGCC
Sbjct  61   GRPMLAVVTLSESILDKLPKAWFIYLFIGIGVILFIISCFGCIGVIARNGCC  112



>ref|XP_008238361.1| PREDICTED: tobamovirus multiplication protein 2A [Prunus mume]
Length=281

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 85/119 (71%), Gaps = 16/119 (13%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPS-------GDDHPIPFPPS  390
            MAC+GC ECLLKLLNF+LTL GL MVGYGIYL VEY   + +       GD+        
Sbjct  1    MACRGCWECLLKLLNFVLTLVGLAMVGYGIYLLVEYLKAADTVAMSSLVGDNQA------  54

Query  391  SGELVQLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
               L+QL RPML+ VS  +NI+DNLPK WF+Y+FIGIG ++FVISCFGC+ A TRNGCC
Sbjct  55   ---LIQLSRPMLMTVSLSSNIWDNLPKAWFIYVFIGIGAIIFVISCFGCVAAMTRNGCC  110



>ref|XP_010499788.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Camelina 
sativa]
 ref|XP_010499789.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Camelina 
sativa]
Length=276

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 86/112 (77%), Gaps = 6/112 (5%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +    D+ + F   S   +  
Sbjct  1    MACRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRAT----DNSVTFDDQS--YISF  54

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+AV+  +N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CC
Sbjct  55   GRPMLMAVTLSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCC  106



>ref|XP_010478663.1| PREDICTED: tobamovirus multiplication protein 2A-like [Camelina 
sativa]
Length=281

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 88/114 (77%), Gaps = 5/114 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGEL--V  405
            MAC+GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +   D+    F P +G+   +
Sbjct  1    MACRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRAT---DNSSGTFDPVNGDQSYI  57

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
              GRP+L+AV+  +N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CC
Sbjct  58   SFGRPLLMAVTLSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCC  111



>ref|XP_006305495.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
 gb|EOA38393.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
Length=256

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 6/90 (7%)
 Frame = +1

Query  304  MVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LVQLGRPMLVAVSYPNNIFDNLPKEW  477
            M+GYGIYLFVEYK  +    D+ + F P +G+   V  GRPML+AV+  +N+FDNLPK W
Sbjct  1    MIGYGIYLFVEYKRAT----DNSVTFDPVNGDQSFVSFGRPMLMAVAMSSNVFDNLPKAW  56

Query  478  FLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            F+YLFIGIGV LFVISC GC+G  +R+ CC
Sbjct  57   FIYLFIGIGVALFVISCCGCVGTCSRSVCC  86



>ref|XP_010933519.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
Length=283

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+G  EC+LKLLNFLLT+ GL MVGYG+YL VE+   S    D PI     + E  +L
Sbjct  1    MACRGFWECMLKLLNFLLTIIGLAMVGYGVYLLVEWNKISSGDGDGPISPVSDNYEFTKL  60

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
             RPML  V+   +I D LP  WF+YLFIGIGV+LFVISCFGCIGA TRNGCC
Sbjct  61   RRPMLAVVTLSESILDKLPNAWFIYLFIGIGVILFVISCFGCIGALTRNGCC  112



>emb|CDX93836.1| BnaA09g24360D [Brassica napus]
Length=281

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 88/115 (77%), Gaps = 7/115 (6%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS---GEL  402
            MAC+GCLECLLKLLNF+L +AGL ++GYGIYLFVE+K  +    DH + F P++      
Sbjct  1    MACRGCLECLLKLLNFILAVAGLSIIGYGIYLFVEFKRAT----DHSVSFIPTNVNDQSY  56

Query  403  VQLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            V  GRPML+AV+  +N+FDNLPK WF+YLFIGIGV+LFV SC GC+G  +R+ CC
Sbjct  57   VSFGRPMLMAVALSSNVFDNLPKAWFIYLFIGIGVVLFVTSCCGCVGTCSRSICC  111



>ref|XP_009114889.1| PREDICTED: tobamovirus multiplication protein 2A [Brassica rapa]
Length=281

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 88/115 (77%), Gaps = 7/115 (6%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS---GEL  402
            MAC+GCLECLLKLLNF+L +AGLG++GYGIYLFVE+K  +    DH +   P++      
Sbjct  1    MACRGCLECLLKLLNFILAVAGLGIIGYGIYLFVEFKRAT----DHSVSLIPTNVNDQSY  56

Query  403  VQLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            V  GRPML+AV+  +N+FDNLPK WF+YLFIGIGV+LFV SC GC+G  +R+ CC
Sbjct  57   VSFGRPMLMAVALSSNVFDNLPKAWFIYLFIGIGVVLFVTSCCGCVGTCSRSICC  111



>ref|XP_002893721.1| hypothetical protein ARALYDRAFT_473428 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69980.1| hypothetical protein ARALYDRAFT_473428 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 87/114 (76%), Gaps = 6/114 (5%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  405
            M  +GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +    D+ + F  ++G+   V
Sbjct  1    MTFRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRVT----DNSVTFDSTNGDQSYV  56

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
              GRPML+AVS  +N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CC
Sbjct  57   SFGRPMLMAVSLSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCC  110



>ref|XP_010934869.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Elaeis 
guineensis]
Length=267

 Score =   108 bits (269),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GC ECLLKLLNF+LT+AGL MVGYG+YL VE+   S  G + PI     +  ++ L
Sbjct  1    MACRGCFECLLKLLNFVLTVAGLAMVGYGVYLLVEWIKVSSGGGEDPISPVSDNPVMLTL  60

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+      +  D LPK WF+YLFIGIGV+LF+ISC GC+GA+TRNGCC
Sbjct  61   GRPMLLVAPISTSFVDQLPKAWFIYLFIGIGVILFIISCCGCVGATTRNGCC  112



>ref|XP_010934868.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Elaeis 
guineensis]
Length=280

