BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF048A02

Length=465
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009800816.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   4e-25   Nicotiana sylvestris
ref|XP_006339720.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   2e-24   Solanum tuberosum [potatoes]
ref|XP_009613969.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   2e-23   Nicotiana tomentosiformis
ref|XP_004248083.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   2e-23   Solanum lycopersicum
ref|XP_006362137.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   3e-23   Solanum tuberosum [potatoes]
ref|XP_004229990.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   2e-22   Solanum lycopersicum
ref|XP_009600181.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   3e-22   
ref|XP_006444833.1|  hypothetical protein CICLE_v10019938mg           98.6    4e-21   Citrus clementina [clementine]
ref|XP_006491285.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  98.6    4e-21   Citrus sinensis [apfelsine]
gb|EYU38885.1|  hypothetical protein MIMGU_mgv1a026932mg              96.7    2e-20   Erythranthe guttata [common monkey flower]
gb|EYU40714.1|  hypothetical protein MIMGU_mgv1a019320mg              96.3    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_009775618.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  96.3    3e-20   Nicotiana sylvestris
ref|XP_008351846.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.5    6e-20   
ref|XP_008343434.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.5    6e-20   
gb|KDP28482.1|  hypothetical protein JCGZ_14253                       95.1    9e-20   Jatropha curcas
ref|XP_002892074.1|  aspartyl protease family protein                 94.7    1e-19   
ref|XP_011093028.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.0    2e-19   Sesamum indicum [beniseed]
ref|XP_011093892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.0    2e-19   Sesamum indicum [beniseed]
ref|XP_007217966.1|  hypothetical protein PRUPE_ppa005289mg           93.6    3e-19   
ref|XP_006418409.1|  hypothetical protein EUTSA_v10009389mg           93.6    3e-19   Eutrema salsugineum [saltwater cress]
emb|CDY15187.1|  BnaC05g00660D                                        92.4    7e-19   Brassica napus [oilseed rape]
gb|KEH24641.1|  eukaryotic aspartyl protease family protein           91.7    1e-18   Medicago truncatula
ref|XP_010474721.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  91.3    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009336767.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    3e-18   Pyrus x bretschneideri [bai li]
ref|XP_002523337.1|  Aspartic proteinase nepenthesin-1 precursor,...  90.5    3e-18   Ricinus communis
emb|CDP08669.1|  unnamed protein product                              90.1    5e-18   Coffea canephora [robusta coffee]
ref|XP_008376086.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    5e-18   Malus domestica [apple tree]
ref|XP_011023172.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    8e-18   Populus euphratica
ref|XP_004494825.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    1e-17   
ref|XP_010266550.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.6    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010095748.1|  Aspartic proteinase nepenthesin-1                88.2    2e-17   Morus notabilis
gb|EYU32252.1|  hypothetical protein MIMGU_mgv1a005685mg              87.4    5e-17   Erythranthe guttata [common monkey flower]
gb|AAM66061.1|  chloroplast nucleoid DNA binding protein, putative    87.4    5e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.0    5e-17   Camelina sativa [gold-of-pleasure]
ref|NP_171637.1|  aspartyl protease family protein                    86.3    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|EPS66029.1|  hypothetical protein M569_08742                       86.3    1e-16   Genlisea aurea
gb|KFK42512.1|  hypothetical protein AALP_AA1G003500                  85.9    2e-16   Arabis alpina [alpine rockcress]
ref|XP_011038277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    2e-16   Populus euphratica
emb|CBI40559.3|  unnamed protein product                              85.1    2e-16   Vitis vinifera
ref|XP_002320868.1|  aspartyl protease family protein                 85.5    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_009119684.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    3e-16   Brassica rapa
ref|XP_002263964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.1    3e-16   Vitis vinifera
emb|CDX90023.1|  BnaA10g00590D                                        85.1    3e-16   
ref|XP_010053832.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  84.3    5e-16   Eucalyptus grandis [rose gum]
ref|XP_002302634.2|  aspartyl protease family protein                 84.0    7e-16   Populus trichocarpa [western balsam poplar]
gb|KJB49569.1|  hypothetical protein B456_008G125700                  83.6    1e-15   Gossypium raimondii
ref|XP_010665756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  83.2    1e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004139658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  82.4    2e-15   Cucumis sativus [cucumbers]
ref|XP_008461984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.6    5e-15   
ref|XP_006307379.1|  hypothetical protein CARUB_v10009005mg           80.1    1e-14   Capsella rubella
ref|XP_010556596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.3    3e-14   Tarenaya hassleriana [spider flower]
emb|CDY43952.1|  BnaC04g21580D                                        79.3    3e-14   Brassica napus [oilseed rape]
ref|XP_010512555.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.0    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010469025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  78.6    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_007147317.1|  hypothetical protein PHAVU_006G113700g           78.6    6e-14   Phaseolus vulgaris [French bean]
emb|CDX89133.1|  BnaA04g00530D                                        77.8    1e-13   
ref|XP_010413342.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  77.4    1e-13   Camelina sativa [gold-of-pleasure]
ref|XP_009138753.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  77.0    2e-13   Brassica rapa
gb|KFK35370.1|  hypothetical protein AALP_AA5G276300                  75.9    5e-13   Arabis alpina [alpine rockcress]
gb|AGV54495.1|  aspartic proteinase nepenthesin-1-like protein        75.5    6e-13   Phaseolus vulgaris [French bean]
gb|AGV54447.1|  aspartic proteinase nepenthesin-1 precursor           75.5    7e-13   Phaseolus vulgaris [French bean]
ref|XP_007135265.1|  hypothetical protein PHAVU_010G114700g           75.5    7e-13   Phaseolus vulgaris [French bean]
ref|XP_002878415.1|  aspartyl protease family protein                 74.7    1e-12   
ref|XP_011461997.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  71.2    4e-12   Fragaria vesca subsp. vesca
gb|KGN56421.1|  Aspartic proteinase nepenthesin-1                     73.2    4e-12   Cucumis sativus [cucumbers]
ref|XP_008437888.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.2    4e-12   Cucumis melo [Oriental melon]
ref|XP_004133810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.8    5e-12   Cucumis sativus [cucumbers]
ref|XP_003554768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.8    5e-12   Glycine max [soybeans]
gb|ABK24467.1|  unknown                                               72.8    6e-12   Picea sitchensis
ref|XP_010480432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.4    8e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010918360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.0    1e-11   Elaeis guineensis
ref|XP_004306664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.9    2e-11   Fragaria vesca subsp. vesca
gb|AAK64003.1|  AT3g61820/F15G16_210                                  70.1    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003529886.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.5    3e-11   Glycine max [soybeans]
emb|CDY25081.1|  BnaC06g18230D                                        70.1    4e-11   Brassica napus [oilseed rape]
ref|NP_191741.1|  aspartyl protease                                   70.1    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799615.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.3    9e-11   Phoenix dactylifera
ref|XP_007051537.1|  Eukaryotic aspartyl protease family protein ...  69.3    9e-11   
ref|XP_007051536.1|  Eukaryotic aspartyl protease family protein ...  69.3    1e-10   
ref|XP_010544842.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.9    1e-10   Tarenaya hassleriana [spider flower]
gb|KJB41527.1|  hypothetical protein B456_007G108800                  67.4    3e-10   Gossypium raimondii
ref|XP_009394177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  67.0    5e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB09628.1|  hypothetical protein B456_001G154400                  66.2    7e-10   Gossypium raimondii
gb|KJB09626.1|  hypothetical protein B456_001G154400                  66.2    9e-10   Gossypium raimondii
ref|XP_004171805.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    9e-10   
ref|XP_009104352.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  65.9    1e-09   Brassica rapa
emb|CDX67868.1|  BnaA07g19080D                                        64.7    3e-09   
ref|XP_010924503.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  60.8    6e-08   Elaeis guineensis
ref|XP_004969076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  60.8    6e-08   Setaria italica
ref|NP_001043485.1|  Os01g0598600                                     60.1    1e-07   
gb|EAZ12575.1|  hypothetical protein OsJ_02481                        59.7    2e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CDX92240.1|  BnaA05g21670D                                        59.3    2e-07   
ref|XP_009145889.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  59.3    2e-07   Brassica rapa
ref|XP_006402438.1|  hypothetical protein EUTSA_v10005923mg           59.3    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_007209939.1|  hypothetical protein PRUPE_ppa004726mg           58.9    3e-07   Prunus persica
ref|XP_008244017.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  58.9    3e-07   Prunus mume [ume]
gb|KJB77420.1|  hypothetical protein B456_012G135900                  58.5    3e-07   Gossypium raimondii
ref|XP_003569303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  58.2    5e-07   Brachypodium distachyon [annual false brome]
emb|CDY24483.1|  BnaC05g34710D                                        57.8    6e-07   Brassica napus [oilseed rape]
ref|XP_002306246.2|  hypothetical protein POPTR_0005s06390g           57.4    7e-07   Populus trichocarpa [western balsam poplar]
gb|KJB79793.1|  hypothetical protein B456_013G067200                  57.4    9e-07   Gossypium raimondii
ref|XP_010279486.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  57.0    9e-07   Nelumbo nucifera [Indian lotus]
ref|XP_006852628.1|  hypothetical protein AMTR_s00021p00234660        57.0    1e-06   Amborella trichopoda
ref|XP_003637421.1|  Aspartic proteinase nepenthesin-1                56.2    1e-06   
ref|XP_009337317.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  57.0    1e-06   Pyrus x bretschneideri [bai li]
ref|XP_009112699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  57.0    1e-06   Brassica rapa
gb|KEH44446.1|  aspartic protease in GUARD CELL-like protein          56.6    1e-06   Medicago truncatula
ref|XP_009337150.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  56.6    1e-06   Pyrus x bretschneideri [bai li]
ref|XP_007142740.1|  hypothetical protein PHAVU_007G013000g           56.2    2e-06   Phaseolus vulgaris [French bean]
ref|XP_006406427.1|  hypothetical protein EUTSA_v10020671mg           56.2    2e-06   Eutrema salsugineum [saltwater cress]
ref|XP_010533981.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  56.2    2e-06   Tarenaya hassleriana [spider flower]
ref|XP_010541885.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.3    2e-06   
emb|CDY69364.1|  BnaCnng63170D                                        56.2    2e-06   Brassica napus [oilseed rape]
gb|KFK39179.1|  hypothetical protein AALP_AA3G210500                  56.2    2e-06   Arabis alpina [alpine rockcress]
tpg|DAA58835.1|  TPA: hypothetical protein ZEAMMB73_701358            56.2    2e-06   
gb|KEH44258.1|  aspartic protease in GUARD CELL-like protein          55.8    2e-06   Medicago truncatula
ref|XP_011007544.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  55.8    2e-06   Populus euphratica
ref|XP_011031192.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  55.8    2e-06   Populus euphratica
ref|XP_010248951.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  55.8    2e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010551158.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  55.8    3e-06   Tarenaya hassleriana [spider flower]
gb|KDO64536.1|  hypothetical protein CISIN_1g011045mg                 55.5    3e-06   Citrus sinensis [apfelsine]
ref|XP_006440937.1|  hypothetical protein CICLE_v10019848mg           55.5    3e-06   Citrus clementina [clementine]
ref|XP_006485768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  55.5    3e-06   Citrus sinensis [apfelsine]
ref|XP_009629151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  55.5    4e-06   Nicotiana tomentosiformis
gb|KJB49971.1|  hypothetical protein B456_008G147500                  55.5    4e-06   Gossypium raimondii
gb|KDO69941.1|  hypothetical protein CISIN_1g011042mg                 55.1    4e-06   Citrus sinensis [apfelsine]
ref|XP_006437655.1|  hypothetical protein CICLE_v10031332mg           54.7    5e-06   
ref|XP_006484478.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.7    5e-06   Citrus sinensis [apfelsine]
ref|XP_003555824.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.7    5e-06   Glycine max [soybeans]
ref|XP_003536757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.7    6e-06   Glycine max [soybeans]
ref|XP_004147103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.7    6e-06   Cucumis sativus [cucumbers]
ref|XP_008351878.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.7    6e-06   
ref|XP_008367576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.7    7e-06   
ref|XP_010466176.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.3    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_004497254.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.3    8e-06   Cicer arietinum [garbanzo]
ref|XP_010487964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.3    8e-06   Camelina sativa [gold-of-pleasure]
ref|XP_011022942.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  54.3    8e-06   Populus euphratica
ref|XP_002309912.2|  hypothetical protein POPTR_0007s04120g           54.3    8e-06   Populus trichocarpa [western balsam poplar]
gb|ABK25248.1|  unknown                                               53.9    9e-06   Picea sitchensis
ref|XP_010506935.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.9    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008802841.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.9    1e-05   Phoenix dactylifera
ref|XP_010908909.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.9    1e-05   
ref|XP_008791252.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.9    1e-05   
ref|XP_004236867.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.9    1e-05   Solanum lycopersicum
ref|XP_006298983.1|  hypothetical protein CARUB_v10015108mg           53.5    1e-05   Capsella rubella
ref|XP_010508355.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.5    1e-05   Camelina sativa [gold-of-pleasure]
gb|ABR17085.1|  unknown                                               53.5    1e-05   Picea sitchensis
ref|XP_003520873.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.5    1e-05   Glycine max [soybeans]
ref|XP_009351765.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.5    1e-05   
ref|XP_008359997.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  53.5    1e-05   Malus domestica [apple tree]
ref|XP_002440367.1|  hypothetical protein SORBIDRAFT_09g030430        53.5    2e-05   
ref|XP_008340423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.5    2e-05   Malus domestica [apple tree]
ref|NP_188478.1|  protein ASPARTIC PROTEASE IN GUARD CELL 1           53.5    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007153018.1|  hypothetical protein PHAVU_003G000900g           53.1    2e-05   Phaseolus vulgaris [French bean]
ref|XP_010549135.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.5    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_006847790.1|  hypothetical protein AMTR_s00029p00016750        53.5    2e-05   Amborella trichopoda
ref|XP_008374731.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.1    2e-05   
ref|XP_010465949.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  53.1    2e-05   Camelina sativa [gold-of-pleasure]
gb|ABR16474.1|  unknown                                               53.1    2e-05   Picea sitchensis
gb|ABK24480.1|  unknown                                               53.1    2e-05   Picea sitchensis
gb|KDP40474.1|  hypothetical protein JCGZ_24473                       52.8    2e-05   Jatropha curcas
emb|CBI35367.3|  unnamed protein product                              53.1    2e-05   Vitis vinifera
ref|XP_010487776.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  52.8    2e-05   Camelina sativa [gold-of-pleasure]
gb|AAL87345.1|  putative chloroplast nucleoid DNA-binding protein     52.8    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  52.8    3e-05   Elaeis guineensis
ref|XP_006406598.1|  hypothetical protein EUTSA_v10020568mg           52.8    3e-05   Eutrema salsugineum [saltwater cress]
ref|XP_007043208.1|  Aspartic proteinase nepenthesin-1, putative      52.8    3e-05   
ref|XP_002267930.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  52.4    3e-05   Vitis vinifera
ref|XP_009760593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  52.4    3e-05   Nicotiana sylvestris
emb|CDY25371.1|  BnaA05g19130D                                        52.4    3e-05   Brassica napus [oilseed rape]
emb|CDY24567.1|  BnaC05g32510D                                        52.4    3e-05   Brassica napus [oilseed rape]
ref|XP_002885351.1|  pepsin A                                         52.4    3e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_006297584.1|  hypothetical protein CARUB_v10013606mg           52.4    4e-05   Capsella rubella
gb|KFK39328.1|  hypothetical protein AALP_AA3G230300                  52.0    4e-05   Arabis alpina [alpine rockcress]
ref|XP_009145693.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  52.0    4e-05   Brassica rapa
ref|XP_002885261.1|  aspartyl protease family protein                 52.0    4e-05   Arabidopsis lyrata subsp. lyrata
gb|EYU40681.1|  hypothetical protein MIMGU_mgv1a005122mg              52.0    4e-05   Erythranthe guttata [common monkey flower]
ref|XP_006360843.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  52.0    5e-05   Solanum tuberosum [potatoes]
ref|XP_002513132.1|  Aspartic proteinase nepenthesin-1 precursor,...  52.0    5e-05   Ricinus communis
ref|NP_188636.2|  protein ASPARTIC PROTEASE IN GUARD CELL 2           51.6    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008351877.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  51.6    6e-05   
ref|XP_011089579.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  51.6    6e-05   Sesamum indicum [beniseed]
ref|XP_010036867.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  51.6    6e-05   
ref|XP_009346910.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  51.6    7e-05   Pyrus x bretschneideri [bai li]
ref|XP_008465249.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  51.2    7e-05   Cucumis melo [Oriental melon]
gb|KDP20100.1|  hypothetical protein JCGZ_05869                       51.2    9e-05   Jatropha curcas
gb|KHN16429.1|  Aspartic proteinase nepenthesin-1                     48.5    9e-05   Glycine soja [wild soybean]
ref|XP_009607692.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  51.2    9e-05   Nicotiana tomentosiformis
ref|XP_004157423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  50.8    1e-04   
ref|XP_004137465.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  50.8    1e-04   Cucumis sativus [cucumbers]
ref|XP_006345303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  50.8    1e-04   Solanum tuberosum [potatoes]
ref|XP_010103590.1|  Aspartic proteinase nepenthesin-2                50.8    1e-04   Morus notabilis
ref|NP_001056485.1|  Os05g0590000                                     50.8    1e-04   
emb|CDP04865.1|  unnamed protein product                              50.8    1e-04   Coffea canephora [robusta coffee]
ref|XP_004497116.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  50.4    1e-04   Cicer arietinum [garbanzo]
ref|XP_004297710.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  50.4    1e-04   Fragaria vesca subsp. vesca
ref|XP_002511962.1|  Aspartic proteinase nepenthesin-1 precursor,...  50.4    1e-04   Ricinus communis
ref|XP_002455897.1|  hypothetical protein SORBIDRAFT_03g026970        50.4    1e-04   
gb|AAT38006.1|  unknow protein                                        50.4    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99240.1|  hypothetical protein OsI_21202                        50.4    1e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504            50.4    1e-04   
ref|XP_011008360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  50.4    2e-04   Populus euphratica
ref|XP_008445900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  50.4    2e-04   Cucumis melo [Oriental melon]
ref|XP_008457107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  50.4    2e-04   
emb|CDX75968.1|  BnaC03g40510D                                        50.1    2e-04   
ref|XP_004150193.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  50.1    2e-04   Cucumis sativus [cucumbers]
ref|XP_010265215.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  50.1    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_004172253.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  50.1    2e-04   
ref|XP_004135107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  50.1    2e-04   Cucumis sativus [cucumbers]
ref|XP_011459743.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  49.3    2e-04   Fragaria vesca subsp. vesca
ref|XP_010031370.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  50.1    2e-04   Eucalyptus grandis [rose gum]
ref|XP_008446567.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  49.7    2e-04   Cucumis melo [Oriental melon]
ref|XP_009135580.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  49.7    2e-04   Brassica rapa
ref|XP_010551288.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  49.7    2e-04   Tarenaya hassleriana [spider flower]
emb|CDX82342.1|  BnaA03g34790D                                        49.7    2e-04   
gb|EEE64882.1|  hypothetical protein OsJ_19741                        49.7    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010477900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  49.7    3e-04   Camelina sativa [gold-of-pleasure]
gb|KCW86348.1|  hypothetical protein EUGRSUZ_B03036                   49.7    3e-04   Eucalyptus grandis [rose gum]
ref|XP_002315953.1|  aspartyl protease family protein                 49.7    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010044282.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  49.3    3e-04   Eucalyptus grandis [rose gum]
ref|XP_007152794.1|  hypothetical protein PHAVU_004G160200g           49.3    3e-04   Phaseolus vulgaris [French bean]
ref|XP_004498098.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  49.3    3e-04   
ref|XP_011077177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  49.3    3e-04   Sesamum indicum [beniseed]
ref|XP_009385987.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  49.3    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004498097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  49.3    4e-04   Cicer arietinum [garbanzo]
ref|XP_004253208.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  49.3    4e-04   Solanum lycopersicum
ref|XP_009770623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  49.3    4e-04   Nicotiana sylvestris
ref|XP_004961034.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  49.3    4e-04   Setaria italica
ref|XP_004512945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  49.3    4e-04   Cicer arietinum [garbanzo]
ref|XP_008221090.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  48.9    5e-04   Prunus mume [ume]
ref|XP_007227097.1|  hypothetical protein PRUPE_ppa025647mg           48.9    5e-04   
gb|ABK24255.1|  unknown                                               48.9    5e-04   Picea sitchensis
emb|CBI27051.3|  unnamed protein product                              48.5    5e-04   Vitis vinifera
ref|XP_006374138.1|  hypothetical protein POPTR_0015s02540g           48.9    5e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011004863.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  48.9    5e-04   Populus euphratica
ref|NP_173922.1|  aspartyl protease family protein                    48.9    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306517.1|  hypothetical protein CARUB_v10012516mg           48.5    5e-04   Capsella rubella
ref|XP_010916474.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  48.9    5e-04   Elaeis guineensis
ref|XP_006415880.1|  hypothetical protein EUTSA_v10009899mg           48.5    6e-04   Eutrema salsugineum [saltwater cress]
ref|XP_008799310.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  48.5    7e-04   Phoenix dactylifera
gb|KJB52970.1|  hypothetical protein B456_008G285900                  48.5    7e-04   Gossypium raimondii
ref|XP_002281973.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  48.1    8e-04   Vitis vinifera
ref|XP_009356391.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  48.1    9e-04   Pyrus x bretschneideri [bai li]
emb|CDY51131.1|  BnaA07g37140D                                        48.1    9e-04   Brassica napus [oilseed rape]
ref|XP_006362549.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  48.1    9e-04   Solanum tuberosum [potatoes]
ref|XP_010460347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  48.1    0.001   Camelina sativa [gold-of-pleasure]
ref|XP_010499100.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  48.1    0.001   Camelina sativa [gold-of-pleasure]



