BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF048E07

Length=544
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAS92623.1|  NADPH:cytochrome P450-reductase                       57.0    3e-13   Centaurium erythraea
emb|CDP11509.1|  unnamed protein product                              54.7    8e-13   Coffea canephora [robusta coffee]
dbj|BAC41516.1|  NADPH-cytochrome P-450 reductase                     51.6    2e-12   Ophiorrhiza pumila
ref|XP_004501653.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  52.8    3e-11   
ref|XP_009630023.1|  PREDICTED: NADPH--cytochrome P450 reductase      52.4    5e-11   Nicotiana tomentosiformis
ref|XP_004501654.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  52.0    5e-11   Cicer arietinum [garbanzo]
ref|XP_007018236.1|  NADPH--cytochrome P450 reductase isoform 3       55.8    1e-10   
gb|ACF17649.1|  putative cytochrome reductase                         49.7    1e-10   Capsicum annuum
ref|XP_007018234.1|  P450 reductase 1 isoform 1                       55.5    1e-10   
ref|XP_007136327.1|  hypothetical protein PHAVU_009G036200g           52.0    2e-10   Phaseolus vulgaris [French bean]
ref|XP_006338052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  49.3    2e-10   Solanum tuberosum [potatoes]
ref|XP_004238001.1|  PREDICTED: NADPH--cytochrome P450 reductase      49.3    2e-10   Solanum lycopersicum
emb|CAA81211.1|  NADPH-ferrihemoprotein reductase                     50.8    2e-10   Vicia sativa [spring vetch]
ref|XP_009786522.1|  PREDICTED: NADPH--cytochrome P450 reductase      49.3    4e-10   Nicotiana sylvestris
gb|ADI49691.1|  cytochrome P450 reductase                             48.5    5e-10   Withania somnifera [ashwagandha]
ref|XP_003522768.1|  PREDICTED: NADPH--cytochrome P450 reductase      51.6    6e-10   Glycine max [soybeans]
ref|XP_002514049.1|  cytochrome P450, putative                        50.8    8e-10   Ricinus communis
ref|XP_003602898.1|  NADPH cytochrome P450 reductase                  47.0    2e-09   Medicago truncatula
ref|XP_008338958.1|  PREDICTED: NADPH--cytochrome P450 reductase      49.3    2e-09   Malus domestica [apple tree]
ref|XP_009791726.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  48.1    3e-09   Nicotiana sylvestris
ref|XP_004299743.1|  PREDICTED: NADPH--cytochrome P450 reductase      49.3    5e-09   Fragaria vesca subsp. vesca
ref|XP_007018237.1|  NADPH--cytochrome P450 reductase isoform 4       54.7    5e-09   
sp|P37116.1|NCPR_VIGRR  RecName: Full=NADPH--cytochrome P450 redu...  46.2    6e-09   Vigna radiata var. radiata [golden gram]
pir||A47298  NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung...  46.2    6e-09
gb|KJB58865.1|  hypothetical protein B456_009G229300                  52.8    1e-08   Gossypium raimondii
gb|KJB58863.1|  hypothetical protein B456_009G229300                  52.8    1e-08   Gossypium raimondii
ref|XP_009376208.1|  PREDICTED: NADPH--cytochrome P450 reductase      48.1    1e-08   Pyrus x bretschneideri [bai li]
gb|KJB58864.1|  hypothetical protein B456_009G229300                  52.8    1e-08   Gossypium raimondii
gb|ACN54323.1|  NADPH:cytochrome P450 reductase                       52.8    2e-08   Gossypium hirsutum [American cotton]
ref|XP_008219251.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  48.9    2e-08   
ref|XP_008219252.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  48.9    2e-08   Prunus mume [ume]
ref|XP_007226979.1|  hypothetical protein PRUPE_ppa002280mg           48.9    2e-08   Prunus persica
ref|XP_003526551.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  45.8    3e-08   Glycine max [soybeans]
gb|ACF35281.1|  cytochrome P450 reductase-like protein                48.5    4e-08   Nothapodytes nimmoniana
gb|AAZ39648.1|  cytochrome P450 NADPH-reductase                       46.2    6e-08   Petunia x hybrida [garden petunia]
gb|KDO81193.1|  hypothetical protein CISIN_1g005496mg                 47.8    6e-08   Citrus sinensis [apfelsine]
ref|XP_006472452.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  47.8    6e-08   Citrus sinensis [apfelsine]
gb|KDO81196.1|  hypothetical protein CISIN_1g005496mg                 47.8    6e-08   Citrus sinensis [apfelsine]
gb|KDO81197.1|  hypothetical protein CISIN_1g005496mg                 47.8    6e-08   Citrus sinensis [apfelsine]
gb|KDO81198.1|  hypothetical protein CISIN_1g005496mg                 47.8    6e-08   Citrus sinensis [apfelsine]
ref|XP_010086660.1|  NADPH--cytochrome P450 reductase                 47.8    7e-08   Morus notabilis
ref|XP_002265859.2|  PREDICTED: NADPH--cytochrome P450 reductase      46.2    8e-08   Vitis vinifera
ref|NP_001236742.1|  NADPH:P450 reductase                             49.3    1e-07   
gb|KHN39959.1|  NADPH--cytochrome P450 reductase                      49.3    1e-07   Glycine soja [wild soybean]
ref|XP_006433816.1|  hypothetical protein CICLE_v10000469mg           47.8    1e-07   Citrus clementina [clementine]
gb|EYU36460.1|  hypothetical protein MIMGU_mgv1a002296mg              43.9    1e-07   Erythranthe guttata [common monkey flower]
ref|XP_010530279.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  50.1    1e-07   Tarenaya hassleriana [spider flower]
gb|KHG05124.1|  NADPH--cytochrome P450 reductase                      50.8    2e-07   Gossypium arboreum [tree cotton]
ref|XP_010254555.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  49.7    2e-07   Nelumbo nucifera [Indian lotus]
gb|KDP41487.1|  hypothetical protein JCGZ_15894                       47.8    3e-07   Jatropha curcas
gb|AIG15451.1|  NADPH-cytochrome P450 reductase 1                     44.7    3e-07   Azadirachta indica [Indian-lilac]
ref|XP_010520739.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  48.9    3e-07   Tarenaya hassleriana [spider flower]
ref|XP_011016946.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...  46.2    9e-07   Populus euphratica
gb|AHB33949.1|  cytochrome P450 reductase                             52.4    1e-06   Santalum album
ref|XP_010277516.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  51.6    3e-06   
ref|XP_010277515.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  51.2    4e-06   Nelumbo nucifera [Indian lotus]
gb|KJB14707.1|  hypothetical protein B456_002G138900                  55.5    5e-06   Gossypium raimondii
gb|KJB14708.1|  hypothetical protein B456_002G138900                  55.5    6e-06   Gossypium raimondii
ref|XP_010692385.1|  PREDICTED: NADPH--cytochrome P450 reductase      55.1    7e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009414761.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  53.5    3e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010448554.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  53.1    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010439016.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  53.1    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010433757.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  53.1    3e-05   Camelina sativa [gold-of-pleasure]
gb|AAC05021.1|  NADPH:ferrihemoprotein oxidoreductase                 53.1    3e-05   Papaver somniferum
gb|ACF35282.1|  cytochrome P450 reductase-like protein                52.8    4e-05   Nothapodytes nimmoniana
ref|XP_009382841.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  52.8    4e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006845640.1|  hypothetical protein AMTR_s00019p00222550        52.8    4e-05   
ref|XP_007141274.1|  hypothetical protein PHAVU_008G182200g           48.5    5e-05   Phaseolus vulgaris [French bean]
ref|XP_008789667.1|  PREDICTED: NADPH--cytochrome P450 reductase      52.4    6e-05   Phoenix dactylifera
emb|CDY51656.1|  BnaAnng10960D                                        51.6    9e-05   Brassica napus [oilseed rape]
gb|ADE76209.1|  unknown                                               49.3    1e-04   Picea sitchensis
emb|CDP02981.1|  unnamed protein product                              51.6    1e-04   Coffea canephora [robusta coffee]
emb|CDY03543.1|  BnaC03g68020D                                        51.2    1e-04   
gb|KFK29577.1|  nadph-ferrihemoprotein reductase                      51.2    1e-04   Arabis alpina [alpine rockcress]
emb|CDX68634.1|  BnaC01g08190D                                        51.2    1e-04   
ref|XP_010928663.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  51.2    2e-04   Elaeis guineensis
ref|XP_006412733.1|  hypothetical protein EUTSA_v10024546mg           50.8    2e-04   Eutrema salsugineum [saltwater cress]
dbj|BAJ33878.1|  unnamed protein product                              50.8    2e-04   Eutrema halophilum
emb|CDX85685.1|  BnaA02g01280D                                        50.4    2e-04   
ref|XP_009108997.1|  PREDICTED: NADPH--cytochrome P450 reductase 2    50.4    2e-04   Brassica rapa
emb|CDY34288.1|  BnaA01g13910D                                        50.4    3e-04   Brassica napus [oilseed rape]
ref|XP_008453604.1|  PREDICTED: NADPH--cytochrome P450 reductase 2    50.4    3e-04   Cucumis melo [Oriental melon]
ref|XP_009138145.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  50.4    3e-04   Brassica rapa
emb|CDX72222.1|  BnaC07g42440D                                        50.4    3e-04   
gb|AIC73829.1|  cytochrome P450 reductase                             50.1    3e-04   Panax ginseng [Asiatic ginseng]
ref|XP_006413419.1|  hypothetical protein EUTSA_v10024568mg           50.1    3e-04   Eutrema salsugineum [saltwater cress]
ref|XP_010688489.1|  PREDICTED: NADPH--cytochrome P450 reductase      50.1    3e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009137450.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  50.1    3e-04   Brassica rapa
emb|CDY11017.1|  BnaA03g46760D                                        50.1    3e-04   Brassica napus [oilseed rape]
emb|CDX92639.1|  BnaC07g38970D                                        49.7    4e-04   
ref|XP_002869386.1|  hypothetical protein ARALYDRAFT_913457           49.7    4e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_004146317.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  49.7    4e-04   Cucumis sativus [cucumbers]
ref|XP_011010331.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  49.7    4e-04   Populus euphratica
ref|XP_002867662.1|  hypothetical protein ARALYDRAFT_492391           49.7    4e-04   
ref|XP_011015338.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  47.8    4e-04   Populus euphratica
emb|CAA46814.1|  NADPH-ferrihemoprotein reductase                     49.7    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194183.1|  NADPH--cytochrome P450 reductase 1                  49.7    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010438203.1|  PREDICTED: NADPH--cytochrome P450 reductase 2    49.7    4e-04   Camelina sativa [gold-of-pleasure]
ref|NP_001190823.1|  NADPH--cytochrome P450 reductase 1               49.7    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433014.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  49.7    5e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010447751.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  49.7    5e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010914150.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  49.7    5e-04   Elaeis guineensis
emb|CDY03447.1|  BnaC01g16350D                                        49.3    5e-04   
gb|AHB33950.1|  cytochrome P450 reductase                             49.3    6e-04   Santalum album
gb|KJB22135.1|  hypothetical protein B456_004G0316001                 48.9    6e-04   Gossypium raimondii
emb|CDY28169.1|  BnaA01g06800D                                        49.3    6e-04   Brassica napus [oilseed rape]
gb|AFO64618.1|  cytochrome P450 reductase                             49.3    6e-04   Artemisia annua [sweet Annie]
gb|ABL09938.1|  cytochrome P450 reductase                             49.3    6e-04   Artemisia annua [sweet Annie]
gb|ABI98819.1|  cytochrome P450 reductase                             49.3    6e-04   Artemisia annua [sweet Annie]
ref|XP_004168990.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  48.5    6e-04   
gb|ABM88789.1|  cytochrome P450 reductase                             49.3    6e-04   Artemisia annua [sweet Annie]
dbj|BAG68945.1|  cytochrome P450 reductase                            49.3    6e-04   Lotus japonicus
gb|ABC47946.1|  cytochrome P450 reductase                             49.3    7e-04   Artemisia annua [sweet Annie]
ref|NP_849472.2|  NADPH--cytochrome P450 reductase 2                  49.3    7e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194750.1|  NADPH--cytochrome P450 reductase 2                  49.3    7e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007227446.1|  hypothetical protein PRUPE_ppa002142mg           49.3    7e-04   Prunus persica
ref|XP_006283224.1|  hypothetical protein CARUB_v10004254mg           48.9    7e-04   Capsella rubella
emb|CAA46815.1|  NADPH-ferrihemoprotein reductase                     48.9    7e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929254.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  48.9    8e-04   Elaeis guineensis
gb|ACG27711.1|  NADPH--cytochrome P450 reductase                      48.9    8e-04   Zea mays [maize]
ref|XP_009385909.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  48.9    8e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO43871.1|  hypothetical protein CISIN_1g005072mg                 48.5    0.001   Citrus sinensis [apfelsine]
gb|KDO43868.1|  hypothetical protein CISIN_1g005072mg                 48.5    0.001   Citrus sinensis [apfelsine]