 Score =   108 bits (269),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GC ECLLKLLNF+LT+AGL MVGYG+YL VE+   S  G + PI     +  ++ L
Sbjct  1    MACRGCFECLLKLLNFVLTVAGLAMVGYGVYLLVEWIKVSSGGGEDPISPVSDNPVMLTL  60

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML+      +  D LPK WF+YLFIGIGV+LF+ISC GC+GA+TRNGCC
Sbjct  61   GRPMLLVAPISTSFVDQLPKAWFIYLFIGIGVILFIISCCGCVGATTRNGCC  112



>ref|XP_009398578.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDD-HPIPFPPSSGELVQ  408
            MAC+G  ECLLKLLNFLLTL GL MVGYG YL VE+   S S DD  PI     + E + 
Sbjct  1    MACRGLWECLLKLLNFLLTLTGLAMVGYGAYLLVEWNRVSSSDDDDEPISPTGDNPEFLT  60

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
             GRPMLVAVS  ++  D LPK WF+YL IGIGV+LF+ISCFG IGA +RNGCC
Sbjct  61   FGRPMLVAVSLSSSFLDKLPKAWFIYLIIGIGVVLFIISCFGFIGAVSRNGCC  113



>ref|XP_004509001.1| PREDICTED: tetraspanin-20-like isoform X1 [Cicer arietinum]
 ref|XP_004509002.1| PREDICTED: tetraspanin-20-like isoform X2 [Cicer arietinum]
Length=280

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 83/112 (74%), Gaps = 2/112 (2%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+G  ECLLKLLNFLLT+ GL MVGYGIYL VE+   S S  +  +        LVQL
Sbjct  1    MACRGFWECLLKLLNFLLTVTGLAMVGYGIYLLVEFSKASDSSLN--VSTVSDGQTLVQL  58

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRP+L+AV   ++ FD+LPK WF+YLFIG+G +LFVISCFGCI + TRNGCC
Sbjct  59   GRPLLMAVPLSDSFFDDLPKAWFIYLFIGVGAVLFVISCFGCIASVTRNGCC  110



>emb|CDY01278.1| BnaC05g24540D [Brassica napus]
Length=281

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 87/115 (76%), Gaps = 7/115 (6%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS---GEL  402
            MAC+GCLECLLKLLNFLL +AGLG++ YGIYLFV +K  +    DH + F P++      
Sbjct  1    MACRGCLECLLKLLNFLLAVAGLGIIAYGIYLFVVFKRAT----DHSVSFIPTNVNDQSY  56

Query  403  VQLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            V  GRPML+AV+  +N+FDNLPK WF+YLFIGIGV+LFV SC GC+G  +R+ CC
Sbjct  57   VSFGRPMLMAVALSSNVFDNLPKAWFVYLFIGIGVVLFVTSCCGCVGTCSRSICC  111



>ref|XP_009391069.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391140.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391209.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391294.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=275

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 80/113 (71%), Gaps = 1/113 (1%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-ELVQ  408
            MACKG  E LLKLLNFLLTL GL MVGYG+YL +EY   S  GD      P S+  +   
Sbjct  1    MACKGFWEYLLKLLNFLLTLTGLAMVGYGVYLLMEYNKVSSGGDGDDQVAPTSNDPKFWM  60

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            +GRPMLV V   ++  D+LPK WF+YLFIG+G +LFVISC GCIGA TRNGCC
Sbjct  61   IGRPMLVGVPLSSSFLDHLPKAWFIYLFIGVGAILFVISCIGCIGAVTRNGCC  113



>gb|AAF81337.1|AC007767_17 Contains similarity to GMFP4 from Glycine max gb|U64915. ESTs 
gb|AV442477, gb|AV441037, gb|AV534954, gb|AV560678 and gb|AV518757 
come from this gene [Arabidopsis thaliana]
Length=252

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 6/106 (6%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGEL--V  405
            MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEYK  +    D+ + F  ++G+   V
Sbjct  1    MACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYKRVT----DNSVTFDLTNGDQSYV  56

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIG  543
              GRP+L+AVS  +NIFDNLPK WF+YLFIGIGV LFVISC GC+ 
Sbjct  57   SFGRPILMAVSLSSNIFDNLPKAWFIYLFIGIGVALFVISCCGCVA  102



>ref|XP_008352453.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=198

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 87/119 (73%), Gaps = 16/119 (13%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKN-------HSPSGDDHPIPFPPS  390
            MAC+GCLECLLKLLNF+LTL GL MVGYGIYL VEY          SP GDDH       
Sbjct  1    MACRGCLECLLKLLNFVLTLVGLAMVGYGIYLLVEYLRASDSTVMSSPVGDDH-------  53

Query  391  SGELVQLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
              +LVQL RP+L+ VS   ++ DNLPK WF+YLFIGIG ++F+ISCFGC+GA TRNGCC
Sbjct  54   --DLVQLSRPLLMTVSLSTSVLDNLPKAWFIYLFIGIGAIIFIISCFGCVGAMTRNGCC  110



>ref|XP_009371175.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009371176.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009371177.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
Length=280

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 87/119 (73%), Gaps = 16/119 (13%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPS-------GDDHPIPFPPS  390
            MAC+GCLECLLKLLNF+LTL GL MVGYGIYL VEY   S S       GDDH       
Sbjct  1    MACRGCLECLLKLLNFVLTLVGLAMVGYGIYLLVEYLRASDSTVMSSAVGDDH-------  53

Query  391  SGELVQLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
              +LVQL RP+L+ VS   +I DNLPK WF+YLFIGIG ++F+ISCFGC+GA TRNGCC
Sbjct  54   --DLVQLSRPLLMTVSLSTSILDNLPKAWFIYLFIGIGAIIFIISCFGCVGAMTRNGCC  110