>ref|XP_009800816.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=474

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 78/98 (80%), Gaps = 3/98 (3%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLIS--SAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNA  350
            QP +SENTL++ LHH+DLI+  ++  N TP ALF  RLQRDA RAK LS LA A    NA
Sbjct  53   QPLNSENTLAVQLHHVDLITPYTSLSNTTPHALFKLRLQRDAVRAKLLSNLAEAVANANA  112

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            T  +DFSSSVISGLAQGSGEYFTR+G+GTPPKYA+MVL
Sbjct  113  TV-KDFSSSVISGLAQGSGEYFTRIGIGTPPKYAYMVL  149



>ref|XP_006339720.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=480

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 75/111 (68%), Gaps = 14/111 (13%)
 Frame = +3

Query  168  QLVQPD----DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaa--------raka  311
            QL+  D    D +NTLSL LHH+DL+S ++ NATP ALF  RLQRDA          A  
Sbjct  48   QLLSGDGSDLDPDNTLSLQLHHVDLVSPSSFNATPHALFKLRLQRDAYRAKAISDLAAAN  107

Query  312  lsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             ++   A  PH    GRDFSSSV+SGL+QGSGEYFTR+GVGTPPKY +MVL
Sbjct  108  ATVGRRAGKPHAG--GRDFSSSVVSGLSQGSGEYFTRIGVGTPPKYVYMVL  156



>ref|XP_009613969.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=510

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa-------PPH  344
            D + TLS+ LHH+DL+S ++ NATP ALF  RLQRDAARAKALS LAAA          H
Sbjct  87   DPDTTLSVQLHHVDLVSPSSFNATPHALFKLRLQRDAARAKALSDLAAANITVGRRGGGH  146

Query  345  NATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            +    RDFSSSV SGLAQGSGEYFTRLGVGTPPKYA+MVL
Sbjct  147  HVVGSRDFSSSVTSGLAQGSGEYFTRLGVGTPPKYAYMVL  186



>ref|XP_004248083.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=458

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 6/93 (6%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD  365
            D+ENTLS+ LHH+DL+S ++ NATP ALF  RLQRDA RAK+LSLL+A     N+T G+D
Sbjct  46   DNENTLSVQLHHVDLLSPSSFNATPHALFKLRLQRDAIRAKSLSLLSA-----NST-GKD  99

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            FSSSVISGL+QGSGEYFTR+G+GTP KY ++VL
Sbjct  100  FSSSVISGLSQGSGEYFTRIGIGTPVKYVYLVL  132



>ref|XP_006362137.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=461

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 80/93 (86%), Gaps = 3/93 (3%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD  365
            D+ENTLS+ LHH+DL+S ++ NATP ALF  RLQRDA RAK+LSLL+A+A   N+T G+D
Sbjct  46   DNENTLSVQLHHVDLLSPSSFNATPHALFKLRLQRDAIRAKSLSLLSASA--ANST-GKD  102

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            FSSSVISGL+QGSGEYFTR+G+GTP KY ++VL
Sbjct  103  FSSSVISGLSQGSGEYFTRIGIGTPTKYVYLVL  135



>ref|XP_004229990.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=500

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 73/111 (66%), Gaps = 14/111 (13%)
 Frame = +3

Query  168  QLVQPD----DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaa--------raka  311
            QL+  D    D +N LSL LHH+DL+S ++ NATP ALF  RLQRDA          +  
Sbjct  68   QLLSGDGSDLDPDNALSLQLHHVDLVSPSSFNATPHALFKLRLQRDAYRAKAISDLASAN  127

Query  312  lsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             ++   A  PH    GRDFSSSV+SGL+QGSGEYFTR+GVGTP KY +MVL
Sbjct  128  ATVGRRAGKPHPG--GRDFSSSVVSGLSQGSGEYFTRIGVGTPSKYVYMVL  176



>ref|XP_009600181.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 79/98 (81%), Gaps = 3/98 (3%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLIS--SAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNA  350
            QP +S+NTL++ LHH+DLI+  ++  N TP ALF  RLQRDA RA+ LS LA AA   NA
Sbjct  53   QPLNSQNTLAVQLHHVDLITPYTSLFNTTPHALFKLRLQRDAVRAELLSKLAEAAANANA  112

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            T  +DFSSSVISGLAQGSGEYFTR+G+GTPPKYA++VL
Sbjct  113  TV-KDFSSSVISGLAQGSGEYFTRIGIGTPPKYAYLVL  149



>ref|XP_006444833.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
 gb|ESR58073.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
Length=480

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 68/99 (69%), Gaps = 9/99 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa---arakalsllaaaaPPHNATR  356
            D+E++LSL LHH+D +S    N TP+ LF  R+QRD        A +  A   PP N +R
Sbjct  60   DAESSLSLRLHHVDSLS---FNRTPEHLFNLRIQRDVLRVKSLTAFAESAVRVPPRNRSR  116

Query  357  GR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            GR    FSSSVISGLAQGSGEYFTRLGVGTPP+Y +MVL
Sbjct  117  GRANGGFSSSVISGLAQGSGEYFTRLGVGTPPRYVYMVL  155



>ref|XP_006491285.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|KDO86492.1| hypothetical protein CISIN_1g040810mg [Citrus sinensis]
Length=480

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 68/99 (69%), Gaps = 9/99 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa---arakalsllaaaaPPHNATR  356
            D+E++LSL LHH+D +S    N TP+ LF  R+QRD        A +  A   PP N +R
Sbjct  60   DAESSLSLRLHHVDSLS---FNRTPEHLFNLRIQRDVLRVKSLTAFAESAVRVPPRNRSR  116

Query  357  GR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            GR    FSSSVISGLAQGSGEYFTRLGVGTPP+Y +MVL
Sbjct  117  GRANGGFSSSVISGLAQGSGEYFTRLGVGTPPRYVYMVL  155



>gb|EYU38885.1| hypothetical protein MIMGU_mgv1a026932mg [Erythranthe guttata]
Length=471

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (78%), Gaps = 11/98 (11%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLI---SSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            +S+ TLSLDLHH+D +   +SAA ++TP++LF  RL+RDA R +ALS +A      N + 
Sbjct  55   ESDTTLSLDLHHVDNLPPSASAAFSSTPQSLFKLRLRRDAVRVRALSTIA------NVSV  108

Query  357  GR--DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            GR  DFSSS++SGLAQGSGEYFTR+G+GTPPKY +MVL
Sbjct  109  GRPGDFSSSIVSGLAQGSGEYFTRIGIGTPPKYVYMVL  146



>gb|EYU40714.1| hypothetical protein MIMGU_mgv1a019320mg [Erythranthe guttata]
Length=469

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 75/96 (78%), Gaps = 9/96 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHID-LISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            +S+ TLSLDLHH+D L  SAA ++TP++LF  RL+RDA R +ALS LA      N + GR
Sbjct  55   ESDTTLSLDLHHLDNLPPSAAFSSTPQSLFKLRLRRDAVRVRALSTLA------NVSGGR  108

Query  363  --DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              DFSSS++SGLAQGSGEYFTR+G+GTPPKY +MVL
Sbjct  109  PGDFSSSIVSGLAQGSGEYFTRIGIGTPPKYVYMVL  144



>ref|XP_009775618.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=491

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 76/100 (76%), Gaps = 7/100 (7%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa-------PPH  344
            D + TLS+ LHH+DL+S ++ NATP  LF  RLQRDAARAKALS LAAA          H
Sbjct  68   DPDYTLSVQLHHVDLVSPSSFNATPHTLFKLRLQRDAARAKALSDLAAANITVGRRGGGH  127

Query  345  NATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            +   GRDFSSSV SGLAQGSGEYFTRLGVGTPPKYA+MVL
Sbjct  128  HVVGGRDFSSSVTSGLAQGSGEYFTRLGVGTPPKYAYMVL  167



>ref|XP_008351846.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 71/96 (74%), Gaps = 10/96 (10%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG-----  359
            NTLS+ LHHID +   A+N TP  LF  RLQRDA R K L+ LAAA+P +  TRG     
Sbjct  70   NTLSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAASP-NRTTRGGGXVP  125

Query  360  -RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             R FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVL
Sbjct  126  VRGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVL  161



>ref|XP_008343434.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 71/96 (74%), Gaps = 10/96 (10%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG-----  359
            NTLS+ LHHID +   A+N TP  LF  RLQRDA R K L+ LAAA+P +  TRG     
Sbjct  70   NTLSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAASP-NRTTRGGGRVP  125

Query  360  -RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             R FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVL
Sbjct  126  VRGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVL  161



>gb|KDP28482.1| hypothetical protein JCGZ_14253 [Jatropha curcas]
Length=478

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 72/101 (71%), Gaps = 4/101 (4%)
 Frame = +3

Query  162  LKQLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPP  341
            L+ L    DS  T SL LHHID +S+   N TP+ LF +RLQRDA R +ALS +AA+A  
Sbjct  56   LQTLTDTADS-TTFSLQLHHIDALSN---NKTPQDLFGERLQRDAFRVEALSSVAASAVG  111

Query  342  HNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                 G  FSSSVISGLAQGSGEYFTR+GVGTPP+Y +MVL
Sbjct  112  AGGRVGTGFSSSVISGLAQGSGEYFTRIGVGTPPRYVYMVL  152



>ref|XP_002892074.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68333.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=485

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 71/96 (74%), Gaps = 6/96 (6%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---R  356
            DSE++++L+L HID +SS   N TP+ LF  RLQRD+ R K+++ LAA  P  N T   R
Sbjct  67   DSESSITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVKSIATLAAQIPGRNVTHAPR  123

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
               FSSSV+SGL+QGSGEYFTRLGVGTP +Y +MVL
Sbjct  124  TGGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVL  159



>ref|XP_011093028.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=476

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 76/100 (76%), Gaps = 5/100 (5%)
 Frame = +3

Query  174  VQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  353
            VQP  S  TLSLDLHH+D +S    N+TP++LF  RL+RDA R KALS ++A +  + + 
Sbjct  54   VQPH-SHTTLSLDLHHVDNLS-PDFNSTPQSLFKLRLRRDAIRVKALSTISAVSQTNVSG  111

Query  354  RGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            + R   DFSSSVISGLAQGSGEYFTR+G+GTPPKY +MVL
Sbjct  112  QPRAAGDFSSSVISGLAQGSGEYFTRIGIGTPPKYVYMVL  151



>ref|XP_011093892.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Sesamum 
indicum]
Length=478

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 70/95 (74%), Gaps = 4/95 (4%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD-  365
            SENT SL+LHH+D +S  A N+TP++LF  RL RD  R KALS LAAA   + + R R  
Sbjct  60   SENTFSLNLHHVDSLS-PAFNSTPESLFKLRLHRDGVRVKALSTLAAATQTNVSARARGA  118

Query  366  --FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              FSSSV SGLAQGSGEYFTRLGVGTP KY +MVL
Sbjct  119  PGFSSSVTSGLAQGSGEYFTRLGVGTPAKYVYMVL  153



>ref|XP_007217966.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
 gb|EMJ19165.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
Length=468

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 69/96 (72%), Gaps = 9/96 (9%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka-lsllaaaaPPHNATRG----  359
            NTLS+ LHH+D +S   +N TP  LF  RLQRDA R K   S+ AAAA P+   RG    
Sbjct  51   NTLSVQLHHLDALS---LNKTPSQLFNLRLQRDAVRVKTLSSIAAAAASPNRTARGGRVP  107

Query  360  -RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             R FSSSV+SGLAQGSGEYFTRLGVGTPPKY +MVL
Sbjct  108  IRGFSSSVVSGLAQGSGEYFTRLGVGTPPKYVYMVL  143



>ref|XP_006418409.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
 gb|ESQ36762.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
Length=486

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 72/96 (75%), Gaps = 6/96 (6%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---R  356
            DSE++++L+L HID +S+   N TP+ LF  RLQRD+ R ++++ LAA  P  NAT   R
Sbjct  68   DSESSITLNLDHIDALST---NRTPQELFSFRLQRDSRRVESIATLAARIPRRNATHAPR  124

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
               FSSSV+SGL+QGSGEYFTRLGVGTP +Y +MVL
Sbjct  125  TVGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVL  160



>emb|CDY15187.1| BnaC05g00660D [Brassica napus]
Length=481

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (74%), Gaps = 6/96 (6%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---R  356
            DSE++++L+L HID +S+   N TP+ LF  RLQRD+ R K+++ LAA  P  N T   R
Sbjct  63   DSESSITLNLDHIDALST---NRTPEELFSSRLQRDSRRVKSIATLAARIPRRNTTHAPR  119

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
               FSSSV+SGL+QGSGEYFTRLGVGTP +Y +MVL
Sbjct  120  PGGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVL  155



>gb|KEH24641.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=485

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 68/97 (70%), Gaps = 6/97 (6%)
 Frame = +3

Query  174  VQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  353
            V P + E +LSL LHHID +SS   + TP+ LF  RLQRDAAR ++ +       PH + 
Sbjct  69   VDPIEQE-SLSLQLHHIDTLSS---DKTPQQLFHLRLQRDAARVESFATALNKTRPHRSA  124

Query  354  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             G  FSSS++SGL+QGSGEYFTR+GVGTP +Y FMVL
Sbjct  125  TG--FSSSIVSGLSQGSGEYFTRIGVGTPARYVFMVL  159