>gb|AAS92623.1| NADPH:cytochrome P450-reductase [Centaurium erythraea]
Length=692

 Score = 57.0 bits (136),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = +3

Query  426  PKAMTA--DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +TA  + EE+  +DP KVKVTVFFGTQTGTAEGFAKAL
Sbjct  62   PKLVTALQEEEEEVDLDPSKVKVTVFFGTQTGTAEGFAKAL  102


 Score = 43.9 bits (102),  Expect(2) = 3e-13, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGND---tvvvllttslavivGLLVFIWKRSGD  396
            LVRS+ESALGVSLG D    V+++LTTSLAVIVGL+VF+WKRS D
Sbjct  7    LVRSIESALGVSLGEDGDKVVILVLTTSLAVIVGLVVFLWKRSSD  51



>emb|CDP11509.1| unnamed protein product [Coffea canephora]
Length=691

 Score = 54.7 bits (130),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = +3

Query  429  KAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K  T+ PEE+   VDP KVKVT+FFGTQTGTAEGFAKAL
Sbjct  62   KLNTSVPEEEEDDVDPSKVKVTIFFGTQTGTAEGFAKAL  100


 Score = 45.1 bits (105),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 2/44 (5%)
 Frame = +1

Query  271  LVRSLESALGVSLGND--tvvvllttslavivGLLVFIWKRSGD  396
            L+RS+ESALGVSLG D   V+++LTTSLA IVGLLVF+WKRS D
Sbjct  7    LIRSIESALGVSLGEDGNQVLLVLTTSLAAIVGLLVFLWKRSSD  50



>dbj|BAC41516.1| NADPH-cytochrome P-450 reductase [Ophiorrhiza pumila]
Length=690

 Score = 51.6 bits (122),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 25/26 (96%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  465  VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            VDP KVKVTVFFGTQTGTAEGFAKAL
Sbjct  75   VDPTKVKVTVFFGTQTGTAEGFAKAL  100


 Score = 47.0 bits (110),  Expect(2) = 2e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 41/44 (93%), Gaps = 2/44 (5%)
 Frame = +1

Query  271  LVRSLESALGVSLGNDt--vvvllttslavivGLLVFIWKRSGD  396
            L+RS+ESALGVSLG+D   ++++LTTSLAVIVGLL+F+WKRSGD
Sbjct  7    LIRSIESALGVSLGDDVNQILLVLTTSLAVIVGLLMFLWKRSGD  50



>ref|XP_004501653.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Cicer 
arietinum]
Length=700

 Score = 52.8 bits (125),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++  + ++D  V  GK KVTV FGTQTGTAEGFAKAL
Sbjct  63   PKSLVKEEDDDIDVGDGKTKVTVLFGTQTGTAEGFAKAL  101


 Score = 41.6 bits (96),  Expect(2) = 3e-11, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 39/45 (87%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGD  396
            LVR++ES LGVSLG+   D++++++TTS AV++GLLVF+WK+S D
Sbjct  8    LVRTIESVLGVSLGDSVSDSLILIVTTSAAVVIGLLVFLWKKSSD  52



>ref|XP_009630023.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=686

 Score = 52.4 bits (124),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++  + EE+  ++PGKVKVTVFFGTQTGTAEGFAKAL
Sbjct  59   PKSLHVESEEEIELEPGKVKVTVFFGTQTGTAEGFAKAL  97


 Score = 41.2 bits (95),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  271  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGD  396
            LVRS+ESALGVSLG+DTV+VLLTTS AVIVGL+V   KRS D
Sbjct  7    LVRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVLFLKRSSD  48



>ref|XP_004501654.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=692

 Score = 52.0 bits (123),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++  + ++D  V  GK KVTV FGTQTGTAEGFAKAL
Sbjct  63   PKSLVKEEDDDIDVGDGKTKVTVLFGTQTGTAEGFAKAL  101


 Score = 41.6 bits (96),  Expect(2) = 5e-11, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 39/45 (87%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGD  396
            LVR++ES LGVSLG+   D++++++TTS AV++GLLVF+WK+S D
Sbjct  8    LVRTIESVLGVSLGDSVSDSLILIVTTSAAVVIGLLVFLWKKSSD  52