>ref|XP_006659267.1| PREDICTED: tobamovirus multiplication protein 2A-like [Oryza 
brachyantha]
Length=287

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 82/116 (71%), Gaps = 4/116 (3%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPF--PPSSGELV  405
            MAC+G  ECLLKLLNF+LT+AGL MVGYGIYL VE+   S  G     P   P    EL+
Sbjct  1    MACRGFFECLLKLLNFVLTVAGLAMVGYGIYLLVEWMRISGGGGGGGGPRASPAPPAELL  60

Query  406  QLGRPMLVAVSYPN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
              GRPML AV+  +  + FD LPK WF+YLFIG+G ++FVIS FGCIGA+TRN CC
Sbjct  61   MFGRPMLTAVALGDGGSFFDKLPKAWFIYLFIGVGAIIFVISLFGCIGAATRNTCC  116



>gb|EEC83268.1| hypothetical protein OsI_28600 [Oryza sativa Indica Group]
Length=195

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+G  ECLLKLLNF+LT+AGL MVGYGIYL VE+   S  G   P   P    EL+  
Sbjct  1    MACRGFFECLLKLLNFVLTVAGLAMVGYGIYLLVEWMRISGGGGGAPPS-PAPPAELLMF  59

Query  412  GRPMLVAVSYPN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML AV+  +  + FD LPK WF+YLFIG+G ++FVIS FGCIGA+TRN CC
Sbjct  60   GRPMLTAVALGDGGSFFDKLPKAWFIYLFIGVGAIIFVISLFGCIGAATRNTCC  113



>gb|EEE68396.1| hypothetical protein OsJ_26735 [Oryza sativa Japonica Group]
Length=221

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+G  ECLLKLLNF+LT+AGL MVGYGIYL VE+   S  G   P   P    EL+  
Sbjct  1    MACRGFFECLLKLLNFVLTVAGLAMVGYGIYLLVEWMRISGGGGGAPPS-PAPPAELLMF  59

Query  412  GRPMLVAVSYPN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML AV+  +  + FD LPK WF+YLFIG+G ++FVIS FGCIGA+TRN CC
Sbjct  60   GRPMLTAVALGDGGSFFDKLPKAWFIYLFIGVGAIIFVISLFGCIGAATRNTCC  113



>ref|XP_009385932.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385933.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-ELVQ  408
            MACKG  ECLLKLLNFLLTL GL MVGYGIYL V +   S SG    + FP     E ++
Sbjct  1    MACKGFWECLLKLLNFLLTLTGLAMVGYGIYLLVIWNKASSSGVGEDLAFPTGGDPEFLK  60

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRPMLVAVS  ++  D+LPK WF+YLFIG+G+++FVISCFGCIGA TRNGCC
Sbjct  61   LGRPMLVAVSLSSSFLDHLPKAWFIYLFIGVGIIIFVISCFGCIGALTRNGCC  113



>gb|ABK22053.1| unknown [Picea sitchensis]
Length=282

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSYPNNIFDNLPKEWF  480
            GMVGYGIY+ V+++  S S +   IP   + G+++ LGRP+L       +  D LP  WF
Sbjct  24   GMVGYGIYMMVKWEQDSVSVN-SVIPATANKGDVLILGRPLLFLAPLSTSFLDKLPGAWF  82

Query  481  LYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            +YLF+ +GV+LF++SC GCI  +TR GCC
Sbjct  83   IYLFMAVGVILFIVSCSGCIAVATRRGCC  111



>ref|NP_001061444.1| Os08g0282000 [Oryza sativa Japonica Group]
 dbj|BAC99958.1| senescence-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF23358.1| Os08g0282000 [Oryza sativa Japonica Group]
 dbj|BAG95056.1| unnamed protein product [Oryza sativa Japonica Group]
Length=284

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+G  ECLLKLLNF+LT+AGL MVGYGIYL VE+   S  G     P P    EL+  
Sbjct  1    MACRGFFECLLKLLNFVLTVAGLAMVGYGIYLLVEWMRISGGGG-GAPPSPAPPAELLMF  59

Query  412  GRPMLVAVSYPN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML AV+  +  + FD LPK WF+YLFIG+G ++FVIS FGCIGA+TRN CC
Sbjct  60   GRPMLTAVALGDGGSFFDKLPKAWFIYLFIGVGAIIFVISLFGCIGAATRNTCC  113



>ref|XP_004983591.1| PREDICTED: tetraspanin-18-like isoform X1 [Setaria italica]
 ref|XP_004983592.1| PREDICTED: tetraspanin-18-like isoform X2 [Setaria italica]
Length=278

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 6/89 (7%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSYPNNIFDNLPKEWF  480
             MVGYGIYL VE+   S  G         +  E++ LGRP+L AV+  ++  D LPK WF
Sbjct  25   AMVGYGIYLLVEWMKISKGGGGG------TPAEVLVLGRPLLGAVALGDSFLDKLPKAWF  78

Query  481  LYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            +YLFIG+G ++F++S FGCIGA TRN CC
Sbjct  79   IYLFIGVGAIVFLVSLFGCIGAGTRNTCC  107



>ref|XP_006850026.1| hypothetical protein AMTR_s00022p00189290 [Amborella trichopoda]
 gb|ERN11607.1| hypothetical protein AMTR_s00022p00189290 [Amborella trichopoda]
Length=276

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 75/112 (67%), Gaps = 1/112 (1%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MACKG  ECLLKLLNFLLTL GL MVGYG+YL + +K  +    D PI    S  E  +L
Sbjct  1    MACKGFFECLLKLLNFLLTLVGLAMVGYGVYLLIIWKKSTSGHTDFPIS-DGSEPEQFRL  59

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
             RP + A     N +D LP  WF+YLFI IG +LFVISC GCIGA+TRN CC
Sbjct  60   VRPFIYAGYLSANFWDKLPTPWFIYLFIAIGAILFVISCIGCIGAATRNICC  111