>ref|XP_010474721.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=484

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSV  380
            ++L+L HID +SS   N TP+ LF  RLQRD+ R ++++ LAA  P  N T    FSSSV
Sbjct  74   ITLNLDHIDALSS---NKTPQELFSSRLQRDSKRVQSIATLAARVPRRNVTHAPGFSSSV  130

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            +SGL+QGSGEYFTRLGVGTP +Y +MVL
Sbjct  131  VSGLSQGSGEYFTRLGVGTPARYVYMVL  158



>ref|XP_009336767.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=485

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 68/94 (72%), Gaps = 11/94 (12%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG------R  362
            LS+ LHHID +   A+N TP  LF  RLQRDA R K L+ LAA+  P+  TRG      R
Sbjct  72   LSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAS--PNRTTRGGGRVPVR  126

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVL
Sbjct  127  GFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVL  160



>ref|XP_002523337.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF39053.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=469

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 67/93 (72%), Gaps = 4/93 (4%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD  365
            +S  T S+ LHH+D +S    N+TP+ LF  RLQRDAAR +A+S LA  A       G  
Sbjct  55   ESSATFSVQLHHVDALS---FNSTPETLFTTRLQRDAARVEAISYLAETAGTGKRV-GTG  110

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            FSSSVISGLAQGSGEYFTR+GVGTPP+Y +MVL
Sbjct  111  FSSSVISGLAQGSGEYFTRIGVGTPPRYVYMVL  143



>emb|CDP08669.1| unnamed protein product [Coffea canephora]
Length=487

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-DFS  371
            N  SL+LHH+D +S  + +A+P++LF  RLQRDA RAK++S +A+         GR +FS
Sbjct  73   NNFSLELHHVDALS-LSPHASPESLFNLRLQRDAFRAKSISDMASGRGRQGVGLGRMNFS  131

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            SSVISGL+QGSGEYFTRLG+GTPPKY++MVL
Sbjct  132  SSVISGLSQGSGEYFTRLGIGTPPKYSYMVL  162



>ref|XP_008376086.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=487

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 67/97 (69%), Gaps = 10/97 (10%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa-arakalsllaaaaPPHNATRG----  359
            NTLS+ LHHID +   A+N TP  LF  RLQRDA       +L AAAA P+  TRG    
Sbjct  69   NTLSVQLHHIDAM---ALNKTPTQLFHLRLQRDAFRVKALTTLAAAAASPNRTTRGGGHV  125

Query  360  --RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVL
Sbjct  126  PVTGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVL  162



>ref|XP_011023172.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=492

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 69/94 (73%), Gaps = 5/94 (5%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD-  365
            +  +LS+ LHH+D +SS   + TP+ LF  RL RDA+R K+L+ LAAA    N TR R  
Sbjct  76   TTTSLSVQLHHLDALSS---DKTPQDLFNSRLARDASRVKSLTSLAAATGRTNRTRARGP  132

Query  366  -FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             FSSSVISGLAQGSGEYFTRLGVGTP +Y FMVL
Sbjct  133  GFSSSVISGLAQGSGEYFTRLGVGTPARYVFMVL  166



>ref|XP_004494825.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=473

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 67/95 (71%), Gaps = 5/95 (5%)
 Frame = +3

Query  180  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG  359
            P+     LSL LHH+D +S+   N TP+ LF  RLQRDAAR ++ +L AA    H +  G
Sbjct  58   PESDPQPLSLQLHHVDALSN---NKTPQQLFHLRLQRDAARVESFTLAAALNQSHRS--G  112

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              FSSS++SGL+QGSGEYFTR+GVGTP KY FMVL
Sbjct  113  SGFSSSIVSGLSQGSGEYFTRIGVGTPAKYVFMVL  147



>ref|XP_010266550.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=484

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 8/96 (8%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPP---HNATR--  356
            +  L+  L H D +   A N TP+ALF  RL+RDAAR ++LS +AA APP    NATR  
Sbjct  65   QTILTARLEHRDAL---AFNVTPEALFHLRLERDAARVESLSTMAAGAPPVTSRNATRSR  121

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            G  FSSSVISGL+QGSGEYFTR+GVGTPP+Y +MVL
Sbjct  122  GNGFSSSVISGLSQGSGEYFTRIGVGTPPRYVYMVL  157



>ref|XP_010095748.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB62168.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=491

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 66/93 (71%), Gaps = 7/93 (8%)
 Frame = +3

Query  198  TLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD----  365
            ++S  LHHID +S+   + +P+ LF  RLQRDA R K L  + AAA   N +R R     
Sbjct  77   SISAQLHHIDALSA---DKSPEQLFDLRLQRDALRVKNLVEVTAAAASRNVSRTRGAAPG  133

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            FSSSVISGLAQGSGEYFTRLGVGTPP+Y +MVL
Sbjct  134  FSSSVISGLAQGSGEYFTRLGVGTPPRYVYMVL  166



>gb|EYU32252.1| hypothetical protein MIMGU_mgv1a005685mg [Erythranthe guttata]
Length=474

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 77/102 (75%), Gaps = 4/102 (4%)
 Frame = +3

Query  168  QLVQ-PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa--P  338
            Q+++ P +SE   SL+LHH+D +S +++ +TP++LF  RL+RD  R +ALS LAA+A  P
Sbjct  49   QVIETPSESETDFSLNLHHVDSLSPSSI-STPESLFQLRLRRDGVRVEALSTLAASAAAP  107

Query  339  PHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             + + +   FSSSVISGLA GSGEYFTRLGVGTP KY +MVL
Sbjct  108  TNVSGKPHGFSSSVISGLAHGSGEYFTRLGVGTPAKYVYMVL  149



>gb|AAM66061.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
Length=485

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 6/91 (7%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  371
            ++L+L HID +SS   N TP+ LF  RLQRD+ R ++++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVRSIATLAAQIPGRNVTHAPRPGGFS  128

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVL
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVL  159



>ref|XP_010457141.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=485

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 65/91 (71%), Gaps = 6/91 (7%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  371
            ++L+L HID +SS   N TP+ LF  RLQRD+ R  +++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVNSIATLAARVPRRNVTHAPRPGGFS  128

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVL
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVL  159



>ref|NP_171637.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAF97328.1|AC023628_9 Unknown protein [Arabidopsis thaliana]
 gb|AAM91547.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
 gb|AAP31963.1| At1g01300 [Arabidopsis thaliana]
 gb|AEE27268.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=485

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 65/91 (71%), Gaps = 6/91 (7%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  371
            ++L+L HID +SS   N TP  LF  RLQRD+ R K+++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPDELFSSRLQRDSRRVKSIATLAAQIPGRNVTHAPRPGGFS  128

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVL
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVL  159



>gb|EPS66029.1| hypothetical protein M569_08742 [Genlisea aurea]
Length=464

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +3

Query  204  SLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT-RGRDFSSSV  380
            SL L H+D +  +  +A+P+ LF  RL+RDA R + LS     A   N + R RDFSSSV
Sbjct  50   SLGLFHVDDVYYSGADASPELLFQFRLRRDAIRVRDLSAAVVEAAARNVSGRARDFSSSV  109

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             SGL+QGSGEYFTR+G+GTPP+Y +MVL
Sbjct  110  TSGLSQGSGEYFTRIGIGTPPRYVYMVL  137



>gb|KFK42512.1| hypothetical protein AALP_AA1G003500 [Arabis alpina]
Length=477

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSV  380
            ++L+L HID +++   N TP+ LF  RLQRD+ R K+++ LA+     +A R   FSSSV
Sbjct  67   ITLNLDHIDALTT---NRTPQELFTSRLQRDSKRVKSIATLASQRNTTHAPRTGTFSSSV  123

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            +SGL+QGSGEYFTRLGVGTP +Y +MVL
Sbjct  124  VSGLSQGSGEYFTRLGVGTPARYVYMVL  151



>ref|XP_011038277.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Populus 
euphratica]
Length=505

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  171  LVQPDDSENT-LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHN  347
            + +P  S  T LS+ LHHID +SS     + + LF  RL RDAAR K+L  LAA     N
Sbjct  82   ISEPSSSATTSLSVQLHHIDALSSGK---SSQDLFNSRLARDAARVKSLISLAATVGGTN  138

Query  348  ATRGRD--FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             TR R   FSSSVISGLAQGSGEYFTRLGVGTP +Y +MVL
Sbjct  139  LTRARGPGFSSSVISGLAQGSGEYFTRLGVGTPARYVYMVL  179



>emb|CBI40559.3| unnamed protein product [Vitis vinifera]
Length=436

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 9/99 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa----arakalsllaaaaPPHNAT  353
            +++ T+++ L H D++   A NATP+ALF  RLQRDA    A +K  +         N T
Sbjct  96   ETDPTMTMHLEHRDVL---AFNATPEALFNLRLQRDAFRVEALSKMAAAAGGRRAGRNGT  152

Query  354  --RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              +G  FSSSV SGLAQGSGEYFTRLGVGTPPKY +MVL
Sbjct  153  HAQGGGFSSSVTSGLAQGSGEYFTRLGVGTPPKYVYMVL  191



>ref|XP_002320868.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE99183.1| aspartyl protease family protein [Populus trichocarpa]
Length=488

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 68/99 (69%), Gaps = 6/99 (6%)
 Frame = +3

Query  177  QPDDSENT-LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  353
            +P  S  T LS+ LHHID +SS   + + + LF  RL RDAAR K+L  LAA     N T
Sbjct  67   EPSSSATTFLSVQLHHIDALSS---DKSSQDLFNSRLVRDAARVKSLISLAATVGGTNLT  123

Query  354  RGRD--FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            R R   FSSSVISGLAQGSGEYFTRLGVGTP +Y +MVL
Sbjct  124  RARGPGFSSSVISGLAQGSGEYFTRLGVGTPARYVYMVL  162



>ref|XP_009119684.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=481

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = +3

Query  204  SLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSS  374
            +L+L HID +S+   N TP+ LF  RLQRD+ R K+++ LAA  P  N T   R   FSS
Sbjct  69   TLNLDHIDALST---NRTPEELFSSRLQRDSRRVKSIATLAARIPRRNTTHAPRPGGFSS  125

Query  375  SVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            SV+SGL+QGSGEYFTRLGVGTP +Y +MVL
Sbjct  126  SVVSGLSQGSGEYFTRLGVGTPARYVYMVL  155



>ref|XP_002263964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
 emb|CAN64659.1| hypothetical protein VITISV_009613 [Vitis vinifera]
Length=489

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 66/99 (67%), Gaps = 9/99 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa----arakalsllaaaaPPHNAT  353
            +++ T+++ L H D++   A NATP+ALF  RLQRDA    A +K  +         N T
Sbjct  69   ETDPTMTMHLEHRDVL---AFNATPEALFNLRLQRDAFRVEALSKMAAAAGGRRAGRNGT  125

Query  354  --RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              +G  FSSSV SGLAQGSGEYFTRLGVGTPPKY +MVL
Sbjct  126  HAQGGGFSSSVTSGLAQGSGEYFTRLGVGTPPKYVYMVL  164



>emb|CDX90023.1| BnaA10g00590D [Brassica napus]
Length=481

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = +3

Query  204  SLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSS  374
            +L+L HID +S+   N TP+ LF  RLQRD+ R K+++ LAA  P  N T   R   FSS
Sbjct  69   TLNLDHIDALST---NRTPEELFSSRLQRDSRRVKSIATLAARIPRRNTTHAPRPGGFSS  125

Query  375  SVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            SV+SGL+QGSGEYFTRLGVGTP +Y +MVL
Sbjct  126  SVVSGLSQGSGEYFTRLGVGTPARYVYMVL  155



>ref|XP_010053832.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
 gb|KCW78191.1| hypothetical protein EUGRSUZ_D02381 [Eucalyptus grandis]
Length=485

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 7/96 (7%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakals---llaaaaPPHNATRG  359
            +  +LS++L H+D +S    N TP+ALF  RLQRDA+R +++S   + AAAAP  N +R 
Sbjct  68   ATTSLSVELQHVDALS---FNLTPQALFHLRLQRDASRVQSISDLAVAAAAAPAGNVSRP  124

Query  360  R-DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            R  FSSSV+SGLAQGSGEYFTRLGVGTPP+Y +MVL
Sbjct  125  RLGFSSSVVSGLAQGSGEYFTRLGVGTPPRYVYMVL  160



>ref|XP_002302634.2| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE81907.2| aspartyl protease family protein [Populus trichocarpa]
Length=490

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 64/88 (73%), Gaps = 5/88 (6%)
 Frame = +3

Query  207  LDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD--FSSSV  380
            + LHH+D +SS   + TP+ LF  RL RDA+R K+L+ LAAA    N TR R   FSSSV
Sbjct  80   VQLHHLDALSS---DETPQDLFNSRLARDASRVKSLTSLAAAVGSTNRTRARGPGFSSSV  136

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             SGLAQGSGEYFTRLGVGTP +Y FMVL
Sbjct  137  TSGLAQGSGEYFTRLGVGTPARYVFMVL  164



>gb|KJB49569.1| hypothetical protein B456_008G125700 [Gossypium raimondii]
Length=488

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 62/92 (67%), Gaps = 7/92 (8%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----lsllaaaaPPHNATRGRDF  368
            L L+LHH+D +SS     TP+ LF  RLQRDA RA+     +S   A   P    R   F
Sbjct  75   LQLELHHLDALSS---EETPERLFDLRLQRDALRAETINSLVSKAVARKHPRAPGRRPGF  131

Query  369  SSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            SSSVISGLAQGSGEYFTRLGVGTPP+Y +MVL
Sbjct  132  SSSVISGLAQGSGEYFTRLGVGTPPRYLYMVL  163



>ref|XP_010665756.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Beta 
vulgaris subsp. vulgaris]
Length=484

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 70/108 (65%), Gaps = 10/108 (9%)
 Frame = +3

Query  162  LKQLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka--lsllaaaa  335
            L++L      ++T +L L H+D +SS   + TP+ LF  RL+RD ARAK       +++ 
Sbjct  54   LEELELSTSIDSTFTLHLEHLDALSS---HLTPEELFSFRLKRDDARAKTIFARAHSSSR  110

Query  336  PPHNATRG-----RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              H   R      RDFSSS++SGL+QGSGEYFTRLGVGTPPKY +MVL
Sbjct  111  SAHKHGRNASHSTRDFSSSIVSGLSQGSGEYFTRLGVGTPPKYMYMVL  158



>ref|XP_004139658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004154449.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN44550.1| hypothetical protein Csa_7G329350 [Cucumis sativus]
Length=453

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 59/88 (67%), Gaps = 14/88 (16%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSV  380
            L+LDLHH+D   S ++N TP  LF  RL RD  R  AL+           +R   FSSSV
Sbjct  54   LTLDLHHLD---SLSLNKTPTDLFNLRLHRDTLRVHALN-----------SRAAGFSSSV  99

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            +SGL+QGSGEYFTRLGVGTPP+Y +MVL
Sbjct  100  VSGLSQGSGEYFTRLGVGTPPRYLYMVL  127



>ref|XP_008461984.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=517

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 60/88 (68%), Gaps = 13/88 (15%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSV  380
            L+LDLHH+D   S ++N TP  LF  RL RDA R  AL+          A  G  FSSSV
Sbjct  117  LTLDLHHLD---SLSLNKTPTDLFNLRLHRDALRVHALTS--------RAAPG--FSSSV  163

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            ISGLAQGSGEYFTRLGVGTPP+Y +MVL
Sbjct  164  ISGLAQGSGEYFTRLGVGTPPRYLYMVL  191



>ref|XP_006307379.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
 gb|EOA40277.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
Length=481

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +3

Query  210  DLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSSSV  380
            +L HID +SS   N TP  LF  RL RD+ R K++  LAA  P  N T   R   FSSSV
Sbjct  71   NLDHIDALSS---NKTPDELFSSRLLRDSRRVKSIVTLAARVPRRNVTHAPRPGGFSSSV  127

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            +SGL+QGSGEYFTRLGVGTP +Y +MVL
Sbjct  128  VSGLSQGSGEYFTRLGVGTPARYVYMVL  155



>ref|XP_010556596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=467

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGL  392
            LHHID +S+   N TP+ LF  RL RD+ R ++++ L       +A     FSSSVISGL
Sbjct  61   LHHIDALSA---NKTPEQLFHLRLHRDSRRVESIAALTRRGNASHAPSAAGFSSSVISGL  117

Query  393  AQGSGEYFTRLGVGTPPKYAFMVL  464
            +QGSGEYFTR+GVGTP +Y +MVL
Sbjct  118  SQGSGEYFTRIGVGTPARYLYMVL  141



>emb|CDY43952.1| BnaC04g21580D [Brassica napus]
Length=483

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 67/105 (64%), Gaps = 6/105 (6%)
 Frame = +3

Query  165  KQLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPH  344
            + L  P  S  +LSL L HID ISS + +A+P  LF  RL+RD+ R ++L+ LAA +   
Sbjct  49   ESLTTPSQSTTSLSLHLSHIDAISSFS-DASPAELFDLRLKRDSIRVESLTSLAAVSSRR  107

Query  345  NATR-----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            N TR        FS +VISGL+QGSGEYF RLGVGTP    +MVL
Sbjct  108  NVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNMYMVL  152



>ref|XP_010512555.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            QP+ + ++LS+ L H+D +SS + +A+P  LF  RLQRD+ R ++++ LAA +   N TR
Sbjct  53   QPESTTSSLSVHLSHVDALSSLS-DASPTDLFNLRLQRDSLRVESIASLAAVSTGRNVTR  111

Query  357  -----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                    FS +VISGL+QGSGEYF RLGVGTP    +MVL
Sbjct  112  KTPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYMVL  152