>ref|XP_007018236.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
 gb|EOY15461.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
Length=736

 Score = 55.8 bits (133),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            P ++  D ++DAV+  GK KVT+F+GTQTGTAEGFAKAL
Sbjct  65   PISLKDDEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKAL  103


 Score = 37.0 bits (84),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 3/44 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG  393
            LVR +ES LGVSLG    D+++V+ TTSLAVI+GLLVF+WK+S 
Sbjct  7    LVRFVESVLGVSLGGSVTDSMIVIATTSLAVILGLLVFLWKKSA  50



>gb|ACF17649.1| putative cytochrome reductase [Capsicum annuum]
 gb|AFV95075.1| cytochrome P450 reductase [Capsicum annuum]
Length=686

 Score = 49.7 bits (117),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++  +PEE+  V+PGKVKVTVFFGTQTGTAEGFAKAL
Sbjct  59   PKSLNVEPEEEIEVEPGKVKVTVFFGTQTGTAEGFAKAL  97


 Score = 42.7 bits (99),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  271  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGD  396
            LVRS+ESA+GVSLG+D V++LLTTS AVIVGL+VF  KRS D
Sbjct  7    LVRSIESAIGVSLGSDAVLMLLTTSFAVIVGLVVFFLKRSSD  48



>ref|XP_007018234.1| P450 reductase 1 isoform 1 [Theobroma cacao]
 gb|EOY15459.1| P450 reductase 1 isoform 1 [Theobroma cacao]
Length=693

 Score = 55.5 bits (132),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            P ++  D ++DAV+  GK KVT+F+GTQTGTAEGFAKAL
Sbjct  65   PISLKDDEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKAL  103


 Score = 37.0 bits (84),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 3/44 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG  393
            LVR +ES LGVSLG    D+++V+ TTSLAVI+GLLVF+WK+S 
Sbjct  7    LVRFVESVLGVSLGGSVTDSMIVIATTSLAVILGLLVFLWKKSA  50



>ref|XP_007136327.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
 gb|ESW08321.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
Length=692

 Score = 52.0 bits (123),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +  + E+D V V  GK KVTVFFGTQTGTAEGFAKAL
Sbjct  62   PKDLLMEEEDDEVDVGAGKTKVTVFFGTQTGTAEGFAKAL  101


 Score = 39.7 bits (91),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 38/45 (84%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGD  396
            LVR++ES LGVSLG+   D+++++ TTS AV++GL+VF+WK+S D
Sbjct  7    LVRTVESLLGVSLGDSVSDSLLLIATTSAAVVIGLIVFLWKKSSD  51



>ref|XP_006338052.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Solanum tuberosum]
Length=686

 Score = 49.3 bits (116),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++  +PEE+  ++PGKVKVTVFFGTQTGTAEGFAKAL
Sbjct  59   PKSLHVEPEEETELEPGKVKVTVFFGTQTGTAEGFAKAL  97


 Score = 42.4 bits (98),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  271  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGD  396
            L+RS+ESALGVSLG+DTV+VLLTTS AVIVGL+VF  KRS D
Sbjct  7    LLRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVFFLKRSSD  48



>ref|XP_004238001.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=686

 Score = 49.3 bits (116),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++  +PEE+  ++PGKVKVTVFFGTQTGTAEGFAKAL
Sbjct  59   PKSLHVEPEEETELEPGKVKVTVFFGTQTGTAEGFAKAL  97


 Score = 42.4 bits (98),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +1

Query  271  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGD  396
            L+RS+ESALGVSLG+DTV+VLLTTS AVIVGL+VF  KRS D
Sbjct  7    LLRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVFFLKRSSD  48



>emb|CAA81211.1| NADPH-ferrihemoprotein reductase [Vicia sativa]
Length=692

 Score = 50.8 bits (120),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK      +++  VD GK KVTVF+GTQTGTAEGFAKAL
Sbjct  63   PKFTVKHEDDEVEVDRGKTKVTVFYGTQTGTAEGFAKAL  101


 Score = 40.8 bits (94),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 39/45 (87%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGD  396
            LVR++ESALG+SLG+   D+VV++ TTS AVI+GLLVF+W++S D
Sbjct  8    LVRTIESALGISLGDSVSDSVVIIATTSAAVIIGLLVFLWRKSPD  52



>ref|XP_009786522.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=686

 Score = 49.3 bits (116),  Expect(2) = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++  +PEE+  ++PGKVKVTVFFGTQTGTAEGFAKAL
Sbjct  59   PKSLHVEPEEEIELEPGKVKVTVFFGTQTGTAEGFAKAL  97


 Score = 41.2 bits (95),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  271  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGD  396
            LVRS+ESALGVSLG+DTV+VLLTTS AVIVGL+V   KRS D
Sbjct  7    LVRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVLFLKRSSD  48



>gb|ADI49691.1| cytochrome P450 reductase [Withania somnifera]
Length=686

 Score = 48.5 bits (114),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++  +PEE+  ++PGK+KVTVFFGTQTGTAEGFAKAL
Sbjct  59   PKSLHLEPEEETEIEPGKIKVTVFFGTQTGTAEGFAKAL  97


 Score = 41.6 bits (96),  Expect(2) = 5e-10, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  271  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGD  396
            LVRS+ES++GVSLG+D V++LLTTS AVIVGL+VF  KRS D
Sbjct  7    LVRSIESSIGVSLGSDMVLMLLTTSFAVIVGLVVFFLKRSSD  48



>ref|XP_003522768.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
 gb|KHN08276.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score = 51.6 bits (122),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +  D +++  V  GK KVT+FFGTQTGTAEGFAKAL
Sbjct  62   PKGLPKDEDDEIDVADGKTKVTIFFGTQTGTAEGFAKAL  100


 Score = 38.5 bits (88),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 37/45 (82%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGD  396
            LVR++ES LGVSL +   D+++++ TTS AVI+GLLVF+WK+S D
Sbjct  7    LVRAVESLLGVSLADSVSDSLLLIATTSAAVIIGLLVFLWKKSSD  51



>ref|XP_002514049.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF48632.1| cytochrome P450, putative [Ricinus communis]
Length=692

 Score = 50.8 bits (120),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK+++   EED A    GK KVT+F+GTQTGTAEGFAKAL
Sbjct  64   PKSLSVKDEEDEAETLAGKTKVTIFYGTQTGTAEGFAKAL  103


 Score = 38.9 bits (89),  Expect(2) = 8e-10, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 4/46 (9%)
 Frame = +1

Query  271  LVRSLESALGVSLG----NDtvvvllttslavivGLLVFIWKRSGD  396
            LVR +ES LGV LG    +D+VVV++TTS AVI+GLLVF+WKRS D
Sbjct  8    LVRYIESVLGVELGGSPMSDSVVVIITTSFAVIIGLLVFLWKRSSD  53



>ref|XP_003602898.1| NADPH cytochrome P450 reductase [Medicago truncatula]
 gb|AES73149.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula]
Length=692

 Score = 47.0 bits (110),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++  + ++DA +  GK KVTVFFGTQTGTAEGFAKAL
Sbjct  63   PKSLVKEEDDDADIADGKTKVTVFFGTQTGTAEGFAKAL  101


 Score = 41.2 bits (95),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 39/45 (87%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGD  396
            LVR++ES LGVSLG+   D+VV+++TTS AVI+GLLVF+WK+S D
Sbjct  8    LVRTIESVLGVSLGDSVSDSVVLIVTTSAAVIIGLLVFLWKKSSD  52



>ref|XP_008338958.1| PREDICTED: NADPH--cytochrome P450 reductase [Malus domestica]
Length=692

 Score = 49.3 bits (116),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +  + E+D   V  GK++VT+F+GTQTGTAEGFAKAL
Sbjct  62   PKPLAVEEEKDEFEVAAGKIRVTIFYGTQTGTAEGFAKAL  101


 Score = 39.3 bits (90),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGD  396
            LVR+LESALGVS G    DTVVV+ TTS+A+I+G+LV +W+RS D
Sbjct  7    LVRALESALGVSFGGSVTDTVVVIATTSIALIIGVLVLVWRRSSD  51



>ref|XP_009791726.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nicotiana sylvestris]
Length=686

 Score = 48.1 bits (113),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++  +PEE+  ++PGKVKVTVFFGTQTGTAEGF+KAL
Sbjct  59   PKSLHVEPEEEIELEPGKVKVTVFFGTQTGTAEGFSKAL  97


 Score = 39.3 bits (90),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  271  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGD  396
            LVRS+ES LGVSLG+DTV+VLLT S AVIVGL+V   KRS D
Sbjct  7    LVRSIESELGVSLGSDTVLVLLTMSFAVIVGLVVLFLKRSSD  48