>ref|NP_001150827.1| tetraspanin family protein [Zea mays]
 ref|XP_008678655.1| PREDICTED: tetraspanin family protein isoform X1 [Zea mays]
 gb|ACN27909.1| unknown [Zea mays]
 tpg|DAA46389.1| TPA: tetraspanin family protein isoform 1 [Zea mays]
 tpg|DAA46390.1| TPA: tetraspanin family protein isoform 2 [Zea mays]
Length=279

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 5/89 (6%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSYPNNIFDNLPKEWF  480
             MVGYGIYL VE+   S  G    +     + E++  GRP+L AV+  ++  D LPK WF
Sbjct  25   AMVGYGIYLLVEWMKISEDGSSGGL-----TAEVLVSGRPLLGAVALGDSFLDMLPKAWF  79

Query  481  LYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            +YLFIG+G  +F++S FGCIGA TRN CC
Sbjct  80   IYLFIGVGATVFLVSLFGCIGAGTRNTCC  108



>gb|ACG40574.1| tetraspanin family protein [Zea mays]
Length=279

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 5/89 (6%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSYPNNIFDNLPKEWF  480
             MVGYGIYL VE+   S  G    +     + E++  GRP+L AV+  ++  D LPK WF
Sbjct  25   AMVGYGIYLLVEWMKISEDGSSGGL-----TAEVLVSGRPLLGAVALGDSFLDMLPKAWF  79

Query  481  LYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            +YLFIG+G  +F++S FGCIGA TRN CC
Sbjct  80   IYLFIGVGATVFLVSLFGCIGAGTRNTCC  108



>gb|AFW87795.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
 gb|AFW87796.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=169

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 57/89 (64%), Gaps = 5/89 (6%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSYPNNIFDNLPKEWF  480
             MVGYGIYL VE+   S  G         S+ E++  GRP+L AV   ++  DNLPK WF
Sbjct  25   AMVGYGIYLLVEWMKISEDGIG-----GASTAEVLVSGRPLLGAVILGDSFLDNLPKAWF  79

Query  481  LYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            +YLFI +G ++ ++S FGCIGA TRN CC
Sbjct  80   IYLFICVGTIVILVSLFGCIGAGTRNTCC  108



>ref|XP_003611446.1| GMFP4 [Medicago truncatula]
Length=220

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +1

Query  421  MLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            ML+AVS  +NIFD LPK WF+YLFIG+G +LFV+SCFGCIGA+TRNGCC
Sbjct  1    MLMAVSLSDNIFDKLPKAWFIYLFIGVGAVLFVVSCFGCIGATTRNGCC  49



>gb|AFK47448.1| unknown [Medicago truncatula]
Length=220

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +1

Query  421  MLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            ML+AVS  +NIFD LPK WF+YLFIG+G +LFV+SCFGCIGA+TRNGCC
Sbjct  1    MLMAVSLSDNIFDKLPKAWFIYLFIGVGAVLFVVSCFGCIGATTRNGCC  49



>ref|NP_001146619.1| hypothetical protein [Zea mays]
 gb|ACF86508.1| unknown [Zea mays]
 gb|ACR38384.1| unknown [Zea mays]
 gb|AFW87797.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=279

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 57/89 (64%), Gaps = 5/89 (6%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSYPNNIFDNLPKEWF  480
             MVGYGIYL VE+   S  G         S+ E++  GRP+L AV   ++  DNLPK WF
Sbjct  25   AMVGYGIYLLVEWMKISEDGIGGA-----STAEVLVSGRPLLGAVILGDSFLDNLPKAWF  79

Query  481  LYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            +YLFI +G ++ ++S FGCIGA TRN CC
Sbjct  80   IYLFICVGTIVILVSLFGCIGAGTRNTCC  108



>gb|EMS54049.1| hypothetical protein TRIUR3_29725 [Triticum urartu]
Length=285

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPML--VAVSYPNNIFDNLPKE  474
             MVGYGIYL VE+   S  G     P P    EL+  GRPML  VA+    + FD LPK 
Sbjct  25   AMVGYGIYLLVEWMRISGGGG-GAPPSPAPPAELLTFGRPMLTVVALGEGGSFFDKLPKA  83

Query  475  WFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            WF+YLFIG+G ++FV+S FGCIGA TRN CC
Sbjct  84   WFIYLFIGVGAVIFVVSLFGCIGAGTRNTCC  114



>dbj|BAJ85018.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=135

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPML--VAVSYPNNIFDNLPKE  474
             MVGYGIYL  E+   S  G   P   P    EL+  GRPML  VA+    + FD LP+ 
Sbjct  25   AMVGYGIYLLAEWMRISGGGGGAPPS-PAPPAELLMFGRPMLTVVALGEGGSFFDKLPEA  83

Query  475  WFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            WF+YLFIG+G ++F++S FGCIGA TRN CC
Sbjct  84   WFIYLFIGVGAVIFIVSLFGCIGAGTRNTCC  114



>gb|KJB51696.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
Length=219

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +1

Query  421  MLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            ML+AVS  ++IFDNLPK WFLYLFIG+GV+LF+ISCFGCIG +TRN CC
Sbjct  1    MLMAVSLSSSIFDNLPKAWFLYLFIGVGVVLFIISCFGCIGTATRNLCC  49



>emb|CDP12960.1| unnamed protein product [Coffea canephora]
Length=221

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +1

Query  427  VAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            +AVS   NIFD LPK WF+YLFIG+GV+LFVISCFGCIGA+TRNGCC
Sbjct  1    MAVSLAANIFDKLPKAWFIYLFIGVGVVLFVISCFGCIGAATRNGCC  47



>gb|EYU17843.1| hypothetical protein MIMGU_mgv1a0124672mg, partial [Erythranthe 
guttata]
Length=221