>ref|XP_010469025.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=486

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            QP+ + ++LS+ L H+D + S + +A+P ALF  RLQRD+ R +++S LAA +   N TR
Sbjct  56   QPESTTSSLSVHLSHVDALYSFS-DASPTALFNLRLQRDSLRVESISSLAAVSTGRNVTR  114

Query  357  -----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                    FS +VISGL+QGSGEYF RLGVGTP    +MVL
Sbjct  115  RTPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYMVL  155



>ref|XP_007147317.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
 gb|ESW19311.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
Length=534

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 69/100 (69%), Gaps = 4/100 (4%)
 Frame = +3

Query  165  KQLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPH  344
            + L +PD  E  LSL+LHHID +SS   N TP+ LF  RLQRD  R ++L  LAA    H
Sbjct  114  EALAEPD-PEEALSLNLHHIDALSS---NKTPEQLFHLRLQRDGKRVQSLLTLAALNSSH  169

Query  345  NATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                G  FSSS+ISGLAQGSGEYFTR+GVGTP KY +MVL
Sbjct  170  ARRSGSGFSSSIISGLAQGSGEYFTRIGVGTPAKYVYMVL  209



>emb|CDX89133.1| BnaA04g00530D [Brassica napus]
Length=483

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 67/105 (64%), Gaps = 6/105 (6%)
 Frame = +3

Query  165  KQLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPH  344
            + L     S  +LSL L H+D ISS + +A+P  LF  RL+RD+ R ++L+ LAA +   
Sbjct  49   ESLTTVSQSTTSLSLHLSHVDAISSFS-DASPAELFNLRLKRDSLRVESLTTLAAVSSRR  107

Query  345  NATR-----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            N TR        FS +VISGL+QGSGEYF RLGVGTP K  +MVL
Sbjct  108  NVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPAKNMYMVL  152



>ref|XP_010413342.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=488

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 68/101 (67%), Gaps = 6/101 (6%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            QP+ + ++LS+ L H+D + S + +A+P  LF  RLQRD+ R +++S LAA +   NATR
Sbjct  58   QPESTTSSLSVHLSHVDALFSFS-DASPTDLFNLRLQRDSLRVESISSLAAVSTGRNATR  116

Query  357  -----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                    FS +VISGL+QGSGEYF RLGVGTP    +MVL
Sbjct  117  RTPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYMVL  157



>ref|XP_009138753.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=483

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 6/105 (6%)
 Frame = +3

Query  165  KQLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPH  344
            + L     S  +LSL L H+D ISS A +A+P  LF  RL+RD+ R ++L+ LAA +   
Sbjct  49   ESLTTVSQSTTSLSLHLSHVDAISSFA-DASPAELFNLRLKRDSLRVESLTTLAAVSSRR  107

Query  345  NATR-----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            N TR        FS +VISGL+QGSGEYF RLGVGTP    +MVL
Sbjct  108  NVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNMYMVL  152



>gb|KFK35370.1| hypothetical protein AALP_AA5G276300 [Arabis alpina]
Length=485

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 70/114 (61%), Gaps = 17/114 (15%)
 Frame = +3

Query  171  LVQPDDSEN---------TLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll  323
            L  PD SE+         +LS+ L HID +SS + ++TP  LF  RL+RD+ R  +++ L
Sbjct  42   LSWPDQSESEFKSESTTTSLSVHLSHIDALSSFS-DSTPSELFNLRLRRDSLRVNSITKL  100

Query  324  aaaaPPHNATRGR-------DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            AA +   N TR +        FS +VISGL+QGSGEYF RLGVGTP   A+MVL
Sbjct  101  AAVSTGRNITRKKRTPKSSGGFSGAVISGLSQGSGEYFMRLGVGTPATNAYMVL  154



>gb|AGV54495.1| aspartic proteinase nepenthesin-1-like protein [Phaseolus vulgaris]
Length=476

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 71/96 (74%), Gaps = 6/96 (6%)
 Frame = +3

Query  186  DSE---NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            DSE   +T+S+++HHID +S   +N TP  LF  RLQRDAAR K+LS LAA       T 
Sbjct  59   DSEPDPDTISVNVHHIDALS---LNKTPSQLFHFRLQRDAARVKSLSSLAALNQTRPTTS  115

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            G  FSSSVISGLAQGSGEYFTRLGVGTPPKY +MVL
Sbjct  116  GSGFSSSVISGLAQGSGEYFTRLGVGTPPKYVYMVL  151



>gb|AGV54447.1| aspartic proteinase nepenthesin-1 precursor [Phaseolus vulgaris]
Length=477

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 71/96 (74%), Gaps = 6/96 (6%)
 Frame = +3

Query  186  DSE---NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            DSE   +T+S+++HHID +S   +N TP  LF  RLQRDAAR K+LS LAA       T 
Sbjct  59   DSEPDPDTISVNVHHIDALS---LNKTPSQLFHFRLQRDAARVKSLSSLAALNQTRPTTS  115

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            G  FSSSVISGLAQGSGEYFTRLGVGTPPKY +MVL
Sbjct  116  GSGFSSSVISGLAQGSGEYFTRLGVGTPPKYVYMVL  151



>ref|XP_007135265.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
 gb|ESW07259.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
Length=477

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 71/96 (74%), Gaps = 6/96 (6%)
 Frame = +3

Query  186  DSE---NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            DSE   +T+S+++HHID +S   +N TP  LF  RLQRDAAR K+LS LAA       T 
Sbjct  59   DSEPDPDTISVNVHHIDALS---LNKTPSQLFHFRLQRDAARVKSLSSLAALNQTRPTTS  115

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            G  FSSSVISGLAQGSGEYFTRLGVGTPPKY +MVL
Sbjct  116  GSGFSSSVISGLAQGSGEYFTRLGVGTPPKYVYMVL  151



>ref|XP_002878415.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54674.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 67/99 (68%), Gaps = 8/99 (8%)
 Frame = +3

Query  189  SENTLSLDLH--HIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR--  356
            SE+T SL +H  H+D +SS + +A+P  LF  RLQRD+ R K+++ LAA +   NAT+  
Sbjct  58   SESTTSLSVHLSHVDALSSFS-DASPVDLFKLRLQRDSLRVKSITSLAAVSTGRNATKRT  116

Query  357  ---GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                  FS +VISGL+QGSGEYF RLGVGTP    +MVL
Sbjct  117  PRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYMVL  155



>ref|XP_011461997.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Fragaria 
vesca subsp. vesca]
Length=261

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 67/105 (64%), Gaps = 12/105 (11%)
 Frame = +3

Query  162  LKQLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPP  341
            L++  +PD   ++LSL LHH+D +SS   N TP  LF  RL+RD+ R  +L+ LA     
Sbjct  29   LEKTSEPDSDPSSLSLPLHHLDALSS---NQTPSQLFHLRLRRDSLRFNSLTSLA-----  80

Query  342  HNATRGRDFSSSVIS----GLAQGSGEYFTRLGVGTPPKYAFMVL  464
            +N TR    SS   S    GL+QGSGEYFTR+GVG+ PKY +MVL
Sbjct  81   YNRTRPGPPSSGFSSSIVSGLSQGSGEYFTRIGVGSSPKYLYMVL  125



>gb|KGN56421.1| Aspartic proteinase nepenthesin-1 [Cucumis sativus]
Length=512

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  249  NATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFTRL  425
            N TP+ LF  RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFTR+
Sbjct  115  NRTPEELFHLRLQRDAIRVKKLSSLGATSRNLSKPGGTTGFSSSVISGLAQGSGEYFTRI  174

Query  426  GVGTPPKYAFMVL  464
            GVGTPPKY +MVL
Sbjct  175  GVGTPPKYVYMVL  187



>ref|XP_008437888.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=474

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  249  NATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFTRL  425
            N TP+ LF  RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFTR+
Sbjct  77   NRTPEELFHLRLQRDAIRVKKLSSLGATSRNLSRPSGTTGFSSSVISGLAQGSGEYFTRI  136

Query  426  GVGTPPKYAFMVL  464
            GVGTPPKY +MVL
Sbjct  137  GVGTPPKYVYMVL  149



>ref|XP_004133810.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=471

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  249  NATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFTRL  425
            N TP+ LF  RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFTR+
Sbjct  74   NRTPEELFHLRLQRDAIRVKKLSSLGATSRNLSKPGGTTGFSSSVISGLAQGSGEYFTRI  133

Query  426  GVGTPPKYAFMVL  464
            GVGTPPKY +MVL
Sbjct  134  GVGTPPKYVYMVL  146



>ref|XP_003554768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=472

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 62/88 (70%), Gaps = 3/88 (3%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSV  380
            LSL LHHID +SS   N TP+ LF  RLQRDA R + +  LAA    H    G  FSSS+
Sbjct  62   LSLHLHHIDALSS---NKTPEQLFQLRLQRDAKRVEGVVALAALNQSHARRSGSSFSSSI  118

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            ISGLAQGSGEYFTR+GVGTP +Y +MVL
Sbjct  119  ISGLAQGSGEYFTRIGVGTPARYVYMVL  146



>gb|ABK24467.1| unknown [Picea sitchensis]
Length=497

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 71/114 (62%), Gaps = 16/114 (14%)
 Frame = +3

Query  168  QLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaara---------kalsl  320
            + VQ ++ +N++ L + H D +SS++  +  K +  +RL+RDAAR           A+ +
Sbjct  58   ETVQGEE-KNSIVLQVVHRDSLSSSSNTSLVKEILQERLKRDAARVDSINARVQLAAMGV  116

Query  321  laaaaPPHNATR------GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              A   P N +        +DFSSS+ISGLAQGSGEYFTRLGVGTPP+Y +MVL
Sbjct  117  SKAEMKPLNGSSIDARFDAKDFSSSIISGLAQGSGEYFTRLGVGTPPRYTYMVL  170



>ref|XP_010480432.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=488

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 65/91 (71%), Gaps = 6/91 (7%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  371
            ++L+L HID +SS   N TP+ LF  RLQRD+ R  +++ LAA  P  N T   R   FS
Sbjct  75   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVNSIATLAARVPRRNVTHAPRSGGFS  131

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVL
Sbjct  132  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVL  162



>ref|XP_010918360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=507

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 60/94 (64%), Gaps = 8/94 (9%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakal----sllaaaaPPHNATRGR--  362
            L + L H+D  S  A N+TP+ L   RL RD AR   L    +   AA     A RGR  
Sbjct  78   LRVRLAHLD--SLLAANSTPEHLLSLRLGRDVARVSNLHEILAAAMAAGNATRAIRGRRR  135

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             FSSSV+SGLAQGSGEYFTR+G+GTP +YA+MVL
Sbjct  136  GFSSSVVSGLAQGSGEYFTRIGIGTPARYAYMVL  169



>ref|XP_004306664.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Fragaria 
vesca subsp. vesca]
Length=467

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 64/99 (65%), Gaps = 11/99 (11%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            +PD   ++LSL LHH+D +SS   + TP  LF  RL+RD+ R  +L+ LA     +N TR
Sbjct  51   EPDSDPSSLSLPLHHLDALSS---DQTPSQLFHLRLRRDSLRFNSLTSLA-----YNRTR  102

Query  357  GRDFSSSVIS---GLAQGSGEYFTRLGVGTPPKYAFMVL  464
                S    S   GL+QGSGEYFTR+GVG+PPKY +MVL
Sbjct  103  PGPSSGFSSSIVSGLSQGSGEYFTRIGVGSPPKYLYMVL  141



>gb|AAK64003.1| AT3g61820/F15G16_210 [Arabidopsis thaliana]
Length=362

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 6/89 (7%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSS  377
            L H+D +SS + +A+P  LF  RLQRD+ R K+++ LAA +   NAT+        FS +
Sbjct  65   LSHVDALSSFS-DASPADLFNLRLQRDSLRVKSITSLAAVSTGRNATKRTPRTAGGFSGA  123

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            VISGL+QGSGEYF RLGVGTP    +MVL
Sbjct  124  VISGLSQGSGEYFMRLGVGTPATNVYMVL  152



>ref|XP_003529886.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 71/101 (70%), Gaps = 11/101 (11%)
 Frame = +3

Query  174  VQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  353
            V+PD  E T SL LHHID +S    N TP  LF  RL+RDAAR K L+ LAAA    N T
Sbjct  54   VEPD-PEPTTSLSLHHIDALS---FNKTPSQLFHLRLERDAARVKTLTHLAAAT---NKT  106

Query  354  RGRD----FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            R  +    FSSSV+SGL+QGSGEYFTRLGVGTPPKY +MVL
Sbjct  107  RPANPGSGFSSSVVSGLSQGSGEYFTRLGVGTPPKYLYMVL  147



>emb|CDY25081.1| BnaC06g18230D [Brassica napus]
Length=485

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 65/98 (66%), Gaps = 6/98 (6%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-  362
            DS  +L++ L H+D +SS + +A+P  LF  RL+RD+ R K+L+ LAA +   N T+   
Sbjct  57   DSITSLTVHLSHVDALSSFS-DASPLELFNLRLRRDSLRVKSLTTLAAVSTGKNVTKRTP  115

Query  363  ----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                 FS +VISGL+QGSGEYF RLGVGTP    +MVL
Sbjct  116  RSPGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYMVL  153



>ref|NP_191741.1| aspartyl protease [Arabidopsis thaliana]
 emb|CAB71112.1| putative protein [Arabidopsis thaliana]
 gb|AEE80260.1| aspartyl protease [Arabidopsis thaliana]
Length=483

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 6/89 (7%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSS  377
            L H+D +SS + +A+P  LF  RLQRD+ R K+++ LAA +   NAT+        FS +
Sbjct  65   LSHVDALSSFS-DASPADLFNLRLQRDSLRVKSITSLAAVSTGRNATKRTPRTAGGFSGA  123

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            VISGL+QGSGEYF RLGVGTP    +MVL
Sbjct  124  VISGLSQGSGEYFMRLGVGTPATNVYMVL  152



>ref|XP_008799615.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=504

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 52/79 (66%), Gaps = 7/79 (9%)
 Frame = +3

Query  243  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG-----RDFSSSVISGLAQGSG  407
            A N+TP+ L   RL RDA R   L  +  A    NAT       R FSSSV+SGLAQGSG
Sbjct  90   AANSTPEHLLGLRLGRDATRVSHLHEILGA--EGNATHAVRAGRRGFSSSVVSGLAQGSG  147

Query  408  EYFTRLGVGTPPKYAFMVL  464
            EYFTR+G+GTP +YA+MVL
Sbjct  148  EYFTRIGIGTPARYAYMVL  166



>ref|XP_007051537.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOX95694.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=488

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 64/99 (65%), Gaps = 9/99 (9%)
 Frame = +3

Query  186  DSENTLS--LDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----lsllaaaaPPHN  347
            +S  TL   L+LHH+D  SS  +   P+ LF  RLQRD  RA+     ++   A  PP  
Sbjct  68   NSNTTLEVQLELHHVDAFSSEEI---PERLFDLRLQRDELRAETINSLVAKAVARNPPRA  124

Query  348  ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              R   FSSS+ISGLAQGSGEYFTRLGVGTPP+Y +MVL
Sbjct  125  PGRRSGFSSSIISGLAQGSGEYFTRLGVGTPPRYLYMVL  163



>ref|XP_007051536.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX95693.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=557

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 64/99 (65%), Gaps = 9/99 (9%)
 Frame = +3

Query  186  DSENTLS--LDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----lsllaaaaPPHN  347
            +S  TL   L+LHH+D  SS  +   P+ LF  RLQRD  RA+     ++   A  PP  
Sbjct  68   NSNTTLEVQLELHHVDAFSSEEI---PERLFDLRLQRDELRAETINSLVAKAVARNPPRA  124

Query  348  ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              R   FSSS+ISGLAQGSGEYFTRLGVGTPP+Y +MVL
Sbjct  125  PGRRSGFSSSIISGLAQGSGEYFTRLGVGTPPRYLYMVL  163



>ref|XP_010544842.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Tarenaya 
hassleriana]
Length=510

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 5/96 (5%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa---arakalsllaaaaPPHNATR  356
            ++  +LS  L H+D +S +  + +P+ LF  RL+RD+       + +  +     H    
Sbjct  93   ETATSLSAQLLHVDALSPS--DTSPEHLFDLRLRRDSLRVETLTSFAAASVRNVTHAPRA  150

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
               FS +V+SGL+QGSGEYFTRLGVGTP  YA+MVL
Sbjct  151  AGGFSGAVVSGLSQGSGEYFTRLGVGTPATYAYMVL  186



>gb|KJB41527.1| hypothetical protein B456_007G108800, partial [Gossypium raimondii]
Length=460

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 57/91 (63%), Gaps = 6/91 (7%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHN---ATRGRDFS  371
            + L+LHH+D  SS     T + LF   LQRD  RA+ +  L + A   N   AT    FS
Sbjct  68   MHLELHHLDAFSS---EETLERLFDLCLQRDMLRAETIYSLVSKAIACNRPRATGYLGFS  124

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            SS+I GLAQGSGEYFTRLGV T P+Y +MVL
Sbjct  125  SSIIFGLAQGSGEYFTRLGVSTLPRYLYMVL  155



>ref|XP_009394177.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=499

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 56/87 (64%), Gaps = 5/87 (6%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa---PPHNATRGRDFSSSVI  383
            L H D  S  A     + +F+ RL RDAAR + LS + A A   P  N T  R FSS V+
Sbjct  80   LSHRD--SLLADTTAAEQIFLLRLDRDAARVETLSQILAVATAPPAANVTSRRGFSSKVV  137