>ref|XP_004299743.1| PREDICTED: NADPH--cytochrome P450 reductase [Fragaria vesca subsp. 
vesca]
Length=689

 Score = 49.3 bits (116),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PKA+    EED   V  GK +V++F+GTQTGTAEGFAKAL
Sbjct  62   PKAVVVKEEEDEFEVASGKTRVSIFYGTQTGTAEGFAKAL  101


 Score = 37.7 bits (86),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGD  396
            LVR LESALGVS G    DT V++ TTS+A+I+G+LV +W+RS D
Sbjct  7    LVRKLESALGVSFGESVTDTAVLIATTSIALIIGVLVVLWRRSSD  51



>ref|XP_007018237.1| NADPH--cytochrome P450 reductase isoform 4 [Theobroma cacao]
 gb|EOY15462.1| NADPH--cytochrome P450 reductase isoform 4 [Theobroma cacao]
Length=517

 Score = 54.7 bits (130),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            P ++  D ++DAV+  GK KVT+F+GTQTGTAEGFAKAL
Sbjct  65   PISLKDDEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKAL  103


 Score = 32.3 bits (72),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 3/44 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG  393
            LVR +ES LGVSLG    D+++V+ TTSLAVI+GLLVF+WK+S 
Sbjct  7    LVRFVESVLGVSLGGSVTDSMIVIATTSLAVILGLLVFLWKKSA  50



>sp|P37116.1|NCPR_VIGRR RecName: Full=NADPH--cytochrome P450 reductase; Short=CPR; Short=P450R 
[Vigna radiata var. radiata]
 gb|AAA34240.1| NADPH cytochrome P450 [Vigna radiata]
Length=690

 Score = 46.2 bits (108),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  465  VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            V  GK KVT+FFGTQTGTAEGFAKAL
Sbjct  75   VAAGKTKVTIFFGTQTGTAEGFAKAL  100


 Score = 40.4 bits (93),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 38/45 (84%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGD  396
            LVR++ES LGVSLG+   D+++++ TTS AV+VGLLVF+WK+S D
Sbjct  7    LVRAVESFLGVSLGDSVSDSLLLIATTSAAVVVGLLVFLWKKSSD  51



>pir||A47298 NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung bean
Length=690

 Score = 46.2 bits (108),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  465  VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            V  GK KVT+FFGTQTGTAEGFAKAL
Sbjct  75   VAAGKTKVTIFFGTQTGTAEGFAKAL  100


 Score = 40.4 bits (93),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 38/45 (84%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGD  396
            LVR++ES LGVSLG+   D+++++ TTS AV+VGLLVF+WK+S D
Sbjct  7    LVRAVESFLGVSLGDSVSDSLLLIATTSAAVVVGLLVFLWKKSSD  51



>gb|KJB58865.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=694

 Score = 52.8 bits (125),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            P ++  + ++DAV+  GK KVT+F+GTQTGTAEGFAKAL
Sbjct  65   PVSLKDEEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKAL  103


 Score = 32.7 bits (73),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 3/44 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG  393
            LV  +ES LGVSL     D+++V+ TTSLAVI+GLLVF+WK+SG
Sbjct  7    LVGFVESVLGVSLEGSVTDSMIVVATTSLAVILGLLVFLWKKSG  50



>gb|KJB58863.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=693

 Score = 52.8 bits (125),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            P ++  + ++DAV+  GK KVT+F+GTQTGTAEGFAKAL
Sbjct  65   PVSLKDEEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKAL  103


 Score = 32.7 bits (73),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 3/44 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG  393
            LV  +ES LGVSL     D+++V+ TTSLAVI+GLLVF+WK+SG
Sbjct  7    LVGFVESVLGVSLEGSVTDSMIVVATTSLAVILGLLVFLWKKSG  50



>ref|XP_009376208.1| PREDICTED: NADPH--cytochrome P450 reductase [Pyrus x bretschneideri]
Length=692

 Score = 48.1 bits (113),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +    EED   V  GK +VT+F+GTQTGTAEGFAKAL
Sbjct  62   PKPLEVKEEEDEFDVAAGKSRVTIFYGTQTGTAEGFAKAL  101


 Score = 37.4 bits (85),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGD  396
            LVR+LES LGVS G    DTVVV+ TTS+A+I+G+LV +W+RS D
Sbjct  7    LVRALESVLGVSFGGSVTDTVVVIATTSIALIIGVLVLVWRRSSD  51



>gb|KJB58864.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=586

 Score = 52.8 bits (125),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            P ++  + ++DAV+  GK KVT+F+GTQTGTAEGFAKAL
Sbjct  65   PVSLKDEEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKAL  103


 Score = 32.7 bits (73),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 3/44 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG  393
            LV  +ES LGVSL     D+++V+ TTSLAVI+GLLVF+WK+SG
Sbjct  7    LVGFVESVLGVSLEGSVTDSMIVVATTSLAVILGLLVFLWKKSG  50



>gb|ACN54323.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum]
Length=693

 Score = 52.8 bits (125),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            P ++  + ++DAV+  GK KVT+F+GTQTGTAEGFAKAL
Sbjct  65   PVSLKDEEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKAL  103


 Score = 32.0 bits (71),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 3/44 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG  393
            LV  +ES LGVSL     D+++V+ TTSLAVI+GLLVF WK+SG
Sbjct  7    LVGFVESVLGVSLEGSVTDSMIVIATTSLAVILGLLVFFWKKSG  50



>ref|XP_008219251.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Prunus 
mume]
Length=728

 Score = 48.9 bits (115),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +    EED   V  GK +VT+F+GTQTGTAEGFAKAL
Sbjct  62   PKPLVVKDEEDEFEVASGKTRVTIFYGTQTGTAEGFAKAL  101


 Score = 35.4 bits (80),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGD  396
            LV  LESALGVS G    D+VVV+ TTS+A+I+G+LV +W+RS D
Sbjct  7    LVSMLESALGVSFGGSVTDSVVVIATTSVALILGVLVLVWRRSSD  51



>ref|XP_008219252.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Prunus 
mume]
Length=692

 Score = 48.9 bits (115),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +    EED   V  GK +VT+F+GTQTGTAEGFAKAL
Sbjct  62   PKPLVVKDEEDEFEVASGKTRVTIFYGTQTGTAEGFAKAL  101


 Score = 35.4 bits (80),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGD  396
            LV  LESALGVS G    D+VVV+ TTS+A+I+G+LV +W+RS D
Sbjct  7    LVSMLESALGVSFGGSVTDSVVVIATTSVALILGVLVLVWRRSSD  51



>ref|XP_007226979.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
 gb|EMJ28178.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
Length=692

 Score = 48.9 bits (115),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +    EED   V  GK +VT+F+GTQTGTAEGFAKAL
Sbjct  62   PKPLVVKDEEDEFEVASGKTRVTIFYGTQTGTAEGFAKAL  101


 Score = 35.4 bits (80),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGD  396
            LV  LESALGVS G    D+VVV+ TTS+A+I+G+LV +W+RS D
Sbjct  7    LVSMLESALGVSFGGSVTDSVVVIATTSVALILGVLVLVWRRSSD  51



>ref|XP_003526551.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Glycine max]
 gb|KHN08988.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score = 45.8 bits (107),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  474  GKVKVTVFFGTQTGTAEGFAKAL  542
            GK KVT+FFGTQTGTAEGFAKAL
Sbjct  78   GKTKVTIFFGTQTGTAEGFAKAL  100


 Score = 38.5 bits (88),  Expect(2) = 3e-08, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 37/45 (82%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGD  396
            LVR++ES LGVSL +   D+++++ TTS A+I+GLLVF+WK+S D
Sbjct  7    LVRAVESLLGVSLADSVSDSLLLIATTSAALIIGLLVFLWKKSSD  51



>gb|ACF35281.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=692

 Score = 48.5 bits (114),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAVVD-PGKVKVTVFFGTQTGTAEGFAKAL  542
            PKA+  D EE+ V   PGK KVTVFFGTQTGTAEGFAK+L
Sbjct  63   PKALQLDAEEEEVEVGPGKKKVTVFFGTQTGTAEGFAKSL  102


 Score = 35.0 bits (79),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGD  396
            L+R +ES  GVS G   +DTVV++ TTS+AVI GLLVF+WKRS +
Sbjct  7    LIRWIESMFGVSFGESVSDTVVLIATTSVAVITGLLVFLWKRSSN  51