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  409  LGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRPML+AVS  +NIFD LPK WF+YLFIG+G ++  I+C GCIG +TRNGCC
Sbjct  1    LGRPMLLAVSLADNIFDKLPKAWFIYLFIGLGGIVLFIACCGCIGTATRNGCC  53



>ref|XP_006847670.1| hypothetical protein AMTR_s00149p00039360 [Amborella trichopoda]
 gb|ERN09251.1| hypothetical protein AMTR_s00149p00039360 [Amborella trichopoda]
Length=284

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 3/89 (3%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSYPNNIFDNLPKEWF  480
             M+GYGIYL VE+KN S +     +    S+  +++LGRP+L      ++I   L + WF
Sbjct  24   AMIGYGIYLLVEWKNDSST---VTLISVLSNQPMIKLGRPLLHMGPLSSSILTELSEAWF  80

Query  481  LYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            +Y FI +GV+L VISCFGCIGA TR+GCC
Sbjct  81   VYSFIVVGVILCVISCFGCIGAFTRHGCC  109



>gb|KCW71821.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=260

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 77/112 (69%), Gaps = 2/112 (2%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GCL C LKLLNFL TLAGL MVGYGIYL V Y N S   D   +    + G L++L
Sbjct  1    MACRGCLGCFLKLLNFLFTLAGLAMVGYGIYLLVMYLNSS--SDAVSVLPVGTGGNLIEL  58

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRPML AVS  ++IFD+LPK WF+YLF+G+GV+LFVIS    I      GC 
Sbjct  59   GRPMLTAVSLSDSIFDDLPKAWFIYLFMGVGVILFVISLLVIILILVELGCA  110



>ref|XP_003573849.1| PREDICTED: tobamovirus multiplication protein 2A-like [Brachypodium 
distachyon]
Length=283

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 56/91 (62%), Gaps = 5/91 (5%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSYPNN--IFDNLPKE  474
             MVGYGIYL VE+   S        P P    +L+  GRPML  V   +    FD LPK 
Sbjct  25   AMVGYGIYLLVEWMRISGG---GAPPSPAPPADLLLFGRPMLTVVGLADGGGFFDKLPKA  81

Query  475  WFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            WF+YLFIG+G ++F++S FGCIGA TRN CC
Sbjct  82   WFIYLFIGVGAVVFIVSLFGCIGAGTRNTCC  112



>dbj|BAK04010.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPML--VAVSYPNNIFDNLPKE  474
             MVGYGIYL  E+   S  G     P P    EL+  GRPML  VA+    + FD LP+ 
Sbjct  25   AMVGYGIYLLAEWMRISGGGG-GAPPSPAPPAELLMFGRPMLTVVALGEGGSFFDKLPEA  83

Query  475  WFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            WF+YLFIG+G ++F++S FGCIGA TRN CC
Sbjct  84   WFIYLFIGVGAVIFIVSLFGCIGAGTRNTCC  114



>ref|XP_006436787.1| hypothetical protein CICLE_v10033213mg [Citrus clementina]
 ref|XP_006436788.1| hypothetical protein CICLE_v10033213mg [Citrus clementina]
 gb|ESR50027.1| hypothetical protein CICLE_v10033213mg [Citrus clementina]
 gb|ESR50028.1| hypothetical protein CICLE_v10033213mg [Citrus clementina]
Length=84

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 64/85 (75%), Gaps = 7/85 (8%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  405
            MAC+GCLECLLKLLNFLLT+ GL MVGYGIYLFVEYK    SG   P+     SG+   V
Sbjct  1    MACRGCLECLLKLLNFLLTIVGLAMVGYGIYLFVEYKRADNSGTVSPV-----SGDEGFV  55

Query  406  QLGRPMLVAVSYPNNIFDNLPKEWF  480
            QLGRPML+AVS  ++IFD LPK W+
Sbjct  56   QLGRPMLMAVSLADSIFDKLPKAWY  80



>emb|CBI33948.3| unnamed protein product [Vitis vinifera]
Length=217

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +1

Query  427  VAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            +AV+  ++I DNLPK WF+Y F  IGV+LFVISCFGC+GA TRNGCC
Sbjct  1    MAVTLSSSILDNLPKAWFIYCFFAIGVILFVISCFGCVGAVTRNGCC  47



>gb|AFW61168.1| hypothetical protein ZEAMMB73_111506 [Zea mays]
Length=126

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 70/115 (61%), Gaps = 5/115 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEY-KNHSPSGDDHPIPFPPSSGELVQ  408
            MAC+G  EC+LKLLN ++   GL MVGYG +L V + +              P SGELV+
Sbjct  1    MACRGFFECVLKLLNLVVMAVGLAMVGYGAFLLVTWLQVAPLPPPSSSPDAVPPSGELVR  60

Query  409  LGRPMLVAV--SYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRP+L+ V  S  +   + L   WF++ FIG+G +LFV S FGC GA  RNGCC
Sbjct  61   LGRPLLLFVDASLSDGTAERLSSAWFIFAFIGVGAILFVTSIFGCAGA--RNGCC  113



>ref|NP_001146674.1| uncharacterized protein LOC100280274 [Zea mays]
 gb|ACL54503.1| unknown [Zea mays]
Length=126

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 70/115 (61%), Gaps = 5/115 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEY-KNHSPSGDDHPIPFPPSSGELVQ  408
            MAC+G  EC+LKLLN ++   GL MVGYG +L V + +              P SGELV+
Sbjct  1    MACRGFFECVLKLLNLVVMAVGLAMVGYGAFLLVTWLQVAPLPPPSSSPDAVPPSGELVR  60

Query  409  LGRPMLVAV--SYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRP+L+ V  S  +   + L   WF++ FIG+G +LFV S FGC GAS  NGCC
Sbjct  61   LGRPLLLFVDASLSDGTAERLSSAWFIFAFIGVGAILFVTSIFGCAGAS--NGCC  113