Query  384  SGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            SGLAQGSGEYF R+G+GTP +YA+MVL
Sbjct  138  SGLAQGSGEYFARIGIGTPARYAYMVL  164



>gb|KJB09628.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=446

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 65/103 (63%), Gaps = 9/103 (9%)
 Frame = +3

Query  174  VQPDDSENTLS--LDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----lsllaaaa  335
            + P  S  TL   L+LHH+D +SS     TP+ LF  RLQRDA R+      +S   A  
Sbjct  64   LDPLSSNTTLEVQLELHHVDALSS---EDTPELLFDLRLQRDALRSGTIYSLVSKAVARN  120

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            PP  A R   FSSS+ISGLAQGSGEYFTRLGVGTP +  +MVL
Sbjct  121  PPRAAGRRSGFSSSIISGLAQGSGEYFTRLGVGTPARNLYMVL  163



>gb|KJB09626.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=488

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 65/103 (63%), Gaps = 9/103 (9%)
 Frame = +3

Query  174  VQPDDSENTLS--LDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----lsllaaaa  335
            + P  S  TL   L+LHH+D +SS     TP+ LF  RLQRDA R+      +S   A  
Sbjct  64   LDPLSSNTTLEVQLELHHVDALSS---EDTPELLFDLRLQRDALRSGTIYSLVSKAVARN  120

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            PP  A R   FSSS+ISGLAQGSGEYFTRLGVGTP +  +MVL
Sbjct  121  PPRAAGRRSGFSSSIISGLAQGSGEYFTRLGVGTPARNLYMVL  163



>ref|XP_004171805.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Cucumis sativus]
Length=384

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            FSSSVISGLAQGSGEYFTR+GVGTPPKY +MVL
Sbjct  27   FSSSVISGLAQGSGEYFTRIGVGTPPKYVYMVL  59



>ref|XP_009104352.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=485

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 6/89 (7%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-----DFSSS  377
            L H+D +SS + +A+P  LF  RL+RD+ R K+L+ LAA +   N T+        FS +
Sbjct  66   LSHVDALSSFS-DASPSELFNLRLRRDSLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGA  124

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            VISGL+QGSGEYF RLGVGTP    +MVL
Sbjct  125  VISGLSQGSGEYFMRLGVGTPATNVYMVL  153



>emb|CDX67868.1| BnaA07g19080D [Brassica napus]
Length=485

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 6/89 (7%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-----DFSSS  377
            L H+D +SS + +A+P  LF  RL+RD+ R K+L+ LAA +   N T+        FS +
Sbjct  66   LSHVDALSSFS-DASPLELFNLRLRRDSLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGA  124

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            VISGL+QGSGEYF RLGVGTP    +MVL
Sbjct  125  VISGLSQGSGEYFMRLGVGTPATNVYMVL  153



>ref|XP_010924503.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=508

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHN------ATR  356
            ++  + L H D  S  A N TP+ L   RL RDAAR   L  + AAA            R
Sbjct  77   SSFHVSLAHRD--SLLAANTTPEHLLRLRLGRDAARVANLHKILAAATAAGNATHAVGAR  134

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             R FS+SV+SGL+QGSGEYFTR+G+GTP +Y  MVL
Sbjct  135  PRGFSASVVSGLSQGSGEYFTRIGIGTPARYLNMVL  170



>ref|XP_004969076.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=493

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = +3

Query  243  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT-RGRDFSSSVISGLAQGSGEYFT  419
            AVNAT   L   RL+RD  RA  +S  AA     N T RG   ++ V+SGLA+GSGEYFT
Sbjct  77   AVNATAAELLKHRLRRDKRRAARISKEAAGGAAANGTSRGGGVAAPVVSGLAEGSGEYFT  136

Query  420  RLGVGTPPKYAFMVL  464
            ++GVGTP   A MVL
Sbjct  137  KIGVGTPATPALMVL  151



>ref|NP_001043485.1| Os01g0598600 [Oryza sativa Japonica Group]
 dbj|BAB63755.1| nucleoid DNA-binding protein cnd41-like [Oryza sativa Japonica 
Group]
 dbj|BAF05399.1| Os01g0598600 [Oryza sativa Japonica Group]
 gb|EAY74816.1| hypothetical protein OsI_02707 [Oryza sativa Indica Group]
Length=500

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 56/98 (57%), Gaps = 9/98 (9%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR----  356
            + +T+ L + H D     AVNAT   L   RL+RD  RA  +S  A  A   N TR    
Sbjct  70   AASTVGLRVVHRDDF---AVNATAAELLAHRLRRDKRRASRISAAAGGAAAANGTRVGGG  126

Query  357  --GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              G  F + V+SGLAQGSGEYFT++GVGTP   A MVL
Sbjct  127  GGGSGFVAPVVSGLAQGSGEYFTKIGVGTPVTPALMVL  164



>gb|EAZ12575.1| hypothetical protein OsJ_02481 [Oryza sativa Japonica Group]
Length=501

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 56/98 (57%), Gaps = 9/98 (9%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR----  356
            + +T+ L + H D     AVNAT   L   RL+RD  RA  +S  A  A   N TR    
Sbjct  70   AASTVGLRVVHRDDF---AVNATAAELLAHRLRRDKRRASRISAAAGGAAAANGTRVGGG  126

Query  357  --GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              G  F + V+SGLAQGSGEYFT++GVGTP   A MVL
Sbjct  127  GGGSGFVAPVVSGLAQGSGEYFTKIGVGTPVTPALMVL  164



>emb|CDX92240.1| BnaA05g21670D [Brassica napus]
Length=491

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 5/97 (5%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-  362
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R  A+      A     +  R 
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAAIIAKVNLAVEGADSETRY  133

Query  363  ---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
               + ++ VISG +QGSGEYF+RLGVGTP K  +MVL
Sbjct  134  QPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVL  170



>ref|XP_009145889.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=492

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 59/97 (61%), Gaps = 5/97 (5%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-  362
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R  ++      A     +  R 
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVASIIAKVNLAVEGADSETRY  133

Query  363  ---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
               + ++ VISG +QGSGEYF+RLGVGTP K  +MVL
Sbjct  134  NPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVL  170



>ref|XP_006402438.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
 dbj|BAJ34045.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43891.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
Length=484

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 47/74 (64%), Gaps = 5/74 (7%)
 Frame = +3

Query  258  PKALFVKRLQRDaarakalsllaaaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTR  422
            P  LF  RLQRD+ R ++L+ LAA +   N T+        FS  VISGL+QGSGEYF R
Sbjct  80   PAELFNLRLQRDSLRVESLTSLAAVSAGRNVTKRPPRSAGGFSGVVISGLSQGSGEYFMR  139

Query  423  LGVGTPPKYAFMVL  464
            LGVGTP    +MVL
Sbjct  140  LGVGTPATNMYMVL  153



>ref|XP_007209939.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
 gb|EMJ11138.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
Length=494

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P H   R  D S+ V+SG++QGSGEYFTR+GVGTP K  +MVL
Sbjct  133  PMHTEIRPEDLSTPVVSGVSQGSGEYFTRIGVGTPAKSLYMVL  175



>ref|XP_008244017.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=494

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P H   R  D S+ V+SG++QGSGEYFTR+GVGTP K  +MVL
Sbjct  133  PMHTEIRPEDLSTPVVSGVSQGSGEYFTRIGVGTPAKSLYMVL  175



>gb|KJB77420.1| hypothetical protein B456_012G135900 [Gossypium raimondii]
Length=484

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 59/106 (56%), Gaps = 7/106 (7%)
 Frame = +3

Query  168  QLVQPDDSENTLS--LDLHHIDLISS--AAVNATPKALFVKRLQRDaarakalsllaaaa  335
            +L+   +SE+     L L H D +S+  A V+      F  R+QRD  R  +L L     
Sbjct  57   ELLNVTESEDQWKWKLKLIHRDWLSTENATVSRNHSRRFHARIQRDVKRVASLLLRIPGG  116

Query  336  PPHN--ATRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              H+  A  G  DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  117  VIHDGEAAHGVNDFGSDVVSGMDQGSGEYFVRIGVGSPPRSQYMVI  162



>ref|XP_003569303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brachypodium 
distachyon]
Length=494

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 50/86 (58%), Gaps = 9/86 (10%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR--GRDFSSSVIS  386
            +H  D +    VNAT   L   RLQRD  RA  +S  A A    N TR  G    + V+S
Sbjct  81   VHRDDFV----VNATAAELLGHRLQRDGKRAARISAAAGA---ANGTRRTGSGVVAPVVS  133

Query  387  GLAQGSGEYFTRLGVGTPPKYAFMVL  464
            GLAQGSGEYFT++GVGTP   A MVL
Sbjct  134  GLAQGSGEYFTKIGVGTPATPALMVL  159



>emb|CDY24483.1| BnaC05g34710D [Brassica napus]
Length=491

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 58/102 (57%), Gaps = 15/102 (15%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD  365
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R  ++           A  G D
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKNYKSLVLSRLERDSSRVASIIAKVKL-----AVEGAD  128

Query  366  ---------FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                      ++ VISG +QGSGEYF+RLGVGTP K  +MVL
Sbjct  129  SETHYQPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVL  170



>ref|XP_002306246.2| hypothetical protein POPTR_0005s06390g [Populus trichocarpa]
 gb|EEE93242.2| hypothetical protein POPTR_0005s06390g [Populus trichocarpa]
Length=502

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 54/98 (55%), Gaps = 5/98 (5%)
 Frame = +3

Query  180  PDDS--ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  353
            P+DS  E    L L H D +S          +F  R+QRD  R  +L    ++     A+
Sbjct  85   PNDSGSEGKQKLKLVHRDKVSFNNKFHNHSHVFHARMQRDVKRVVSLIRRVSSGS--TAS  142

Query  354  RG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             G  DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  143  YGVEDFGSEVVSGMDQGSGEYFVRIGVGSPPRSQYMVI  180



>gb|KJB79793.1| hypothetical protein B456_013G067200 [Gossypium raimondii]
Length=475

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 53/105 (50%), Gaps = 7/105 (7%)
 Frame = +3

Query  171  LVQPDDSENTLSLDLHHIDLI----SSAAVNATPKALFVKRLQRDaarakalsllaaaaP  338
            L + DD     +L L H D +     S +        F  R+QRD  R  +L        
Sbjct  48   LSETDDHRGKWNLKLVHRDKLLSPNDSLSTLHNHGRRFHARMQRDVKRVASLLRRLPGKG  107

Query  339  PHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             H+   A +  DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  108  THDGDAAYQVNDFGSDVVSGMDQGSGEYFVRIGVGSPPRSQYMVI  152



>ref|XP_010279486.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=483

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 35/95 (37%), Positives = 54/95 (57%), Gaps = 2/95 (2%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG-  359
            D++E    L L H D+IS     +  +    +R++RD  R  +L+   +         G 
Sbjct  63   DEAEGRWKLKLVHRDMISLGNF-SNHRHHLSERIKRDVRRVASLTRRLSGGGGGGVNYGV  121

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             DF+S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  122  EDFASEVVSGVDQGSGEYFVRIGVGSPPRNQYMVI  156



>ref|XP_006852628.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
 gb|ERN14095.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
Length=489

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 68/131 (52%), Gaps = 32/131 (24%)
 Frame = +3

Query  159  ILKQLVQPDDSENTLS------LDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsl  320
            +L + ++ +++E  LS      L LHH D +S   +N T + LF  RL+RD AR K+L+ 
Sbjct  38   LLDEDLKQEETEGDLSDQTSLFLTLHHRDSLS---LNLTAEELFKLRLERDDARVKSLTN  94

Query  321  laaaaPP---------HNAT--------------RGRDFSSSVISGLAQGSGEYFTRLGV  431
                A           H A               RG+ F++ V+SGL QGSGEYF R+ V
Sbjct  95   WVNLAAALGSSHRGHHHGAANPAAHANGSVQTRGRGQAFTAPVVSGLPQGSGEYFARVKV  154

Query  432  GTPPKYAFMVL  464
            GTPP+  +MVL
Sbjct  155  GTPPQPMYMVL  165



>ref|XP_003637421.1| Aspartic proteinase nepenthesin-1, partial [Medicago truncatula]
Length=280

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 10/93 (11%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD-  365
            S +TLSL LH    +SS   +A  K+L + RL RD+AR K ++         N     D 
Sbjct  66   STSTLSLQLHSRASLSS---HADYKSLTLSRLDRDSARVKYITTKL------NQNFNTDK  116

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             S  +ISG +QGSGEYF+R+G+G PP  A+MVL
Sbjct  117  LSGPIISGTSQGSGEYFSRIGIGEPPSQAYMVL  149



>ref|XP_009337317.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVL
Sbjct  126  PMHTEVQSQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVL  168



>ref|XP_009112699.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
 emb|CDY18523.1| BnaA01g26720D [Brassica napus]
Length=499

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 62/106 (58%), Gaps = 14/106 (13%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  74   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGITAKIRFAVEGIDRSDLK  132

Query  336  PPHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P +N   + +  D ++ V+SG +QGSGEYF+R+GVGTP K  FMVL
Sbjct  133  PVYNDETSYQPEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMFMVL  178



>gb|KEH44446.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=486

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = +3

Query  207  LDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVIS  386
            L L H D IS+  ++    + F  R++RD+ R  A+    A    +      +F S V+S
Sbjct  82   LKLLHRDKISAFNISGDHLSRFNARMERDSKRVTAVVRQIAGGVGYET---EEFGSGVVS  138

Query  387  GLAQGSGEYFTRLGVGTPPKYAFMVL  464
            G+ QGSGEYF R+GVG+PPK  ++V+
Sbjct  139  GMEQGSGEYFVRIGVGSPPKNQYVVV  164



>ref|XP_009337150.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVL
Sbjct  126  PMHTEIQSQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVL  168



>ref|XP_007142740.1| hypothetical protein PHAVU_007G013000g [Phaseolus vulgaris]
 gb|ESW14734.1| hypothetical protein PHAVU_007G013000g [Phaseolus vulgaris]
Length=475

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 49/94 (52%), Gaps = 2/94 (2%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            D S     L L H D +S+       +  F  R++RDA R   L    AA  P       
Sbjct  62   DSSSTKWKLKLLHRDKVSTFNTTLDHQTRFNARIERDARRVAVLLRRLAAGKP--TLDSE  119

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             F S V+SG+ QGSGEYF R+GVG+PP+  ++V+
Sbjct  120  AFGSDVVSGMEQGSGEYFVRIGVGSPPRNQYVVI  153



>ref|XP_006406427.1| hypothetical protein EUTSA_v10020671mg [Eutrema salsugineum]
 gb|ESQ47880.1| hypothetical protein EUTSA_v10020671mg [Eutrema salsugineum]
Length=468

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = +3

Query  180  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT-R  356
            PD+S+ TL L LH     S +  N   +     R   D   A    +   + PP N+   
Sbjct  52   PDESKYTLRL-LHRDKFPSVSYRNHHHRLHARMRRDSDRVAAILRRISGKSVPPSNSKYE  110

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  111  VDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVI  146



>ref|XP_010533981.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=502

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 60/105 (57%), Gaps = 14/105 (13%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa----------P  338
            + ++ SL+LH  + +  +  +   ++L + RL+RD+AR   ++     A          P
Sbjct  79   NSSSFSLELHSRETLVESQ-HKDYRSLLLGRLERDSARVSGITAKVRLAIEGVERSKLHP  137

Query  339  PHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             H+     R  D S+ V+SG +QGSGEYF+R+GVGTPPK  FMVL
Sbjct  138  VHDDDSLIRPEDMSTPVVSGASQGSGEYFSRVGVGTPPKEMFMVL  182



>ref|XP_010541885.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Tarenaya hassleriana]
Length=188

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  109  DFGSDVVSGMDQGSGEYFVRIGVGSPPRNQYMVI  142



>emb|CDY69364.1| BnaCnng63170D [Brassica napus]
Length=501

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 61/106 (58%), Gaps = 14/106 (13%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  76   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGITTKIRFAVEGIDRSDLK  134

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P +N     +  D ++ V+SG +QGSGEYF+R+GVGTP K  FMVL
Sbjct  135  PVYNDETLYQPEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMFMVL  180



>gb|KFK39179.1| hypothetical protein AALP_AA3G210500 [Arabis alpina]
Length=499

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 60/106 (57%), Gaps = 14/106 (13%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  74   NSSSPLSLTLHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGITAKIRFAVEGIDRSDLK  132

Query  336  PPHN-ATR--GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P +N  TR    D ++ V+SG  QGSGEYF+R+GVGTP K  FMVL
Sbjct  133  PVYNDETRYQTEDLTTPVVSGAGQGSGEYFSRIGVGTPAKEMFMVL  178



>tpg|DAA58835.1| TPA: hypothetical protein ZEAMMB73_701358 [Zea mays]
Length=485

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +3

Query  243  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTR  422
            AVNAT   L   RLQRD  RA  +S  A A   +     +  ++ V+SGLAQGSGEYFT+
Sbjct  76   AVNATAGELLKHRLQRDKRRAARISEAAGAGGGNGR---KGVAAPVVSGLAQGSGEYFTK  132

Query  423  LGVGTPPKYAFMVL  464
            +GVGTP   A MVL
Sbjct  133  IGVGTPATQALMVL  146



>gb|KEH44258.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=467

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 10/93 (11%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD-  365
            S +TLSL LH    +SS   +A  K+L + RL RD+AR K ++         N     D 
Sbjct  66   STSTLSLQLHSRASLSS---HADYKSLTLSRLDRDSARVKYITTKL------NQNFNTDK  116

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             S  +ISG +QGSGEYF+R+G+G PP  A+MVL
Sbjct  117  LSGPIISGTSQGSGEYFSRIGIGEPPSQAYMVL  149