>gb|AAZ39648.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=687

 Score = 46.2 bits (108),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +3

Query  474  GKVKVTVFFGTQTGTAEGFAKAL  542
            GKVKVTVFFGTQTGTAEGFAK++
Sbjct  76   GKVKVTVFFGTQTGTAEGFAKSI  98


 Score = 37.0 bits (84),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  271  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGD  396
            L +S+ESA GVSL  DT++VLLTTS A+IVGL+VF+ KRS D
Sbjct  8    LFKSIESAFGVSLSTDTLIVLLTTSFALIVGLIVFLLKRSSD  49



>gb|KDO81193.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=694

 Score = 47.8 bits (112),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +3

Query  429  KAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K ++A  E+D A +  GK KVTVF+GTQTGTAEGFAKAL
Sbjct  66   KPLSAKDEDDEADIAAGKTKVTVFYGTQTGTAEGFAKAL  104


 Score = 35.4 bits (80),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 3/43 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRS  390
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKS  51



>ref|XP_006472452.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Citrus sinensis]
Length=694

 Score = 47.8 bits (112),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +3

Query  429  KAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K ++A  E+D A +  GK KVTVF+GTQTGTAEGFAKAL
Sbjct  66   KPLSAKDEDDEADIAAGKTKVTVFYGTQTGTAEGFAKAL  104


 Score = 35.4 bits (80),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 3/43 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRS  390
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKS  51



>gb|KDO81196.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=669

 Score = 47.8 bits (112),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +3

Query  429  KAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K ++A  E+D A +  GK KVTVF+GTQTGTAEGFAKAL
Sbjct  66   KPLSAKDEDDEADIAAGKTKVTVFYGTQTGTAEGFAKAL  104


 Score = 35.4 bits (80),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 3/43 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRS  390
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKS  51



>gb|KDO81197.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=635

 Score = 47.8 bits (112),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +3

Query  429  KAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K ++A  E+D A +  GK KVTVF+GTQTGTAEGFAKAL
Sbjct  66   KPLSAKDEDDEADIAAGKTKVTVFYGTQTGTAEGFAKAL  104


 Score = 35.4 bits (80),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 3/43 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRS  390
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKS  51



>gb|KDO81198.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=599

 Score = 47.8 bits (112),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +3

Query  429  KAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K ++A  E+D A +  GK KVTVF+GTQTGTAEGFAKAL
Sbjct  66   KPLSAKDEDDEADIAAGKTKVTVFYGTQTGTAEGFAKAL  104


 Score = 35.4 bits (80),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 36/43 (84%), Gaps = 3/43 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRS  390
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKS  51



>ref|XP_010086660.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB22547.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=687

 Score = 47.8 bits (112),  Expect(2) = 7e-08, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +    E++ V +  GK KVTVF+GTQTGTAEGFAKAL
Sbjct  58   PKPLLVKDEDNEVELASGKTKVTVFYGTQTGTAEGFAKAL  97


 Score = 35.0 bits (79),  Expect(2) = 7e-08, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +1

Query  271  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGD  396
            LVR+LES LGV +  D+V+V+ TT++A+I+GLLV +W+RS D
Sbjct  7    LVRTLESLLGVPV-TDSVIVIATTAVALILGLLVLVWRRSSD  47



>ref|XP_002265859.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
 emb|CBI19275.3| unnamed protein product [Vitis vinifera]
Length=688

 Score = 46.2 bits (108),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 22/23 (96%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  474  GKVKVTVFFGTQTGTAEGFAKAL  542
            GK KVTVFFGTQTGTAEGFAKAL
Sbjct  76   GKTKVTVFFGTQTGTAEGFAKAL  98


 Score = 36.2 bits (82),  Expect(2) = 8e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +1

Query  271  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGD  396
            L+ ++E+ LGVSLG+++ VV+LTT++AVI+GLL+F+W+ S D
Sbjct  7    LINTVEAFLGVSLGSESAVVILTTTVAVILGLLIFVWRISSD  48



>ref|NP_001236742.1| NADPH:P450 reductase [Glycine max]
 gb|AAN85869.1| NADPH:P450 reductase [Glycine max]
Length=689

 Score = 49.3 bits (116),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +  + EED V    GK +V +FFGTQTGTAEGFAKAL
Sbjct  59   PKLLVKEDEEDEVDAGSGKTRVAIFFGTQTGTAEGFAKAL  98


 Score = 32.7 bits (73),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 37/43 (86%), Gaps = 2/43 (5%)
 Frame = +1

Query  271  LVRSL-ESALGVSLGNDtvvvllttslavivGLLVFIWKRSGD  396
            LVR++ ES LGVS+ +D+V+V+  TS+A+++GLLVF+W++S D
Sbjct  7    LVRTVVESVLGVSV-SDSVMVIAATSVALVIGLLVFVWRKSSD  48



>gb|KHN39959.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=689

 Score = 49.3 bits (116),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +  + EED V    GK +V +FFGTQTGTAEGFAKAL
Sbjct  59   PKLLVKEDEEDEVDAGSGKTRVAIFFGTQTGTAEGFAKAL  98


 Score = 32.7 bits (73),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 37/43 (86%), Gaps = 2/43 (5%)
 Frame = +1

Query  271  LVRSL-ESALGVSLGNDtvvvllttslavivGLLVFIWKRSGD  396
            LVR++ ES LGVS+ +D+V+V+  TS+A+++GLLVF+W++S D
Sbjct  7    LVRTVVESVLGVSV-SDSVMVIAATSVALVIGLLVFVWRKSSD  48



>ref|XP_006433816.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
 gb|ESR47056.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
Length=694

 Score = 47.8 bits (112),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +3

Query  429  KAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K ++A  E+D A +  GK KVTVF+GTQTGTAEGFAKAL
Sbjct  66   KPLSAKDEDDEADIAAGKTKVTVFYGTQTGTAEGFAKAL  104


 Score = 33.9 bits (76),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 3/43 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRS  390
            LV+ +ESALG+SLG+   DTV+++ TTS AV +GLLV +WK+S
Sbjct  9    LVKFVESALGLSLGDSVTDTVILIATTSFAVAIGLLVLVWKKS  51



>gb|EYU36460.1| hypothetical protein MIMGU_mgv1a002296mg [Erythranthe guttata]
Length=690

 Score = 43.9 bits (102),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/22 (95%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +3

Query  477  KVKVTVFFGTQTGTAEGFAKAL  542
            KVKV VFFGTQTGTAEGFAKAL
Sbjct  79   KVKVAVFFGTQTGTAEGFAKAL  100


 Score = 37.7 bits (86),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 2/44 (5%)
 Frame = +1

Query  271  LVRS-LESALGVSLGNDtvvvllttslavivGLLVFIWKR-SGD  396
            LVRS +E  LGV LG++T V++LTTS A+I+GLL+FIWKR SGD
Sbjct  7    LVRSSVEQVLGVKLGDETAVLVLTTSAALILGLLIFIWKRSSGD  50



>ref|XP_010530279.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score = 50.1 bits (118),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A  E+D   +  GK +VT+FFGTQTGTAEGFAKAL
Sbjct  67   PKSLMAKDEDDNFDLGSGKTRVTIFFGTQTGTAEGFAKAL  106


 Score = 31.6 bits (70),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 4/45 (9%)
 Frame = +1

Query  271  LVRSLESALGVSLG----NDtvvvllttslavivGLLVFIWKRSG  393
            LVR LESALG+SLG    +D  +V+ TTSLAVIVG  V +W+++ 
Sbjct  10   LVRYLESALGISLGDSVSDDVALVIATTSLAVIVGFAVLLWRKTA  54



>gb|KHG05124.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=693

 Score = 50.8 bits (120),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            P ++  + ++D V+  GK KVT+F+GTQTGTAEGFAKAL
Sbjct  65   PVSLKDEEDDDDVIASGKTKVTIFYGTQTGTAEGFAKAL  103


 Score = 30.8 bits (68),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 3/44 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG  393
            LV  +ES LGVSL     D+++V+ TTSLAVI+GLL+F WK+SG
Sbjct  7    LVGFVESVLGVSLEGLVTDSMIVIATTSLAVILGLLLFFWKKSG  50



>ref|XP_010254555.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nelumbo nucifera]
Length=692

 Score = 49.7 bits (117),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  471  PGKVKVTVFFGTQTGTAEGFAKAL  542
            PGK KVT+FFGTQTGTAEGFAKAL
Sbjct  79   PGKTKVTIFFGTQTGTAEGFAKAL  102


 Score = 31.6 bits (70),  Expect(2) = 2e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 4/41 (10%)
 Frame = +1

Query  280  SLESALGVSLGN----DtvvvllttslavivGLLVFIWKRS  390
            SL+S LG+SLG+    D+ +++ TTS+AV+VGL+ FIWKRS
Sbjct  11   SLQSILGISLGSESVSDSFILIFTTSVAVLVGLVFFIWKRS  51