>ref|XP_002443902.1| hypothetical protein SORBIDRAFT_07g004040 [Sorghum bicolor]
 gb|EES13397.1| hypothetical protein SORBIDRAFT_07g004040 [Sorghum bicolor]
Length=274

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 71/116 (61%), Gaps = 6/116 (5%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+G  EC+LKLLN ++   GL MVGYG YL V +   +P          PS G+LV+L
Sbjct  1    MACRGFFECVLKLLNLVVMAVGLAMVGYGAYLLVMWLQVAPPLPPPAPSPAPSGGDLVRL  60

Query  412  GRPMLVAV----SYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRP+L+ V    S  +   + L   WF++ FIG+G +LF+ S FGC GA  RNGCC
Sbjct  61   GRPLLLLVDASLSDSDGTAERLSSAWFIFAFIGVGAILFITSIFGCAGA--RNGCC  114



>ref|XP_003573463.1| PREDICTED: tobamovirus multiplication protein 2A-like [Brachypodium 
distachyon]
Length=278

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 72/119 (61%), Gaps = 7/119 (6%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS----GE  399
            MAC+G  EC+LKLLNF++ + GL M GYG YL V +              P +     G+
Sbjct  1    MACRGFFECVLKLLNFVVMVVGLAMAGYGAYLLVLWLQVLSPPLPPSPAPPAAVAPSGGD  60

Query  400  LVQLGRPMLVAVSYP---NNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LV+LGRPML+ +      N   + L   WF++ FIGIGV+LF+ S FGC GASTR+GCC
Sbjct  61   LVRLGRPMLLLLDASLSDNGTVERLSSAWFIFAFIGIGVILFITSIFGCAGASTRSGCC  119



>gb|ACN35034.1| unknown [Zea mays]
 gb|AFW61169.1| hypothetical protein ZEAMMB73_111506 [Zea mays]
Length=275

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 69/115 (60%), Gaps = 5/115 (4%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEY-KNHSPSGDDHPIPFPPSSGELVQ  408
            MAC+G  EC+LKLLN ++   GL MVGYG +L V + +              P SGELV+
Sbjct  1    MACRGFFECVLKLLNLVVMAVGLAMVGYGAFLLVTWLQVAPLPPPSSSPDAVPPSGELVR  60

Query  409  LGRPML--VAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LGRP+L  V  S  +   + L   WF++ FIG+G +LFV S FGC GA  RNGCC
Sbjct  61   LGRPLLLFVDASLSDGTAERLSSAWFIFAFIGVGAILFVTSIFGCAGA--RNGCC  113



>gb|KCW77892.1| hypothetical protein EUGRSUZ_D021562, partial [Eucalyptus grandis]
 gb|KCW77893.1| hypothetical protein EUGRSUZ_D021562, partial [Eucalyptus grandis]
 gb|KCW77894.1| hypothetical protein EUGRSUZ_D021562, partial [Eucalyptus grandis]
Length=79

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 59/80 (74%), Gaps = 2/80 (3%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GCLEC+LKLLNFLLTL GL MVGYGIYLFVEYK  S SG     P     G  VQL
Sbjct  1    MACRGCLECVLKLLNFLLTLVGLAMVGYGIYLFVEYK-RSSSGTVGYSPIGADEGS-VQL  58

Query  412  GRPMLVAVSYPNNIFDNLPK  471
            GRP+LV VS   +IFDNLPK
Sbjct  59   GRPLLVTVSLSASIFDNLPK  78



>ref|XP_004972786.1| PREDICTED: tetraspanin-20-like isoform X2 [Setaria italica]
Length=278

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 70/120 (58%), Gaps = 10/120 (8%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS-----G  396
            MAC+G  ECLLKLLN ++   GL MVGYG YL V +    P       P P        G
Sbjct  1    MACRGFFECLLKLLNLIVMAVGLAMVGYGAYLLVMWLQVVPPPAPPLPPSPAPVVVAAGG  60

Query  397  ELVQLGRPMLVAV---SYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            ELV+LGRP+++ V   S  +   +     WF++ FIG+GV+LF+ S FGC GA  RNGCC
Sbjct  61   ELVRLGRPLMLLVDASSLSDGTAERFSSAWFIFTFIGVGVVLFITSIFGCAGA--RNGCC  118



>gb|KDP43415.1| hypothetical protein JCGZ_16702 [Jatropha curcas]
Length=229

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 7/86 (8%)
 Frame = +1

Query  313  YGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPM-LVAVSYPNNIFDNLPKEWFLYL  489
            YGI+  V +KN   S   +      +S +  Q+  P  L+A+   + + + LP  WF+YL
Sbjct  29   YGIFCLVNWKNDRESHSHN------NSKKYEQIALPRALLAIEASSWLSNRLPVAWFIYL  82

Query  490  FIGIGVLLFVISCFGCIGASTRNGCC  567
             + IG  L VISCFGC+GA+TR+ CC
Sbjct  83   LLVIGASLIVISCFGCVGAATRSSCC  108



>gb|KHN21027.1| hypothetical protein glysoja_034149 [Glycine soja]
Length=250

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 62/89 (70%), Gaps = 15/89 (17%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPS-----GDDHPIPFPPSSG  396
            MAC+GC ECLLKLLNF+LTLAGL MVGYGIYLFVEY N +P      GDD          
Sbjct  1    MACRGCWECLLKLLNFILTLAGLAMVGYGIYLFVEY-NKTPDNTLTVGDDQT--------  51

Query  397  ELVQLGRPMLVAVSYPNNIFDNLPKEWFL  483
             LVQLGRPMLVAVS  N+  D+LPK  FL
Sbjct  52   -LVQLGRPMLVAVSLSNSFLDDLPKACFL  79



>ref|XP_004972785.1| PREDICTED: tetraspanin-20-like isoform X1 [Setaria italica]
Length=332