>ref|XP_011007544.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=501

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 53/98 (54%), Gaps = 5/98 (5%)
 Frame = +3

Query  180  PDDS--ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  353
            P+DS  E    L L H D +S           F  R+QRD  R  +L    ++     A+
Sbjct  84   PNDSGSEGKQKLKLVHRDKVSFNKKFHNHSHDFHARMQRDVKRVVSLIRRVSSGSA--AS  141

Query  354  RG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             G  DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  142  YGVEDFGSEVVSGMDQGSGEYFVRIGVGSPPRSQYMVI  179



>ref|XP_011031192.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=501

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 53/98 (54%), Gaps = 5/98 (5%)
 Frame = +3

Query  180  PDDS--ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  353
            P+DS  E    L L H D +S           F  R+QRD  R  +L    ++     A+
Sbjct  84   PNDSGSEGKQKLKLVHRDKVSFNKKFHNHSHDFHARMQRDVKRVVSLIRRVSSGSA--AS  141

Query  354  RG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             G  DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  142  YGVEDFGSEVVSGMDQGSGEYFVRIGVGSPPRSQYMVI  179



>ref|XP_010248951.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=475

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S VISG+ QGSGEYF R+GVG+PP+  +MVL
Sbjct  120  DFGSEVISGMEQGSGEYFVRIGVGSPPRNQYMVL  153



>ref|XP_010551158.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=495

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  354  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            R  D S+ V+SG +QGSGEYF+R+GVGTPPK  FMVL
Sbjct  139  RPEDLSTPVVSGASQGSGEYFSRIGVGTPPKDMFMVL  175



>gb|KDO64536.1| hypothetical protein CISIN_1g011045mg [Citrus sinensis]
Length=495

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 57/105 (54%), Gaps = 11/105 (10%)
 Frame = +3

Query  180  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa--------  335
            P +S ++ SL LH  +++     N   ++L + RL+RD+AR   L      A        
Sbjct  73   PLNSSSSFSLPLHSREILHKTRHNDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHE  131

Query  336  --PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              P        DFS+ V+SG +QGSGEYF+R+GVGTPP+   MVL
Sbjct  132  LKPAEAQILPEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVL  176



>ref|XP_006440937.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
 gb|ESR54177.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
Length=495

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 57/105 (54%), Gaps = 11/105 (10%)
 Frame = +3

Query  180  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa--------  335
            P +S ++ SL LH  +++     N   ++L + RL+RD+AR   L      A        
Sbjct  73   PLNSSSSFSLPLHSREILHKTRHNDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHE  131

Query  336  --PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              P        DFS+ V+SG +QGSGEYF+R+GVGTPP+   MVL
Sbjct  132  LKPAEAQILPEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVL  176



>ref|XP_006485768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=495

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 57/105 (54%), Gaps = 11/105 (10%)
 Frame = +3

Query  180  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa--------  335
            P +S ++ SL LH  +++     N   ++L + RL+RD+AR   L      A        
Sbjct  73   PLNSSSSFSLPLHSREILHKTRHNDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHE  131

Query  336  --PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              P        DFS+ V+SG +QGSGEYF+R+GVGTPP+   MVL
Sbjct  132  LKPAEAQILPEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVL  176



>ref|XP_009629151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
tomentosiformis]
Length=491

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 2/96 (2%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            +  + +  L L L H D +  +   +    +F  R++RD  R  +L          N  R
Sbjct  76   ENGEEKRNLKLKLIHRDKLYFSNYFSNHSKMFEARMKRDVKRVSSLIHRITGGG--NGYR  133

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              +F S V+SG+ QGSGEYF R+GVG+P +  +MV+
Sbjct  134  VEEFGSDVVSGMDQGSGEYFVRIGVGSPARNQYMVI  169



>gb|KJB49971.1| hypothetical protein B456_008G147500 [Gossypium raimondii]
Length=480

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 51/104 (49%), Gaps = 5/104 (5%)
 Frame = +3

Query  168  QLVQPDDSENTLSLDLHHIDLISS--AAVNATPKALFVKRLQRDaaraka---lsllaaa  332
            Q+    +++    L L H D +SS  +A        F  R+QRD  R  +          
Sbjct  55   QVSDVSETQGKWKLKLVHRDKLSSNTSATFRDHSRRFHARMQRDVKRVASLLRRLSGGGG  114

Query  333  aPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                 A    DF S V+SG+ QGSGEYF R+GVG+PPK  +MV+
Sbjct  115  HDGGAAYEVNDFGSDVVSGMDQGSGEYFVRIGVGSPPKSQYMVI  158



>gb|KDO69941.1| hypothetical protein CISIN_1g011042mg [Citrus sinensis]
Length=495

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 54/99 (55%), Gaps = 9/99 (9%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATP-------KALFVKRLQRDaarakalsllaaaaPPHNA  350
            E   +L+L H D +SS++ N T        +  F  R+QRD  R   L    +      A
Sbjct  76   EARWNLELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAA  134

Query  351  TRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  135  KHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVI  173



>ref|XP_006437655.1| hypothetical protein CICLE_v10031332mg [Citrus clementina]
 gb|ESR50895.1| hypothetical protein CICLE_v10031332mg [Citrus clementina]
Length=495

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (54%), Gaps = 9/99 (9%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATP-------KALFVKRLQRDaarakalsllaaaaPPHNA  350
            E    L+L H D +SS++ N T        +  F  R+QRD  R   L    +      A
Sbjct  76   EARWKLELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAA  134

Query  351  TRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  135  KHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVI  173



>ref|XP_006484478.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
Length=495

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (54%), Gaps = 9/99 (9%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATP-------KALFVKRLQRDaarakalsllaaaaPPHNA  350
            E    L+L H D +SS++ N T        +  F  R+QRD  R   L    +      A
Sbjct  76   EARWKLELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAA  134

Query  351  TRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  135  KHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVI  173



>ref|XP_003555824.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query  207  LDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVIS  386
            L L H D + +   +   +  F  R+QRD  R  AL    AA  P  A     F S V+S
Sbjct  68   LKLVHRDKVPTFNTSHDHRTRFNARMQRDTKRVAALRRHLAAGKPTYAEEA--FGSDVVS  125

Query  387  GLAQGSGEYFTRLGVGTPPKYAFMVL  464
            G+ QGSGEYF R+GVG+PP+  ++V+
Sbjct  126  GMEQGSGEYFVRIGVGSPPRNQYVVI  151



>ref|XP_003536757.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=475

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query  207  LDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVIS  386
            L L H D + +       +  F  R+QRD  RA +L    AA  P  A     F S V+S
Sbjct  70   LKLVHRDKVPTFNTYHDHRTRFNARMQRDTKRAASLLRRLAAGKPTYAAEA--FGSDVVS  127

Query  387  GLAQGSGEYFTRLGVGTPPKYAFMVL  464
            G+ QGSGEYF R+GVG+PP+  ++V+
Sbjct  128  GMEQGSGEYFVRIGVGSPPRNQYVVM  153



>ref|XP_004147103.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 ref|XP_004166359.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 gb|KGN51568.1| hypothetical protein Csa_5G579060 [Cucumis sativus]
Length=482

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 55/104 (53%), Gaps = 7/104 (7%)
 Frame = +3

Query  165  KQLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPH  344
            +Q+       NT  L+L H D +S   V+   +  F  R++RDA R   L    +   P 
Sbjct  60   RQVSGYKSDNNTFKLNLLHRDKLSH--VHGHRRG-FNDRMKRDAIRVATLVRRLSHGAPA  116

Query  345  NATRGR----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                 R    +F++ VISG+  GSGEYF R+GVG+PP+  +MV+
Sbjct  117  AVKDSRYKVANFATDVISGMEAGSGEYFVRIGVGSPPRNQYMVI  160



>ref|XP_008351878.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 62/109 (57%), Gaps = 12/109 (11%)
 Frame = +3

Query  168  QLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa----  335
            Q  QP +S +  SL LH  D + ++  +   K+L + RL RD+AR  +L      A    
Sbjct  62   QESQPLNS-SAFSLQLHPRDXLFNSQ-HKDYKSLTLTRLGRDSARVNSLHTKLQLALQGI  119

Query  336  ------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                  P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVL
Sbjct  120  KRGDLEPMHAEIQPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVL  168



>ref|XP_008367576.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVL
Sbjct  126  PMHAEIQPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVL  168



>ref|XP_010466176.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Camelina 
sativa]
Length=470

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 52/98 (53%), Gaps = 5/98 (5%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            DDS +  +L L H D   S         L   R++RD  R  AL    +     +++  R
Sbjct  52   DDSTSKYTLRLLHRDRFPSVTYRNHHHRLHA-RMRRDTDRVAALLRRISGKAVSSSSDAR  110

Query  363  ----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  111  YEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVI  148



>ref|XP_004497254.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=486

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 54/99 (55%), Gaps = 9/99 (9%)
 Frame = +3

Query  186  DSENTLS------LDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHN  347
            +SE T S      L L H D I    ++   ++ F  R++RDA R  A+    A    + 
Sbjct  69   ESEKTESGSGKRKLKLLHRDEIHIFNISRDHRSRFNARMKRDAKRVAAVVRRIAGGVGYK  128

Query  348  ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                 +F S V+SG+ QGSGEYF R+GVG+PPK  ++V+
Sbjct  129  T---EEFGSDVVSGMEQGSGEYFVRIGVGSPPKNQYVVI  164



>ref|XP_010487964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=470

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 53/98 (54%), Gaps = 5/98 (5%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            DDS +  +L L H D   S +       L   R++RD  R  AL    +     +++  R
Sbjct  52   DDSNSKHTLRLLHRDRFPSVSYRNHHHRLHA-RMRRDTDRVAALLRRISGKTVSSSSDAR  110

Query  363  ----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  111  YEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVI  148



>ref|XP_011022942.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=502

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 18/106 (17%)
 Frame = +3

Query  177  QPDDSENT---LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHN  347
             P+DSE+T     L L H D +S +        +F  R+ RD  R  +L         H 
Sbjct  83   NPNDSESTGGKQKLKLVHRDKVSFSNQLHNHSHVFNARMHRDVKRVASLI--------HR  134

Query  348  ATRG-------RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             + G        +F S V+SG+ QGSGEYF R+G+G+PP+  +MV+
Sbjct  135  LSSGSAAKYEVENFGSDVVSGMNQGSGEYFVRIGLGSPPRSQYMVI  180



>ref|XP_002309912.2| hypothetical protein POPTR_0007s04120g [Populus trichocarpa]
 gb|EEE90362.2| hypothetical protein POPTR_0007s04120g [Populus trichocarpa]
Length=501

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 17/105 (16%)
 Frame = +3

Query  177  QPDDSEN--TLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNA  350
             P+DSE+     L L H D +S +        +F  R+ RD  R  +L         H  
Sbjct  83   NPNDSESGGKQKLKLVHRDKVSFSNKLHNHSHVFHARMHRDVKRVASLI--------HRL  134

Query  351  TRG-------RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            + G        DF S V+SG+ QGSGEYF R+G+G+PP+  +MV+
Sbjct  135  SSGSAAKYEVEDFGSDVVSGMNQGSGEYFVRIGLGSPPRSQYMVI  179



>gb|ABK25248.1| unknown [Picea sitchensis]
Length=366

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF   V+SG+ QGSGEYFTR+GVGTP +  +MVL
Sbjct  141  DFGGEVVSGMEQGSGEYFTRIGVGTPTREQYMVL  174



>ref|XP_010506935.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Camelina 
sativa]
Length=501

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 62/106 (58%), Gaps = 14/106 (13%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D+   A+ +   K+L + RL+RD++R   ++            +   
Sbjct  76   NSSSPLSLELHSRDIFV-ASQHKDYKSLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLK  134

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P +N     + ++ ++ V+SG +QGSGEYF+R+GVGTP K  ++VL
Sbjct  135  PVYNEDTRYQTQELTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVL  180



>ref|XP_008802841.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Phoenix 
dactylifera]
Length=470

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S V+SGL +GSGEYF R+GVG+PPK  FMV+
Sbjct  110  DFGSDVVSGLDEGSGEYFVRIGVGSPPKEQFMVI  143



>ref|XP_010908909.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=448

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 2/90 (2%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSS  374
            N  +L+L H D ISS    ++    F + + RDA R   L+   AA+    A    DF S
Sbjct  37   NKWALNLVHRDTISSRNY-SSHHHRFQELMNRDARRVAGLTRRLAASTGL-AYSSEDFGS  94

Query  375  SVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             V+SGL +GSGEYF R+GVG+PP+  +MV+
Sbjct  95   EVVSGLEEGSGEYFVRVGVGSPPREQYMVI  124



>ref|XP_008791252.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=469

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            +DF S V+SGL +GSGEYF R+GVG+PP+  +MV+
Sbjct  111  QDFGSEVVSGLEEGSGEYFVRVGVGSPPREQYMVI  145



>ref|XP_004236867.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=479

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  354  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            R ++F S +ISG+ QGSGEYF R+GVG+PPK  +MVL
Sbjct  121  RVKEFGSDLISGMDQGSGEYFVRVGVGSPPKNQYMVL  157



>ref|XP_006298983.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
 gb|EOA31881.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
Length=501

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 62/106 (58%), Gaps = 14/106 (13%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D+   A+ +   K+L + RL+RD++R   ++            +   
Sbjct  76   NSSSPLSLELHSRDIFV-ASQHKDYKSLVLSRLERDSSRVNGIAAKVRFAVEGIDRSDLK  134

Query  336  PPHNA-TRGR--DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P  N  TR +  D ++ V+SG +QGSGEYF+R+GVGTP K  ++VL
Sbjct  135  PVSNEDTRYQPEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVL  180



>ref|XP_010508355.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=471

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 51/98 (52%), Gaps = 5/98 (5%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            DDS +  +L L H D   S         L   R++RD  R  AL          +++  R
Sbjct  53   DDSTSKHTLRLLHRDRFPSVTYRNHHHRLHA-RMRRDTDRVAALLRRICGKAVSSSSDAR  111

Query  363  ----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  112  YEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVI  149



>gb|ABR17085.1| unknown [Picea sitchensis]
Length=498

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF   V+SG+ QGSGEYFTR+GVGTP +  +MVL
Sbjct  141  DFGGEVVSGMEQGSGEYFTRIGVGTPTREQYMVL  174



>ref|XP_003520873.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=461

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 54/81 (67%), Gaps = 7/81 (9%)
 Frame = +3

Query  222  IDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQG  401
            ID +SS   N TP+ LF  RLQRDA R +AL     A     ++     SSS+ISGLAQG
Sbjct  62   IDALSS---NKTPEQLFHLRLQRDAKRVEALLNQIHARRSAGSSF----SSSIISGLAQG  114

Query  402  SGEYFTRLGVGTPPKYAFMVL  464
            SGEYFTR+GVGTP +Y +MVL
Sbjct  115  SGEYFTRIGVGTPARYVYMVL  135



>ref|XP_009351765.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Pyrus x 
bretschneideri]
Length=548

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 9/94 (10%)
 Frame = +3

Query  207  LDLHHIDLISSAAVNATPKA--------LFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            L + H D +SS   N             LF  R++RDA R  +L+        ++     
Sbjct  121  LKVVHRDKMSSQYSNRNGNGGSHTSHSHLFRARMKRDAKRVASLTRRLLN-DSNSELESL  179

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  180  DFGSGVVSGMEQGSGEYFVRIGVGSPPRNQYMVI  213



>ref|XP_008359997.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 2-like [Malus domestica]
Length=539

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  171  DFGSGVVSGMEQGSGEYFVRIGVGSPPRSQYMVI  204



>ref|XP_002440367.1| hypothetical protein SORBIDRAFT_09g030430 [Sorghum bicolor]
 gb|EES18797.1| hypothetical protein SORBIDRAFT_09g030430 [Sorghum bicolor]
Length=462

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 6/67 (9%)
 Frame = +3

Query  267  LFVKRLQRDaarakalsllaaaaPPHNATR-GRDFSSSVISGLAQGSGEYFTRLGVGTPP  443
            L   RL RDAARA+A+S+ A      N TR G  FS+ V+SGLAQGSGEYF  +GVGTPP
Sbjct  98   LLAHRLARDAARAEAISVSA-----RNVTRAGGGFSAPVVSGLAQGSGEYFASVGVGTPP  152

Query  444  KYAFMVL  464
              A +VL
Sbjct  153  TPALLVL  159



>ref|XP_008340423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Malus domestica]
Length=547

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  179  DFGSGVVSGMEQGSGEYFVRIGVGSPPRNQYMVI  212



>ref|NP_188478.1| protein ASPARTIC PROTEASE IN GUARD CELL 1 [Arabidopsis thaliana]
 sp|Q9LS40.1|ASPG1_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 1; Short=AtASPG1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01116.1| CND41, chloroplast nucleoid DNA binding protein-like [Arabidopsis 
thaliana]
 gb|AAN13013.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
 gb|AEE76104.1| protein aspartic protease in guard cell 1 [Arabidopsis thaliana]
Length=500

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 59/106 (56%), Gaps = 14/106 (13%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D    A+ +   K+L + RL+RD++R   +             +   
Sbjct  75   NSSSPLSLELHSRDTFV-ASQHKDYKSLTLSRLERDSSRVAGIVAKIRFAVEGVDRSDLK  133

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P +N     +  D ++ V+SG +QGSGEYF+R+GVGTP K  ++VL
Sbjct  134  PVYNEDTRYQTEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVL  179



>ref|XP_007153018.1| hypothetical protein PHAVU_003G000900g [Phaseolus vulgaris]
 gb|ESW25012.1| hypothetical protein PHAVU_003G000900g [Phaseolus vulgaris]
Length=464