>gb|KDP41487.1| hypothetical protein JCGZ_15894 [Jatropha curcas]
Length=689

 Score = 47.8 bits (112),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++T   EED A    GK +V +F+GTQTGTAEGFAK+L
Sbjct  60   PKSLTVKKEEDDAEALAGKTRVIIFYGTQTGTAEGFAKSL  99


 Score = 32.7 bits (73),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 36/45 (80%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGD  396
            LVR +ES LGVSLG    D++++++TTS+AVIVGL VF+ K+S D
Sbjct  5    LVRYVESVLGVSLGGSVTDSLLLIVTTSVAVIVGLFVFLLKKSSD  49



>gb|AIG15451.1| NADPH-cytochrome P450 reductase 1 [Azadirachta indica]
Length=695

 Score = 44.7 bits (104),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  474  GKVKVTVFFGTQTGTAEGFAKAL  542
            GK KVT+F+GTQTGTAEGFAKAL
Sbjct  83   GKTKVTIFYGTQTGTAEGFAKAL  105


 Score = 35.8 bits (81),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 35/45 (78%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGD  396
            LV+ +ESALGVSLG+   DTV+V+ TT  AV++GLLV  WK+S D
Sbjct  10   LVKFVESALGVSLGSSVTDTVIVIATTLFAVVIGLLVLAWKKSSD  54



>ref|XP_010520739.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score = 48.9 bits (115),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  435  MTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            M  D ++D  +  GK +VT+FFGTQTGTAEGFAKAL
Sbjct  71   MAKDEDDDLDMGSGKTRVTIFFGTQTGTAEGFAKAL  106


 Score = 31.6 bits (70),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 4/45 (9%)
 Frame = +1

Query  271  LVRSLESALGVSLG----NDtvvvllttslavivGLLVFIWKRSG  393
            LVR LESALG+SLG    +D  +V+ TTSLAVIVG  V +W+++ 
Sbjct  10   LVRYLESALGISLGDSVSDDAALVIATTSLAVIVGFAVLLWRKTA  54



>ref|XP_011016946.1| PREDICTED: LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like 
[Populus euphratica]
Length=692

 Score = 46.2 bits (108),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 7/43 (16%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDP----GKVKVTVFFGTQTGTAEGFAKAL  542
            PK+++   EED   +P    GK KVT+F+GTQTGTA GFAKAL
Sbjct  63   PKSLSVKDEED---EPEALAGKTKVTIFYGTQTGTAGGFAKAL  102


 Score = 33.1 bits (74),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 3/45 (7%)
 Frame = +1

Query  271  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGD  396
            LVR +ES LGVS G+   D+VVV++TTS AV+ GL+VFI KRS D
Sbjct  8    LVRFVESVLGVSFGDSVSDSVVVIITTSFAVVFGLVVFISKRSSD  52



>gb|AHB33949.1| cytochrome P450 reductase [Santalum album]
Length=692

 Score = 52.4 bits (124),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  450  EEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            E+D  VD GK KVTVFFGTQTGTAEGFAKAL
Sbjct  72   EDDGEVDSGKTKVTVFFGTQTGTAEGFAKAL  102


 Score = 26.2 bits (56),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 4/46 (9%)
 Frame = +1

Query  271  LVRSLESALGVS----LGNDtvvvllttslavivGLLVFIWKRSGD  396
            L +S+ SALGVS       +   V++TTS A+IVG ++F+W+RSG+
Sbjct  7    LWKSIGSALGVSPPPAWAEEWAAVIVTTSAALIVGFVMFMWRRSGE  52



>ref|XP_010277516.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Nelumbo 
nucifera]
Length=651

 Score = 51.6 bits (122),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  468  DPGKVKVTVFFGTQTGTAEGFAKAL  542
            DPGK K+T+FFGTQTGTAEGFAKAL
Sbjct  77   DPGKTKITIFFGTQTGTAEGFAKAL  101


 Score = 25.4 bits (54),  Expect(2) = 3e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 4/45 (9%)
 Frame = +1

Query  271  LVRSLESALGVSLG----NDtvvvllttslavivGLLVFIWKRSG  393
            +  SL+S LGVSLG    +D+ VV+LTTS AV+V L   +W+RS 
Sbjct  8    ITNSLQSILGVSLGYESVSDSFVVVLTTSAAVLVALAFLVWRRSA  52



>ref|XP_010277515.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Nelumbo 
nucifera]
Length=691

 Score = 51.2 bits (121),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 22/25 (88%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +3

Query  468  DPGKVKVTVFFGTQTGTAEGFAKAL  542
            DPGK K+T+FFGTQTGTAEGFAKAL
Sbjct  77   DPGKTKITIFFGTQTGTAEGFAKAL  101


 Score = 25.4 bits (54),  Expect(2) = 4e-06, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 4/45 (9%)
 Frame = +1

Query  271  LVRSLESALGVSLG----NDtvvvllttslavivGLLVFIWKRSG  393
            +  SL+S LGVSLG    +D+ VV+LTTS AV+V L   +W+RS 
Sbjct  8    ITNSLQSILGVSLGYESVSDSFVVVLTTSAAVLVALAFLVWRRSA  52



>gb|KJB14707.1| hypothetical protein B456_002G138900 [Gossypium raimondii]
Length=693

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            P ++  D ++DA+V  GK KVT+F+GTQTGTAEGFAKAL
Sbjct  65   PVSLKVDEDDDALVASGKKKVTIFYGTQTGTAEGFAKAL  103



>gb|KJB14708.1| hypothetical protein B456_002G138900 [Gossypium raimondii]
Length=672

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            P ++  D ++DA+V  GK KVT+F+GTQTGTAEGFAKAL
Sbjct  65   PVSLKVDEDDDALVASGKKKVTIFYGTQTGTAEGFAKAL  103



>ref|XP_010692385.1| PREDICTED: NADPH--cytochrome P450 reductase [Beta vulgaris subsp. 
vulgaris]
Length=693

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++  +PEED + +  GK KV++FFGTQTGTAEGFAKAL
Sbjct  64   PKSLKVEPEEDELEIAAGKTKVSIFFGTQTGTAEGFAKAL  103



>ref|XP_009414761.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=700

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  393  RSE*GGEAGGCPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            R   G +    PK +    + +A VD GK KVTVFFGTQTGTAEGFAKAL
Sbjct  60   RRSLGKKPPSLPKPLVVKVQPEAEVDDGKKKVTVFFGTQTGTAEGFAKAL  109



>ref|XP_010448554.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Camelina 
sativa]
Length=691

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A  ++DA +  GK +V++FFGTQTGTAEGFAKAL
Sbjct  64   PKSLMAKDDDDADLGSGKTRVSIFFGTQTGTAEGFAKAL  102



>ref|XP_010439016.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Camelina 
sativa]
Length=691

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A  ++DA +  GK +V++FFGTQTGTAEGFAKAL
Sbjct  64   PKSLMAKDDDDADLGSGKTRVSIFFGTQTGTAEGFAKAL  102



>ref|XP_010433757.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Camelina 
sativa]
 ref|XP_010433758.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X2 [Camelina 
sativa]
 ref|XP_010433759.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X3 [Camelina 
sativa]
Length=691

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A  ++DA +  GK +V++FFGTQTGTAEGFAKAL
Sbjct  64   PKSLMAKDDDDADLGSGKTRVSIFFGTQTGTAEGFAKAL  102



>gb|AAC05021.1| NADPH:ferrihemoprotein oxidoreductase [Papaver somniferum]
 gb|AHF27398.1| NADPH:ferrihemoprotein oxidoreductase [synthetic construct]
Length=683

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/26 (88%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +3

Query  465  VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            VDPGK+K+T+FFGTQTGTAEGFAKAL
Sbjct  73   VDPGKIKLTIFFGTQTGTAEGFAKAL  98



>gb|ACF35282.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=681

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  450  EEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            EE++ VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  81   EEESEVDDGKKKVTIFFGTQTGTAEGFAKAL  111



>ref|XP_009382841.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=694

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +3

Query  387  IGRSE*GGEAGGC---PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
              RS  GG+A      PK +T +   +   D GK KVTVFFGTQTGTAEGFAKAL
Sbjct  49   FWRSSLGGKASSPVQPPKPLTVNVVREVEADDGKRKVTVFFGTQTGTAEGFAKAL  103



>ref|XP_006845640.1| hypothetical protein AMTR_s00019p00222550 [Amborella trichopoda]
 gb|ERN07315.1| hypothetical protein AMTR_s00019p00222550 [Amborella trichopoda]
Length=711