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 70/120 (58%), Gaps = 10/120 (8%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS-----G  396
            MAC+G  ECLLKLLN ++   GL MVGYG YL V +    P       P P        G
Sbjct  1    MACRGFFECLLKLLNLIVMAVGLAMVGYGAYLLVMWLQVVPPPAPPLPPSPAPVVVAAGG  60

Query  397  ELVQLGRPMLV---AVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            ELV+LGRP+++   A S  +   +     WF++ FIG+GV+LF+ S FGC GA  RNGCC
Sbjct  61   ELVRLGRPLMLLVDASSLSDGTAERFSSAWFIFTFIGVGVVLFITSIFGCAGA--RNGCC  118



>gb|KHG29161.1| Stk31 [Gossypium arboreum]
Length=259

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 65/82 (79%), Gaps = 6/82 (7%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  405
            MAC+GCLECLLKLLNFL+T+AGL +V YGIYLFV+YK+ +    D  + F P  S  +L+
Sbjct  1    MACRGCLECLLKLLNFLVTVAGLAIVRYGIYLFVKYKDAA----DTVMLFSPVGSDQDLI  56

Query  406  QLGRPMLVAVSYPNNIFDNLPK  471
            QLGRPML+AVS  ++IFDNLPK
Sbjct  57   QLGRPMLMAVSLSSSIFDNLPK  78



>ref|NP_001061041.1| Os08g0159100 [Oryza sativa Japonica Group]
 dbj|BAC99658.1| senescence-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF22955.1| Os08g0159100 [Oryza sativa Japonica Group]
 dbj|BAG92210.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91640.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68082.1| hypothetical protein OsJ_26119 [Oryza sativa Japonica Group]
Length=278

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 73/120 (61%), Gaps = 9/120 (8%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-----  396
            MAC+G  E +LKLLN ++ + GL M+GYG YL V +    PS    P     + G     
Sbjct  1    MACRGFFEWVLKLLNLVVMVVGLAMMGYGAYLLVAWLQLLPSPPPLPPAPAVAPGGGGGG  60

Query  397  ELVQLGRPMLVAV---SYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            E+V+LGRP+L+ +   S P+   + L   WF+Y FIG+GV+LF+ S FGC GAS R GCC
Sbjct  61   EMVRLGRPLLLLLDVSSLPDGTAERLSAAWFIYAFIGVGVILFITSIFGCAGAS-RGGCC  119



>gb|EEC82932.1| hypothetical protein OsI_27894 [Oryza sativa Indica Group]
Length=305

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 73/120 (61%), Gaps = 9/120 (8%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS-----G  396
            MAC+G  E +LKLLNF++ + GL M+GYG YL V +    PS    P P           
Sbjct  1    MACRGFFEWVLKLLNFVVMVVGLAMMGYGAYLLVAWLQLLPSPPLPPAPAVAPGGGGGGS  60

Query  397  ELVQLGRPMLVAV---SYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            E+V+LGRP+L+ +   S P+   + L   WF+Y FIG+GV+LF+ S FGC GAS R GCC
Sbjct  61   EMVRLGRPLLLLLDVSSLPDGTAEKLSAAWFIYTFIGVGVILFITSIFGCAGAS-RGGCC  119



>ref|XP_008788693.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Phoenix dactylifera]
Length=202

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 2/36 (6%)
 Frame = +1

Query  460  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
             LP+  F+YLFIGIGV+LF+ISC GC+GA+TRNGCC
Sbjct  2    KLPR--FIYLFIGIGVILFIISCCGCVGATTRNGCC  35



>gb|KHN01670.1| hypothetical protein glysoja_012981 [Glycine soja]
Length=250

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 57/84 (68%), Gaps = 5/84 (6%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+GC ECLLKLLNF+LTLAGL MVGYGIYLFVEY        D+ + F     E VQ 
Sbjct  1    MACRGCWECLLKLLNFILTLAGLAMVGYGIYLFVEYN----KAWDNTLNFSEDKTE-VQF  55

Query  412  GRPMLVAVSYPNNIFDNLPKEWFL  483
            GRPMLV VS  N+  D LPK  FL
Sbjct  56   GRPMLVVVSLSNSFLDELPKACFL  79



>gb|KCW77895.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
 gb|KCW77896.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
Length=204

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +1

Query  478  FLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            F++LFIG+GV+LF+ISCFGCIG+ TRNGCC
Sbjct  1    FIFLFIGVGVVLFIISCFGCIGSVTRNGCC  30



>ref|XP_010672322.1| PREDICTED: tobamovirus multiplication protein 2A-like [Beta vulgaris 
subsp. vulgaris]
Length=215

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +1

Query  478  FLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            F+Y+FIG+GV+LFVISC GCIGAST++GCC
Sbjct  22   FIYMFIGVGVVLFVISCVGCIGASTKDGCC  51



>ref|XP_006659854.1| PREDICTED: tobamovirus multiplication protein 2A-like [Oryza 
brachyantha]
Length=250

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 64/114 (56%), Gaps = 25/114 (22%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            MAC+G  E +LKLLNF++ + GL MVGYG YL V +                        
Sbjct  1    MACRGFFEWVLKLLNFVVMVVGLAMVGYGAYLLVVWLQ----------------------  38

Query  412  GRPMLVA--VSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            GRP+L+   VS  + I + L   WF++ FIG+GV+LF+ S FGC GAS R GCC
Sbjct  39   GRPLLLLLDVSMSDGIEERLSSAWFIFTFIGVGVILFITSIFGCSGAS-RGGCC  91



>ref|XP_011083093.1| PREDICTED: tetraspanin-18 [Sesamum indicum]
Length=263

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 51/95 (54%), Gaps = 9/95 (9%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPML--VAVSYPNNI----FDN  462
             MV Y  Y+  ++++    GD+ P P P      + L   ++  + ++  +N     F +
Sbjct  27   AMVIYSAYMLSQWQHR---GDEFPPPAPSHDVSGIHLSADVVNHLNLALGDNALHVNFHS  83