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 54/95 (57%), Gaps = 4/95 (4%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAA-VNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG  359
            ++ +    + L H D IS A  +N + +  F +R++RDA R  ++    + A    A   
Sbjct  51   EEKQGNWKVQLLHRDKISKAPPMNHSTR--FNQRMKRDAKRVSSIVNKNSDARTEAAEEA  108

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              F S V+SG+ +GSGEYF R+G+G+P  Y +MV+
Sbjct  109  -SFGSDVVSGMEEGSGEYFVRIGIGSPATYQYMVI  142



>ref|XP_010549135.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=496

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             D S+ V+SG +QGSGEYF+R+G+G PPK  FMVL
Sbjct  142  EDLSTPVVSGASQGSGEYFSRIGIGNPPKEMFMVL  176



>ref|XP_006847790.1| hypothetical protein AMTR_s00029p00016750 [Amborella trichopoda]
 gb|ERN09371.1| hypothetical protein AMTR_s00029p00016750 [Amborella trichopoda]
Length=524

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 53/98 (54%), Gaps = 6/98 (6%)
 Frame = +3

Query  177  QPDDSE--NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNA  350
            QP  S+  N L L L H D       +++ K  F  R++RD  R  AL+        +  
Sbjct  108  QPSASKPGNLLRLKLLHRDSFKPTN-SSSHKHRFESRMRRDLLRVAALAKKLGLESGYKL  166

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            T   DF + V+SG+ QGSGEYF R+GVG+P +  FMV+
Sbjct  167  T---DFGAEVVSGMEQGSGEYFVRIGVGSPARDQFMVI  201



>ref|XP_008374731.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
Length=487

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P H     +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVL
Sbjct  126  PMHAEILPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVL  168



>ref|XP_010465949.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=502

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 63/106 (59%), Gaps = 14/106 (13%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D++  A+ +   K+L + RL+R+++R   ++            +   
Sbjct  77   NSSSPLSLELHSRDILV-ASQHKDYKSLVLSRLERESSRVAGIAAKIQFAVEGIDRSDLK  135

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P +N     + ++ ++ V+SG +QGSGEYF+R+GVGTP K  ++VL
Sbjct  136  PVYNEDTRYQTQELTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVL  181



>gb|ABR16474.1| unknown [Picea sitchensis]
Length=538

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            +F   V+SG+AQGSGEYFTR+GVGTP +  +MVL
Sbjct  181  EFGGEVVSGMAQGSGEYFTRIGVGTPMREQYMVL  214



>gb|ABK24480.1| unknown [Picea sitchensis]
Length=496

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            +F S V+SG+ QGSGEYFTR+G+GTP +  +MVL
Sbjct  138  EFGSEVVSGMEQGSGEYFTRIGIGTPTREQYMVL  171



>gb|KDP40474.1| hypothetical protein JCGZ_24473 [Jatropha curcas]
Length=469

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 3/93 (3%)
 Frame = +3

Query  189  SENTLSLDLHHID-LISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD  365
            S+    L L H D +I+S+        LF  R+ RD  R  +L    ++  P    +  D
Sbjct  57   SQGIWKLKLVHRDRIITSSNSLHNHTHLFHARINRDIKRVASLIRRLSS--PAATYQVND  114

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            F + V+SG+ QGSGEYF R+GVG+PP+  ++V+
Sbjct  115  FGAEVVSGMNQGSGEYFVRIGVGSPPRDQYVVI  147



>emb|CBI35367.3| unnamed protein product [Vitis vinifera]
Length=521

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF + VISG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  185  DFGTDVISGMEQGSGEYFVRIGVGSPPRSQYMVI  218



>ref|XP_010487776.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=501

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 61/106 (58%), Gaps = 14/106 (13%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D+   A+ +   K+L + RL+RD++R   ++            +   
Sbjct  76   NSSSPLSLELHSRDIFV-ASQHKDYKSLVLSRLERDSSRVSGIAAKIRFAVEGIDRSDLK  134

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P  N     + ++ ++ V+SG +QGSGEYF+R+GVGTP K  ++VL
Sbjct  135  PVDNEDTRYQTQELTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVL  180



>gb|AAL87345.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
Length=500

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 59/106 (56%), Gaps = 14/106 (13%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D    A+ +   K+L + RL+RD++R   +             +   
Sbjct  75   NSSSPLSLELHSRDTFV-ASQHKDYKSLTLSRLERDSSRVAGIVAKIRFAVEGVDRSDLK  133

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P +N     +  D ++ V+SG +QGSGEYF+R+GVGTP K  ++VL
Sbjct  134  PVYNEDTRYQTEDLTTPVVSGASQGSGEYFSRIGVGTPAKDMYLVL  179



>ref|XP_010935575.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=467

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             DF S V+SGL +GSGEYF R+G+G+PPK  FMV+
Sbjct  105  EDFGSDVVSGLDEGSGEYFVRIGLGSPPKEQFMVI  139



>ref|XP_006406598.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
 dbj|BAJ33681.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48051.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
Length=502

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 60/106 (57%), Gaps = 14/106 (13%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalslla---------aaaP  338
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  77   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLK  135

Query  339  PHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P +    R    D ++ V+SG +QGSGEYF+R+GVGTP K  ++VL
Sbjct  136  PVDIDETRFQPEDLTTPVVSGTSQGSGEYFSRIGVGTPAKEMYVVL  181



>ref|XP_007043208.1| Aspartic proteinase nepenthesin-1, putative [Theobroma cacao]
 gb|EOX99039.1| Aspartic proteinase nepenthesin-1, putative [Theobroma cacao]
Length=481

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  126  DFGSDVVSGMDQGSGEYFVRIGVGSPPRSQYMVI  159



>ref|XP_002267930.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
Length=479

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF + VISG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  124  DFGTDVISGMEQGSGEYFVRIGVGSPPRSQYMVI  157



>ref|XP_009760593.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=494

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 48/91 (53%), Gaps = 3/91 (3%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFS  371
            +    L L H D +  +   +    +F  R++RD  R  +L         +   R  +F 
Sbjct  85   QKNWKLKLIHRDKLHFSNYFSNHSKMFEARMKRDIKRVSSLIHRITGGGVY---RVEEFG  141

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            S+VISG+ QGSGEYF R+GVG+P +  +MV+
Sbjct  142  SNVISGMDQGSGEYFVRIGVGSPARNQYMVI  172



>emb|CDY25371.1| BnaA05g19130D [Brassica napus]
Length=397

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  111  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVI  144



>emb|CDY24567.1| BnaC05g32510D [Brassica napus]
Length=395

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  109  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVI  142



>ref|XP_002885351.1| pepsin A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61610.1| pepsin A [Arabidopsis lyrata subsp. lyrata]
Length=471

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 51/98 (52%), Gaps = 5/98 (5%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            DDS +  +L L H D   S         L   R++RD  R  A+    +      ++  R
Sbjct  53   DDSNSKYTLRLLHRDRFPSVTYRNHHHRLHA-RMRRDTDRVSAILRRISGKVVVASSDSR  111

Query  363  ----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  112  YEVNDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVI  149



>ref|XP_006297584.1| hypothetical protein CARUB_v10013606mg [Capsella rubella]
 gb|EOA30482.1| hypothetical protein CARUB_v10013606mg [Capsella rubella]
Length=475

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  120  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVI  153



>gb|KFK39328.1| hypothetical protein AALP_AA3G230300 [Arabis alpina]
Length=460

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  105  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVI  138



>ref|XP_009145693.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brassica 
rapa]
Length=467

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  112  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVI  145



>ref|XP_002885261.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61520.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 60/106 (57%), Gaps = 14/106 (13%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalslla---------aaaP  338
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLK  133

Query  339  PHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P N    R      ++ V+SG++QGSGEYF+R+GVGTP K  ++VL
Sbjct  134  PVNNEDTRYQPEALTTPVVSGVSQGSGEYFSRIGVGTPAKEMYLVL  179



>gb|EYU40681.1| hypothetical protein MIMGU_mgv1a005122mg [Erythranthe guttata]
Length=496

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 53/98 (54%), Gaps = 3/98 (3%)
 Frame = +3

Query  177  QPDDSENTLSLDLH--HIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNA  350
            +P  + N+ +  LH  H D ++  + +   +  F  R++RDA R   L    +      A
Sbjct  78   KPTTNHNSTAAKLHLVHRDKLA-FSWHHDHRRRFESRMKRDARRVGGLIRRLSGGGGAAA  136

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                DF S V+SG+ QGSGEYF R+GVG+P +  +MV+
Sbjct  137  YEVADFGSEVVSGMDQGSGEYFVRIGVGSPARSQYMVI  174



>ref|XP_006360843.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=479

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 48/97 (49%), Gaps = 2/97 (2%)
 Frame = +3

Query  174  VQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  353
            ++ ++    L L L H D +           +F  R+ RD  R  ++         +   
Sbjct  63   IEQENGNWKLKLKLIHRDKLQIPHFPYNNNKVFEGRINRDLKRVSSIIHRIENGGVN--Y  120

Query  354  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            R  +F S +ISG+ QGSGEYF R+GVG+P K  +MVL
Sbjct  121  RVEEFGSDLISGMDQGSGEYFVRIGVGSPAKNQYMVL  157



>ref|XP_002513132.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF49635.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=481

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 52/100 (52%), Gaps = 6/100 (6%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKAL------FVKRLQRDaarakalsllaaaaPPH  344
            D+  +TL+     + L+    + A  K+       F  R+QRD  R   L    +     
Sbjct  60   DNQNDTLTEGKWKLKLVHRDKITAFNKSSYDHSHNFHARIQRDKKRVATLIRRLSPRDAT  119

Query  345  NATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            ++    +F + V+SG+ QGSGEYF R+GVG+PP+  ++V+
Sbjct  120  SSYSVEEFGAEVVSGMNQGSGEYFIRIGVGSPPREQYVVI  159



>ref|NP_188636.2| protein ASPARTIC PROTEASE IN GUARD CELL 2 [Arabidopsis thaliana]
 sp|Q9LHE3.1|ASPG2_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 2; Short=AtASPG2; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB03167.1| nucleoid chloroplast DNA-binding protein-like [Arabidopsis thaliana]
 gb|AAO41867.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76319.1| protein aspartic protease in guard cell 2 [Arabidopsis thaliana]
Length=470

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S ++SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  115  DFGSDIVSGMDQGSGEYFVRIGVGSPPRDQYMVI  148



>ref|XP_008351877.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P H   + +D S+ V+SG++QGSGEYF+R+GV TP K  +MVL
Sbjct  126  PMHAEIQPQDLSTPVVSGVSQGSGEYFSRIGVXTPAKSFYMVL  168



>ref|XP_011089579.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 2 [Sesamum indicum]
Length=479

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 53/96 (55%), Gaps = 8/96 (8%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            +P  S +T+ L L H D ++ +  N   +  F  R++RDA R   L   A       A  
Sbjct  70   KPLTSNSTVKLHLVHRDKLAFSWHN-DHRRRFEARMKRDARRVAGLLRXA-------AYE  121

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              DF + V+SG+ QGSGEYF R+GVG+P +  +MV+
Sbjct  122  VADFGAEVVSGMDQGSGEYFVRIGVGSPARSQYMVI  157



>ref|XP_010036867.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Eucalyptus grandis]
Length=496

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 47/79 (59%), Gaps = 12/79 (15%)
 Frame = +3

Query  261  KALFVKRLQRDaarakalsllaaaaPPHNATRG-----------RDFSSSVISGLAQGSG  407
            KAL + RL RD+AR  AL+     A  +N TR             D S+ V+SG +QGSG
Sbjct  99   KALVLARLGRDSARVDALASKLNLAL-NNVTRTDLTPLRTEIQPEDLSTPVVSGTSQGSG  157

Query  408  EYFTRLGVGTPPKYAFMVL  464
            EYF+R+GVGTP K  +MVL
Sbjct  158  EYFSRIGVGTPAKQFYMVL  176



>ref|XP_009346910.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
            P H     +D S+ V+SG++QGSGEYF+R+GVGTP K  +MV
Sbjct  126  PMHAKILPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMV  167



>ref|XP_008465249.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Cucumis 
melo]
Length=477

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 4/94 (4%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            + S++   L L H D +        P+  F +R+ RD+ R  +L  L + A     T   
Sbjct  66   NSSQSQWKLKLFHRDKLPLNFDTNHPRR-FKERISRDSKRVSSLLRLLSNASDEQVT---  121

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S V+SG  QGSGEYF R+GVG+PP+  ++V+
Sbjct  122  DFGSDVVSGTEQGSGEYFVRIGVGSPPRSQYVVI  155



>gb|KDP20100.1| hypothetical protein JCGZ_05869 [Jatropha curcas]
Length=493

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 10/78 (13%)
 Frame = +3

Query  261  KALFVKRLQRDaarakalsllaaaa----------PPHNATRGRDFSSSVISGLAQGSGE  410
            K+L + RLQRD++R KA++     A          P     +  DFS+ V SG +QGSGE
Sbjct  97   KSLVLSRLQRDSSRVKAITTQVELAVNGISKNDLKPLVTEIQPEDFSTPVTSGTSQGSGE  156

Query  411  YFTRLGVGTPPKYAFMVL  464
            YF+R+GVG P K  +MVL
Sbjct  157  YFSRVGVGNPEKSFYMVL  174



>gb|KHN16429.1| Aspartic proteinase nepenthesin-1, partial [Glycine soja]
Length=104

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +3

Query  390  LAQGSGEYFTRLGVGTPPKYAFMVL  464
            LAQGSGEYFTR+GVGTP +Y +MVL
Sbjct  1    LAQGSGEYFTRIGVGTPARYVYMVL  25



>ref|XP_009607692.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=489

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = +3

Query  279  RLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  458
            R++RD  R   L         +N     +F S VISG+ QGSGEYF R+GVG+P +  +M
Sbjct  106  RVKRDVKRVDTLIHKITGGNNNNVYEVEEFGSEVISGMEQGSGEYFVRIGVGSPVREQYM  165

Query  459  VL  464
            V+
Sbjct  166  VI  167



>ref|XP_004157423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=491

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 55/105 (52%), Gaps = 11/105 (10%)
 Frame = +3

Query  180  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----------lsllaa  329
            P +S  + SL LH  D + +A  +   K+L + RL RD++R K+              + 
Sbjct  69   PSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSELKRSD  127

Query  330  aaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              P        D S+ +ISG +QGSGEYF+R+GVG P K  +MVL
Sbjct  128  LEPLKTEILPEDLSTPIISGTSQGSGEYFSRVGVGQPAKPFYMVL  172



>ref|XP_004137465.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN64110.1| hypothetical protein Csa_1G042220 [Cucumis sativus]
Length=491

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 55/105 (52%), Gaps = 11/105 (10%)
 Frame = +3

Query  180  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----------lsllaa  329
            P +S  + SL LH  D + +A  +   K+L + RL RD++R K+              + 
Sbjct  69   PSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSELKRSD  127

Query  330  aaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              P        D S+ +ISG +QGSGEYF+R+GVG P K  +MVL
Sbjct  128  LEPLKTEILPEDLSTPIISGTSQGSGEYFSRVGVGQPAKPFYMVL  172



>ref|XP_006345303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=477

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 46/94 (49%), Gaps = 2/94 (2%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            DD  +   L L H D +  +     P   F  R++RD  R   L+             G 
Sbjct  63   DDDNSRWKLKLLHRDKLPFSHFTDHPHR-FQARMKRDIKRVHTLTATTNYDEVKEEEFG-  120

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             F S VISG+ QGSGEYF R+GVG+P +  +MV+
Sbjct  121  GFGSEVISGMEQGSGEYFVRIGVGSPVRQQYMVI  154



>ref|XP_010103590.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXB96367.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=521

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 6/72 (8%)
 Frame = +3

Query  267  LFVKRLQRDaarakalsllaaaaPPHNATRG------RDFSSSVISGLAQGSGEYFTRLG  428
            +F +R++RDA R  +L    A +  ++   G       DF S V+SG+ QGSGEYF R+G
Sbjct  128  IFNERMKRDAHRVASLVRRLANSSNNSRISGSDKYEVEDFGSEVVSGMDQGSGEYFVRIG  187

Query  429  VGTPPKYAFMVL  464
            VG+P +  +MV+
Sbjct  188  VGSPARSQYMVI  199



>ref|NP_001056485.1| Os05g0590000 [Oryza sativa Japonica Group]
 gb|AAT58814.1| putative nucleoid DNA-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF18399.1| Os05g0590000 [Oryza sativa Japonica Group]
Length=481

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 3/45 (7%)
 Frame = +3

Query  339  PHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A MVL
Sbjct  101  PNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALMVL  145



>emb|CDP04865.1| unnamed protein product [Coffea canephora]
Length=523

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             +F + V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  167  EEFGTEVVSGMEQGSGEYFVRIGVGSPPRNQYMVV  201



>ref|XP_004497116.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=469

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 5/72 (7%)
 Frame = +3

Query  249  NATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLG  428
            +A  K+L + RL RD+AR  ++       P  N  +    S  +ISG +QGSGEYF+R+G
Sbjct  85   HADYKSLTLARLARDSARVNSIVTQLD--PNFNVEK---LSGPIISGTSQGSGEYFSRIG  139

Query  429  VGTPPKYAFMVL  464
            +G PP  A+MVL
Sbjct  140  IGEPPSQAYMVL  151



>ref|XP_004297710.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Fragaria 
vesca subsp. vesca]
Length=477