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +3

Query  447  PEEDAVVDPGKVKVTVFFGTQTGTAEGF  530
            PE++A VDPGK KVT+FFGTQTGTAEGF
Sbjct  86   PEQEAEVDPGKEKVTIFFGTQTGTAEGF  113



>ref|XP_007141274.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
 gb|ESW13268.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
Length=685

 Score = 48.5 bits (114),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PK-AMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK A+  + E++A V  GK +V VFFGTQTGTAEGFAKAL
Sbjct  55   PKLALRQEEEDEADVGLGKTRVVVFFGTQTGTAEGFAKAL  94


 Score = 24.6 bits (52),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 35/42 (83%), Gaps = 4/42 (10%)
 Frame = +1

Query  271  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGD  396
            LVR++   LGVS+ +D+V++++TTS AV++GLLVF+ K+S D
Sbjct  7    LVRTV---LGVSV-SDSVLLIVTTSAAVLIGLLVFVLKKSSD  44



>ref|XP_008789667.1| PREDICTED: NADPH--cytochrome P450 reductase [Phoenix dactylifera]
Length=706

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            P+ +   P+ +  +D GK KVT+FFGTQTGTAEGFAKAL
Sbjct  77   PRPLVVKPDREPDMDDGKKKVTIFFGTQTGTAEGFAKAL  115



>emb|CDY51656.1| BnaAnng10960D [Brassica napus]
Length=706

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 32/49 (65%), Gaps = 6/49 (12%)
 Frame = +3

Query  414  AGGCPK------AMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            +GG PK       +   P  +  VD G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  72   SGGSPKRVETLKPLVIKPPSEDEVDDGRKKVTIFFGTQTGTAEGFAKAL  120



>gb|ADE76209.1| unknown [Picea sitchensis]
Length=137

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 29/44 (66%), Gaps = 3/44 (7%)
 Frame = +3

Query  405  GGEAGGCPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  536
            GG A   P     + EED   D GK KVTVFFGTQTGTAEGFAK
Sbjct  52   GGSAPWKPSEKLKEDEED---DSGKNKVTVFFGTQTGTAEGFAK  92



>emb|CDP02981.1| unnamed protein product [Coffea canephora]
Length=662

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  435  MTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            MT   EE   +D G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  37   MTKSVEEPEEIDDGRTKVTIFFGTQTGTAEGFAKAL  72



>emb|CDY03543.1| BnaC03g68020D [Brassica napus]
Length=710

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +3

Query  393  RSE*GGEAGGCP-KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            RS  G    G P K +   P  +  VD G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  74   RSSAGNSKPGEPLKPLVIKPPREDEVDDGRKKVTIFFGTQTGTAEGFAKAL  124



>gb|KFK29577.1| nadph-ferrihemoprotein reductase [Arabis alpina]
Length=715

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +3

Query  429  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K +   P ED V D G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  91   KPLVIKPREDEV-DDGRKKVTIFFGTQTGTAEGFAKAL  127



>emb|CDX68634.1| BnaC01g08190D [Brassica napus]
Length=712

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +3

Query  429  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K +   P ED V D G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  90   KPLVIKPREDEV-DDGRKKVTIFFGTQTGTAEGFAKAL  126



>ref|XP_010928663.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=706

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +    + ++ VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  77   PKPLMVKTDLESEVDDGKKKVTIFFGTQTGTAEGFAKAL  115



>ref|XP_006412733.1| hypothetical protein EUTSA_v10024546mg [Eutrema salsugineum]
 gb|ESQ54186.1| hypothetical protein EUTSA_v10024546mg [Eutrema salsugineum]
Length=711

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +3

Query  429  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K +   P ED V D G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  89   KPLVIKPREDDV-DDGRKKVTIFFGTQTGTAEGFAKAL  125



>dbj|BAJ33878.1| unnamed protein product [Thellungiella halophila]
Length=711

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +3

Query  429  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K +   P ED V D G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  89   KPLVIKPREDDV-DDGRKKVTIFFGTQTGTAEGFAKAL  125



>emb|CDX85685.1| BnaA02g01280D [Brassica napus]
Length=910

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  DAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            D  VD G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  63   DDEVDDGRKKVTIFFGTQTGTAEGFAKAL  91



>ref|XP_009108997.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Brassica rapa]
Length=707

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  429  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K +   P  +  VD G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  84   KPLVIKPPREDEVDDGRKKVTIFFGTQTGTAEGFAKAL  121



>emb|CDY34288.1| BnaA01g13910D [Brassica napus]
Length=695

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A D +ED  +  GK +V++FFGTQTGTAEGFAKAL
Sbjct  67   PKSLMAKDEDEDVDLGSGKERVSIFFGTQTGTAEGFAKAL  106



>ref|XP_008453604.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Cucumis melo]
Length=708

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 3/40 (8%)
 Frame = +3

Query  426  PKAMTA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK + A +PE +  VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  81   PKPLLAKEPEPE--VDDGKKKVTIFFGTQTGTAEGFAKAL  118



>ref|XP_009138145.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Brassica 
rapa]
Length=695

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A D +ED  +  GK +V++FFGTQTGTAEGFAKAL
Sbjct  67   PKSLMAKDEDEDVDLGSGKERVSIFFGTQTGTAEGFAKAL  106



>emb|CDX72222.1| BnaC07g42440D [Brassica napus]
Length=708

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  429  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K +   P  +  VD G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  85   KPLVIKPPREDEVDDGRKKVTIFFGTQTGTAEGFAKAL  122



>gb|AIC73829.1| cytochrome P450 reductase [Panax ginseng]
Length=678

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +    E +  VD GK KVT+FFGTQTGTAEGFAKA 
Sbjct  52   PKLVIPKIEPEEEVDDGKKKVTIFFGTQTGTAEGFAKAF  90



>ref|XP_006413419.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
 gb|ESQ54872.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
Length=694

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A  E+D V +  GK +V++FFGTQTGTAEGFAKAL
Sbjct  67   PKSLMAKDEDDDVDLISGKTRVSIFFGTQTGTAEGFAKAL  106



>ref|XP_010688489.1| PREDICTED: NADPH--cytochrome P450 reductase [Beta vulgaris subsp. 
vulgaris]
Length=705

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  450  EEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            ++D  VD GK KVTVFFGTQTGTAEGFAKAL
Sbjct  87   DDDVEVDDGKKKVTVFFGTQTGTAEGFAKAL  117



>ref|XP_009137450.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Brassica 
rapa]
Length=695

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A  E+D V +  GK +V++FFGTQTGTAEGFAKAL
Sbjct  67   PKSLMAKDEDDDVDLGSGKTRVSIFFGTQTGTAEGFAKAL  106



>emb|CDY11017.1| BnaA03g46760D [Brassica napus]
Length=695

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A  E+D V +  GK +V++FFGTQTGTAEGFAKAL
Sbjct  67   PKSLMAKDEDDDVDLGSGKTRVSIFFGTQTGTAEGFAKAL  106



>emb|CDX92639.1| BnaC07g38970D [Brassica napus]
Length=695

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A  E+D V +  GK +V++FFGTQTGTAEGFAKAL
Sbjct  67   PKSLMAKDEDDDVDLGSGKERVSIFFGTQTGTAEGFAKAL  106



>ref|XP_002869386.1| hypothetical protein ARALYDRAFT_913457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45645.1| hypothetical protein ARALYDRAFT_913457 [Arabidopsis lyrata subsp. 
lyrata]
Length=711

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +3

Query  429  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K +   P E+ + D GK KVT+FFGTQTGTAEGFAKAL
Sbjct  87   KPLVIKPREEEI-DDGKKKVTIFFGTQTGTAEGFAKAL  123



>ref|XP_004146317.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Cucumis sativus]
 gb|AIT72028.1| cytochrome P450 reductase [Cucumis sativus]
 gb|KGN65457.1| hypothetical protein Csa_1G423150 [Cucumis sativus]
Length=708

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 3/40 (8%)
 Frame = +3

Query  426  PKAMTA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +   +PE +  VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  81   PKPLLGKEPEPE--VDDGKKKVTIFFGTQTGTAEGFAKAL  118



>ref|XP_011010331.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=712

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  465  VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  97   VDDGKKKVTIFFGTQTGTAEGFAKAL  122



>ref|XP_002867662.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43921.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
Length=692

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A  E+D + +  GK +V++FFGTQTGTAEGFAKAL
Sbjct  64   PKSLMAKDEDDDLDLGSGKTRVSIFFGTQTGTAEGFAKAL  103



>ref|XP_011015338.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
 ref|XP_011015339.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=692

 Score = 47.8 bits (112),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK+++   EED +    GK KVT+F+GTQTGTAEGFAKAL
Sbjct  63   PKSVSIKDEEDESEALGGKTKVTIFYGTQTGTAEGFAKAL  102