Query  463  LPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            LP  WF+Y F+GIGV++  I+C G I A + NGCC
Sbjct  84   LPAPWFIYAFMGIGVIICCITCIGNIAAESINGCC  118



>gb|ACG25649.1| hypothetical protein [Zea mays]
Length=78

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 33/59 (56%), Gaps = 5/59 (8%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSYPNNIFDNLPKEW  477
             MVGYGIYL VE+   S  G         S+ E++  GRP+L AV   ++  DNLPK W
Sbjct  25   AMVGYGIYLLVEWMKISEDGIGGA-----STAEVLVSGRPLLGAVILGDSFLDNLPKAW  78



>ref|XP_002972323.1| hypothetical protein SELMODRAFT_172827 [Selaginella moellendorffii]
 gb|EFJ26409.1| hypothetical protein SELMODRAFT_172827 [Selaginella moellendorffii]
Length=282

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSYPNNIFDNLP-KEW  477
             M+ Y +++  E+  HS     HP    P+  +L       L  V+   N +   P +  
Sbjct  26   AMIVYSLWMLNEW--HSRQEPSHPPAASPAPEQLQDHHHAFLAIVAEKGNGYPRGPGRAT  83

Query  478  FLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            F+Y F+G+G ++ VI+C G + A T +GCC
Sbjct  84   FIYAFLGVGAIVLVITCTGHVAAETASGCC  113



>gb|KCW77897.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
Length=188

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 3/33 (9%)
 Frame = +1

Query  478  FLYLFIGIGVLLFVISCFGCIGASTRN---GCC  567
            F++LFIG+GV+LF+ISCFGCIG+ TRN   GC 
Sbjct  1    FIFLFIGVGVVLFIISCFGCIGSVTRNVELGCA  33



>ref|XP_002984277.1| hypothetical protein SELMODRAFT_229009 [Selaginella moellendorffii]
 gb|EFJ14787.1| hypothetical protein SELMODRAFT_229009 [Selaginella moellendorffii]
Length=258

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 62/112 (55%), Gaps = 8/112 (7%)
 Frame = +1

Query  232  MACKGClecllkllnflltlaglGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  411
            M C+GCL+ ++KLLN LL + GLGM+ Y +++  +   H    DD     P    EL   
Sbjct  1    MKCRGCLQIVVKLLNLLLFVIGLGMILYSVWMLNQLHKHG-DDDDGLNSLPVVRSEL---  56

Query  412  GRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
                L A++  + I  +LP  WF+Y F+G+G+ + +IS  G + A   +GCC
Sbjct  57   ----LGAMANSSRIELSLPVPWFVYAFMGVGIFVCIISFSGYVAAEAASGCC  104



>ref|XP_006408938.1| hypothetical protein EUTSA_v10002082mg [Eutrema salsugineum]
 gb|ESQ50391.1| hypothetical protein EUTSA_v10002082mg [Eutrema salsugineum]
Length=250

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 6/89 (7%)
 Frame = +1

Query  301  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSYPNNIFDNLPKEWF  480
             ++ Y I++  +Y  H P      +  PPS    V L    +V  S  N    +LP  WF
Sbjct  27   SIIIYSIWMLDQYHRHVP------VDPPPSLKNPVDLTASFVVGSSGFNLRSLDLPAPWF  80

Query  481  LYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            +Y F+ +G+L+ +++  G I A   NGCC
Sbjct  81   IYSFMAVGILVCIVTIIGFIAAEAINGCC  109



>ref|XP_006854320.1| hypothetical protein AMTR_s00039p00118150 [Amborella trichopoda]
 gb|ERN15787.1| hypothetical protein AMTR_s00039p00118150 [Amborella trichopoda]
Length=313

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  454  FDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            F+ LP  WF+Y F+GIG+LL +I+C G I A   NGCC
Sbjct  110  FETLPAPWFIYSFMGIGILLCLITCIGHIAAEALNGCC  147



>ref|XP_006350291.1| PREDICTED: tetraspanin-20-like isoform X2 [Solanum tuberosum]
Length=244

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  427  VAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            V ++ P    ++LP  WF+Y F+GIGV+L  I+C G +GA   NGCC
Sbjct  63   VVLALPELNKNSLPAPWFIYAFMGIGVILCCITCIGHVGAEAVNGCC  109



>ref|XP_006350290.1| PREDICTED: tetraspanin-20-like isoform X1 [Solanum tuberosum]
Length=259

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  427  VAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            V ++ P    ++LP  WF+Y F+GIGV+L  I+C G +GA   NGCC
Sbjct  63   VVLALPELNKNSLPAPWFIYAFMGIGVILCCITCIGHVGAEAVNGCC  109



>ref|XP_009342640.1| PREDICTED: tetraspanin-19 [Pyrus x bretschneideri]
Length=220

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +1

Query  466  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGCC  567
            P  WF+Y F+GIG+ L VI+C G I A T NGCC
Sbjct  56   PTPWFIYTFLGIGITLLVITCSGHIAADTANGCC  89



>gb|AFK47805.1| unknown [Medicago truncatula]
Length=249

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 4/68 (6%)
 Frame = +1

Query  364  DHPIPFPPSSGELVQLGRPMLVAVSYPNNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIG  543
            DH  P PP     + L  P   +  + ++I  NLP  WF+Y F+ +G+L+  I+ FGCI 
Sbjct  40   DHFTPQPPLPH--LSLSLPRSFSPQFTSDI--NLPAPWFIYAFMCVGILVCCIAFFGCIA  95

Query  544  ASTRNGCC  567
            A   NGCC
Sbjct  96   AEIINGCC  103



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960