 Score = 22.3 bits (46),  Expect(2) = 4e-04, Method: Composition-based stats.
 Identities = 9/15 (60%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = +1

Query  271  LVRSLESALGVSLGN  315
            LVR +ES LG+S G+
Sbjct  8    LVRFVESLLGISFGD  22



>emb|CAA46814.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=692

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A  E+D + +  GK +V++FFGTQTGTAEGFAKAL
Sbjct  64   PKSLMAKDEDDDLDLGSGKTRVSIFFGTQTGTAEGFAKAL  103



>ref|NP_194183.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 sp|Q9SB48.1|NCPR1_ARATH RecName: Full=NADPH--cytochrome P450 reductase 1 [Arabidopsis 
thaliana]
 emb|CAA23011.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 emb|CAB79362.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 gb|AAK96879.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 gb|AAP37785.1| At4g24520 [Arabidopsis thaliana]
 gb|AEE84919.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AGA15807.1| CPR1 [Expression vector pUDE172]
Length=692

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A  E+D + +  GK +V++FFGTQTGTAEGFAKAL
Sbjct  64   PKSLMAKDEDDDLDLGSGKTRVSIFFGTQTGTAEGFAKAL  103



>ref|XP_010438203.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Camelina sativa]
Length=709

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++     E+ V D G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  84   PKSLVIKRREEDV-DDGRKKVTIFFGTQTGTAEGFAKAL  121



>ref|NP_001190823.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AEE84920.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
Length=688

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A  E+D + +  GK +V++FFGTQTGTAEGFAKAL
Sbjct  64   PKSLMAKDEDDDLDLGSGKTRVSIFFGTQTGTAEGFAKAL  103



>ref|XP_010433014.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=709

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++     E+ V D G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  84   PKSLVIKRREEDV-DDGRKKVTIFFGTQTGTAEGFAKAL  121



>ref|XP_010447751.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=710

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++     E+ V D G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  84   PKSLVIKRREEDV-DDGRKKVTIFFGTQTGTAEGFAKAL  121



>ref|XP_010914150.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=701

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            P+ +    E +  +D G+ KVTVFFGTQTGTAEGFAKAL
Sbjct  72   PRPLEFREETENELDSGRKKVTVFFGTQTGTAEGFAKAL  110



>emb|CDY03447.1| BnaC01g16350D [Brassica napus]
Length=695

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 2/41 (5%)
 Frame = +3

Query  426  PKAMTA--DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK++ A  + EED  +  GK +V++FFGTQTGTAEGFAKAL
Sbjct  67   PKSLMAKDEDEEDVDLGSGKERVSIFFGTQTGTAEGFAKAL  107



>gb|AHB33950.1| cytochrome P450 reductase [Santalum album]
Length=704

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  453  EDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            E A VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  88   EAAEVDDGKKKVTIFFGTQTGTAEGFAKAL  117



>gb|KJB22135.1| hypothetical protein B456_004G0316001, partial [Gossypium raimondii]
 gb|KJB22136.1| hypothetical protein B456_004G0316001, partial [Gossypium raimondii]
 gb|KJB22137.1| hypothetical protein B456_004G0316001, partial [Gossypium raimondii]
Length=312

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +     E+ V D GK KVT+FFGTQTGTAEGFAKAL
Sbjct  84   PKPLIVKDRENEV-DDGKKKVTIFFGTQTGTAEGFAKAL  121



>emb|CDY28169.1| BnaA01g06800D [Brassica napus]
Length=696

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  465  VDPGKVKVTVFFGTQTGTAEGFAKAL  542
            VD G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  85   VDDGRKKVTIFFGTQTGTAEGFAKAL  110



>gb|AFO64618.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 5/39 (13%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +T D      VD G+ KVTVFFGTQTGTAEGFAKAL
Sbjct  85   PKKVTEDE-----VDDGRKKVTVFFGTQTGTAEGFAKAL  118



>gb|ABL09938.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 5/39 (13%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +T D      VD G+ KVTVFFGTQTGTAEGFAKAL
Sbjct  85   PKKVTEDE-----VDDGRKKVTVFFGTQTGTAEGFAKAL  118



>gb|ABI98819.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 5/39 (13%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +T D      VD G+ KVTVFFGTQTGTAEGFAKAL
Sbjct  85   PKKVTEDE-----VDDGRKKVTVFFGTQTGTAEGFAKAL  118



>ref|XP_004168990.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like, partial [Cucumis 
sativus]
Length=209

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 3/40 (8%)
 Frame = +3

Query  426  PKAMTA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +   +PE +  VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  81   PKPLLGKEPEPE--VDDGKKKVTIFFGTQTGTAEGFAKAL  118



>gb|ABM88789.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 5/39 (13%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +T D      VD G+ KVTVFFGTQTGTAEGFAKAL
Sbjct  85   PKKVTEDE-----VDDGRKKVTVFFGTQTGTAEGFAKAL  118



>dbj|BAG68945.1| cytochrome P450 reductase [Lotus japonicus]
Length=706

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 2/54 (4%)
 Frame = +3

Query  387  IGRSE*GGEAGGC--PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            I R   G +A     PK +     ++A VD G  KVT+FFGTQTGTAEGFAKA+
Sbjct  63   IWRRSTGNKAKSIEPPKRVVEKLSDEAEVDDGTRKVTIFFGTQTGTAEGFAKAI  116



>gb|ABC47946.1| cytochrome P450 reductase [Artemisia annua]
 gb|AEQ63685.1| cytochrome P450 reductase [synthetic construct]
Length=704

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 5/39 (13%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +T D      VD G+ KVTVFFGTQTGTAEGFAKAL
Sbjct  85   PKKVTEDE-----VDDGRKKVTVFFGTQTGTAEGFAKAL  118



>ref|NP_849472.2| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
 gb|AEE85737.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
Length=712

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +3

Query  429  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K +   P E+ + D G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  87   KPLVIKPREEEI-DDGRKKVTIFFGTQTGTAEGFAKAL  123



>ref|NP_194750.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
 sp|Q9SUM3.1|NCPR2_ARATH RecName: Full=NADPH--cytochrome P450 reductase 2 [Arabidopsis 
thaliana]
 gb|AAK17169.1|AF325101_1 NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 emb|CAB52465.1| NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 emb|CAB81014.1| NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 gb|AEE85738.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
Length=711

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +3

Query  429  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K +   P E+ + D G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  87   KPLVIKPREEEI-DDGRKKVTIFFGTQTGTAEGFAKAL  123



>ref|XP_007227446.1| hypothetical protein PRUPE_ppa002142mg [Prunus persica]
 gb|EMJ28645.1| hypothetical protein PRUPE_ppa002142mg [Prunus persica]
Length=710

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 4/39 (10%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            P  +T++PE    VD G  KVT+FFGTQTGTAEGFAKAL
Sbjct  85   PVIVTSEPE----VDDGTKKVTIFFGTQTGTAEGFAKAL  119



>ref|XP_006283224.1| hypothetical protein CARUB_v10004254mg [Capsella rubella]
 gb|EOA16122.1| hypothetical protein CARUB_v10004254mg [Capsella rubella]
Length=710

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  DAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            D  +D G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  94   DEEIDDGRKKVTIFFGTQTGTAEGFAKAL  122



>emb|CAA46815.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=712

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +3

Query  429  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            K +   P E+ + D G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  87   KPLVIKPREEEI-DDGRKKVTIFFGTQTGTAEGFAKAL  123



>ref|XP_010929254.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=704

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            P+ +    E    VD G+ KVTVFFGTQTGTAEGFAK+L
Sbjct  75   PRPLAVRDEPGHEVDDGRKKVTVFFGTQTGTAEGFAKSL  113



>gb|ACG27711.1| NADPH--cytochrome P450 reductase [Zea mays]
Length=703

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  450  EEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            EE+   D G+ KVTVFFGTQTGTAEGFAKAL
Sbjct  83   EEEKPADDGRKKVTVFFGTQTGTAEGFAKAL  113



>ref|XP_009385909.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=703

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  426  PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            PK +      +  VD GK KVTVFFGTQTGTAEGFAKAL
Sbjct  75   PKPLVVRVLPELEVDDGKKKVTVFFGTQTGTAEGFAKAL  113



>gb|KDO43871.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=714

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  450  EEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            E +  VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  95   EPEVEVDDGKQKVTIFFGTQTGTAEGFAKAL  125



>gb|KDO43868.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=715

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  450  EEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  542
            E +  VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  95   EPEVEVDDGKQKVTIFFGTQTGTAEGFAKAL  125



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490