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +3

Query  261  KALFVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFTRLGVGT  437
            K++F  R+ RD  R  +L               + DF S V+SG+AQGSGEYF R+GVG+
Sbjct  84   KSIFHARIHRDVKRVDSLMRRLGGNSNDQVMNKKLDFGSEVVSGMAQGSGEYFVRIGVGS  143

Query  438  PPKYAFMVL  464
            P +  ++V+
Sbjct  144  PARSQYVVI  152



>ref|XP_002511962.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF50631.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=495

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 10/78 (13%)
 Frame = +3

Query  261  KALFVKRLQRDaarakalsl----------laaaaPPHNATRGRDFSSSVISGLAQGSGE  410
            KAL + RL RD++R +A++            +   P     + +D S+ V SG +QGSGE
Sbjct  99   KALVLSRLHRDSSRVQAITTRLQLILNGVSKSDLKPLQTEIQPQDLSTPVSSGTSQGSGE  158

Query  411  YFTRLGVGTPPKYAFMVL  464
            YFTR+GVG P K  +MVL
Sbjct  159  YFTRVGVGNPAKSYYMVL  176



>ref|XP_002455897.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
 gb|EES01017.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
Length=493

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            +RG   ++ V+SGLAQGSGEYFT++GVGTP   A MVL
Sbjct  120  SRGGAVAAPVVSGLAQGSGEYFTKIGVGTPSTPALMVL  157



>gb|AAT38006.1| unknow protein [Oryza sativa Japonica Group]
Length=475

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 3/45 (7%)
 Frame = +3

Query  339  PHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A MVL
Sbjct  95   PNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALMVL  139



>gb|EAY99240.1| hypothetical protein OsI_21202 [Oryza sativa Indica Group]
Length=475

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 3/45 (7%)
 Frame = +3

Query  339  PHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A MVL
Sbjct  95   PNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALMVL  139



>ref|XP_002970504.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
 gb|EFJ28634.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
Length=483

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 53/103 (51%), Gaps = 4/103 (4%)
 Frame = +3

Query  165  KQLVQPDDSENTLSLDLHHIDLISSAAVNA--TPKALFVKRLQRDaarakalsllaaaa-  335
            K  + P D   TLSL+L H + +   A     T + L ++ LQRD  R + +   A  A 
Sbjct  45   KLQLSPRDG-GTLSLELIHRNSLLREAKEKLHTHEQLLLETLQRDEQRVRWIESKAQLAG  103

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
               +     D +  V SGL  GSGEYF RLGVGTP +  FMV+
Sbjct  104  KKKDEASSTDLNGPVTSGLLYGSGEYFVRLGVGTPARSLFMVV  146



>ref|XP_011008360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=484

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  354  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            +  D  S +ISG +QGSGEYF+R+G+G PP  A+++L
Sbjct  130  KSEDLQSPIISGTSQGSGEYFSRVGIGKPPSQAYLIL  166



>ref|XP_008445900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=481

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 55/107 (51%), Gaps = 14/107 (13%)
 Frame = +3

Query  165  KQLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPH  344
            +Q+       +T  L+L H D +S    +   +  F  R++RDA R   L    +    H
Sbjct  60   RQVSGHKSHNDTFKLNLLHRDKLSHVHGH---RRGFNDRMKRDAIRVATLVRRLS----H  112

Query  345  NATRGRD-------FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             A    D       F++ VISG+ +GSGEYF R+GVG+PP+  +MV+
Sbjct  113  GAAAVEDSRFKVANFATDVISGMEEGSGEYFVRIGVGSPPRSQYMVI  159



>ref|XP_008457107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=489

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 11/105 (10%)
 Frame = +3

Query  180  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----------lsllaa  329
            P +S  + SL LH  D + +A  +   K+L + RL RD++R K+              + 
Sbjct  67   PSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSELKRSD  125

Query  330  aaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              P        D S+ ++SG +QGSGEYF+R+GVG P K  +MVL
Sbjct  126  LEPLKTEILPEDLSTPIVSGTSQGSGEYFSRVGVGQPAKPFYMVL  170



>emb|CDX75968.1| BnaC03g40510D [Brassica napus]
Length=503

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 60/106 (57%), Gaps = 14/106 (13%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + L+L+LH  D +  A  +   K+L + RL+RD++R  A++            +   
Sbjct  78   NSSSPLTLELHSRDTLL-APHHKDYKSLVLSRLERDSSRVAAIAAKVRFSVEGVNRSDLK  136

Query  336  PPHNATRG---RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P +N        + ++ V+SG +QGSGEYF+R+GVGTP K  +MVL
Sbjct  137  PVYNDETMYNPEELTTPVVSGASQGSGEYFSRIGVGTPAKEMYMVL  182



>ref|XP_004150193.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 ref|XP_004170426.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
Length=476

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 53/96 (55%), Gaps = 8/96 (8%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPK--ALFVKRLQRDaarakalsllaaaaPPHNATR  356
            + S++   L L H D +    +N  P     F +R+ RD+ R  +L  L ++      T 
Sbjct  65   NSSQSQWKLKLFHRDKL---PLNFDPDHPRRFKERISRDSKRVSSLLRLLSSGSDEQVT-  120

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              DF S V+SG  QGSGEYF R+GVG+PP+  ++V+
Sbjct  121  --DFGSDVVSGTEQGSGEYFVRIGVGSPPRSQYVVI  154



>ref|XP_010265215.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nelumbo 
nucifera]
Length=494

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            +D    VISG++QGSGEYF+RLG+G P K  +MV+
Sbjct  141  KDLEGPVISGMSQGSGEYFSRLGIGVPAKQLYMVI  175



>ref|XP_004172253.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Cucumis sativus]
Length=486

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             DF S ++SG +QGSGEYF+R+G+G PP   +MVL
Sbjct  134  EDFESPIVSGASQGSGEYFSRVGIGRPPSPVYMVL  168



>ref|XP_004135107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN52057.1| hypothetical protein Csa_5G608450 [Cucumis sativus]
Length=486

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             DF S ++SG +QGSGEYF+R+G+G PP   +MVL
Sbjct  134  EDFESPIVSGASQGSGEYFSRVGIGRPPSPVYMVL  168



>ref|XP_011459743.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Fragaria 
vesca subsp. vesca]
Length=227

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 48/84 (57%), Gaps = 15/84 (18%)
 Frame = +3

Query  225  DLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVIS----GL  392
            D +SS   N TP  LF  RL+RD+    +L+        +N TR    SS   S    GL
Sbjct  25   DALSS---NQTPSQLFHLRLRRDSLHFNSLA--------YNRTRPGPPSSGFSSSIVSGL  73

Query  393  AQGSGEYFTRLGVGTPPKYAFMVL  464
            +QGSGEYFTR+  G+PPKY +MVL
Sbjct  74   SQGSGEYFTRIDDGSPPKYLYMVL  97



>ref|XP_010031370.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
Length=496

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             DF S V+SG+ QGSGEYF R+GVG+P +  +MV+
Sbjct  142  EDFGSDVVSGMDQGSGEYFVRIGVGSPARSQYMVI  176



>ref|XP_008446567.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Cucumis 
melo]
Length=486

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             DF S ++SG +QGSGEYF+R+G+G PP   +MVL
Sbjct  134  EDFESPIVSGASQGSGEYFSRVGIGRPPSPVYMVL  168



>ref|XP_009135580.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=499

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 59/106 (56%), Gaps = 14/106 (13%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + L+L+LH  D +  A  +   K+L + RL+RD++R   ++            +   
Sbjct  73   NSSSPLTLELHSRDTLL-APHHKDYKSLVLSRLERDSSRVAGIAAKVRFSVEGVDRSDLK  131

Query  336  PPHNATRG---RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P +N        + ++ V+SG +QGSGEYF+R+GVGTP K  +MVL
Sbjct  132  PVYNDETMYNPEELTTPVVSGASQGSGEYFSRIGVGTPAKEMYMVL  177



>ref|XP_010551288.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Tarenaya 
hassleriana]
Length=511

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 59/101 (58%), Gaps = 16/101 (16%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATP----KALFVKRLQRDaarakalsl-----laaaaPPHN  347
            ++LSL LH     S A++        + L + RL+RD+AR ++L+      ++  +P   
Sbjct  98   SSLSLKLH-----SRASIRGNEHRDYRTLTLARLERDSARVRSLTTRLDLAVSRVSPAAL  152

Query  348  ATR--GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             TR  G   +  V+SG +QGSGEYF+R+G+G PP+  +MVL
Sbjct  153  ETRDGGAKINGPVVSGTSQGSGEYFSRVGIGNPPRQVYMVL  193



>emb|CDX82342.1| BnaA03g34790D [Brassica napus]
Length=499

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 59/106 (56%), Gaps = 14/106 (13%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + L+L+LH  D +  A  +   K+L + RL+RD++R   ++            +   
Sbjct  73   NSSSPLTLELHSRDTLL-APHHKDYKSLVLSRLERDSSRVAGIAAKVRFSVEGVDRSDLK  131

Query  336  PPHNATRG---RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P +N        + ++ V+SG +QGSGEYF+R+GVGTP K  +MVL
Sbjct  132  PVYNDETMYNPEELTTPVVSGASQGSGEYFSRIGVGTPAKEMYMVL  177



>gb|EEE64882.1| hypothetical protein OsJ_19741 [Oryza sativa Japonica Group]
Length=456

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 3/45 (7%)
 Frame = +3

Query  339  PHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P+NATR R    F++ ++SGL QG+GEYF ++GVGTP   A MVL
Sbjct  95   PNNATRPRRRGGFAAPLLSGLPQGTGEYFAQVGVGTPATTALMVL  139



>ref|XP_010477900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 52/109 (48%), Gaps = 13/109 (12%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa-------  335
            Q + S++  SL LH    +     ++  K+L + RL RD AR K+L      A       
Sbjct  57   QEEQSQSPFSLKLHSRASVRGGVEHSDYKSLTLARLDRDTARVKSLVTRLDLALNNISKA  116

Query  336  ------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                       T   D  + +ISG  QGSGEYFTR+G+G P +  +MVL
Sbjct  117  DLKPVITTMYTTDQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVL  165



>gb|KCW86348.1| hypothetical protein EUGRSUZ_B03036 [Eucalyptus grandis]
Length=492

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            F S V+SG +QGSGEYF+RLGVG PP   +MV+
Sbjct  145  FESPVVSGTSQGSGEYFSRLGVGDPPSQVYMVV  177



>ref|XP_002315953.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEF02124.1| aspartyl protease family protein [Populus trichocarpa]
Length=484

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             D  S +ISG +QGSGEYF+R+G+G PP  A+++L
Sbjct  132  EDLQSPIISGTSQGSGEYFSRVGIGKPPSQAYLIL  166



>ref|XP_010044282.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1 [Eucalyptus grandis]
Length=495

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            F S V+SG +QGSGEYF+RLGVG PP   +MV+
Sbjct  145  FESPVVSGTSQGSGEYFSRLGVGDPPSQVYMVV  177



>ref|XP_007152794.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
 gb|ESW24788.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
Length=486

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P     R  D S+ V SG +QGSGEYF+R+GVG P K  FMVL
Sbjct  125  PTQTEIRPEDLSTPVSSGTSQGSGEYFSRVGVGQPAKPFFMVL  167



>ref|XP_004498098.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Cicer arietinum]
Length=465

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 47/103 (46%), Gaps = 7/103 (7%)
 Frame = +3

Query  165  KQLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarak---alsllaaaa  335
            K+  QP         D H I+ I++A      K  F+ R++RD  R              
Sbjct  57   KEQQQPQWKTKLFHRD-HIINHINTAT---NHKTRFISRIKRDIKRVSFLHNRLNKHTQV  112

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                 T    F S ++SG  +GSGEYF R+G+G+P  Y +MV+
Sbjct  113  TEQETTADTSFGSDIVSGSEEGSGEYFVRIGIGSPAIYQYMVI  155



>ref|XP_011077177.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Sesamum 
indicum]
Length=492

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            VISG +QGSGEYF R+GVG PP  A+MVL
Sbjct  145  VISGTSQGSGEYFCRVGVGNPPTQAYMVL  173



>ref|XP_009385987.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Musa acuminata 
subsp. malaccensis]
Length=464

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S V+SGL +GSGEYF R+GVG PP+  ++V+
Sbjct  102  DFGSEVVSGLEEGSGEYFVRVGVGVPPRDQYLVV  135



>ref|XP_004498097.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Cicer arietinum]
Length=478

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 47/103 (46%), Gaps = 7/103 (7%)
 Frame = +3

Query  165  KQLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarak---alsllaaaa  335
            K+  QP         D H I+ I++A      K  F+ R++RD  R              
Sbjct  57   KEQQQPQWKTKLFHRD-HIINHINTAT---NHKTRFISRIKRDIKRVSFLHNRLNKHTQV  112

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                 T    F S ++SG  +GSGEYF R+G+G+P  Y +MV+
Sbjct  113  TEQETTADTSFGSDIVSGSEEGSGEYFVRIGIGSPAIYQYMVI  155



>ref|XP_004253208.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=486

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            G  F S VISG+ QGSGEYF R+GVG+P +  +MV+
Sbjct  127  GFGFGSEVISGMEQGSGEYFVRIGVGSPVRQQYMVI  162



>ref|XP_009770623.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=512

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             +F S VISG+ QGSGEYF R+GVG+P +  +MV+
Sbjct  156  EEFGSEVISGMEQGSGEYFVRIGVGSPVREQYMVI  190



>ref|XP_004961034.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=517

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 6/46 (13%)
 Frame = +3

Query  345  NATR------GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            N TR      G  F++ V+SGL+QGSGEYF ++GVGTPP  A +VL
Sbjct  128  NGTRAPRRRGGSGFAAPVLSGLSQGSGEYFAQVGVGTPPTPALLVL  173



>ref|XP_004512945.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=502

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P     +  D S+ V SG  QGSGEYFTRLGVG P K  +MVL
Sbjct  142  PTQTELQQLDLSTPVSSGTGQGSGEYFTRLGVGQPEKPYYMVL  184



>ref|XP_008221090.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Prunus 
mume]
Length=542

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            F S V+SG+ QGSGEYF R+GVG+PP+  ++V+
Sbjct  169  FGSEVVSGMEQGSGEYFVRIGVGSPPRSQYIVI  201



>ref|XP_007227097.1| hypothetical protein PRUPE_ppa025647mg [Prunus persica]
 gb|EMJ28296.1| hypothetical protein PRUPE_ppa025647mg [Prunus persica]
Length=524

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            F S V+SG+ QGSGEYF R+GVG+PP+  ++V+
Sbjct  170  FGSEVVSGMEQGSGEYFVRIGVGSPPRSQYIVI  202



>gb|ABK24255.1| unknown [Picea sitchensis]
 gb|ABR16185.1| unknown [Picea sitchensis]
Length=485

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            DF S V+SG+ QGSGEYF+R+GVG P +   MVL
Sbjct  129  DFQSPVVSGMDQGSGEYFSRIGVGAPRRDQLMVL  162



>emb|CBI27051.3| unnamed protein product [Vitis vinifera]
Length=256

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            ++SG +QGSGEYF+R+G+G+PPK+ +MV+
Sbjct  42   LVSGASQGSGEYFSRVGIGSPPKHVYMVV  70



>ref|XP_006374138.1| hypothetical protein POPTR_0015s02540g [Populus trichocarpa]
 gb|ABK94105.1| unknown [Populus trichocarpa]
 gb|ERP51935.1| hypothetical protein POPTR_0015s02540g [Populus trichocarpa]
Length=499

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P     +  D S+ V SG +QGSGEYFTR+GVG P +  +MVL
Sbjct  136  PLETEIKPEDLSTPVTSGTSQGSGEYFTRVGVGNPARQFYMVL  178



>ref|XP_011004863.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=501

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            P     +  D S+ V SG +QGSGEYFTR+GVG P +  +MVL
Sbjct  138  PLETEIKPEDLSTPVTSGTSQGSGEYFTRVGVGNPARQFYMVL  180



>ref|NP_173922.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAG50814.1|AC079281_16 hypothetical protein [Arabidopsis thaliana]
 gb|AAM20575.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15613.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00436.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30636.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=483

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            T  +D  + +ISG  QGSGEYFTR+G+G P +  +MVL
Sbjct  128  TEEQDIEAPLISGTTQGSGEYFTRVGIGKPAREVYMVL  165



>ref|XP_006306517.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
 gb|EOA39415.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
Length=482

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +3

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            T   D  + +ISG  QGSGEYFTR+G+G P +  +MVL
Sbjct  127  TEQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVL  164



>ref|XP_010916474.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=512

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 64/106 (60%), Gaps = 20/106 (19%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATP---KALFVKRLQRDaarakalsllaaaaPPHNATRG----  359
            L+L+LH  D + ++A +  P   K L + RL+RD+AR K+++   A A  H+  R     
Sbjct  82   LTLELHSRDFLPTSA-HPRPNDYKTLTLDRLRRDSARVKSIAAQLALAA-HSVKRTDLKP  139

Query  360  ----RDFSSS-------VISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                ++F++S       ++SG +QGSGEYF+R+G+G PPK  +MVL
Sbjct  140  VAEEKEFAASAESIRGPIVSGTSQGSGEYFSRVGIGNPPKPLYMVL  185



>ref|XP_006415880.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
 gb|ESQ34233.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
Length=487

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 52/99 (53%), Gaps = 11/99 (11%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPH-----------N  347
             +L LH    +  A  ++  K+L + RL+RD+AR K+L      A  +            
Sbjct  71   FTLQLHSRASVRGAEHHSDYKSLTLARLERDSARVKSLMARLDLAINNISKSDLKPISTT  130

Query  348  ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             T  +D  + +ISG  QGSGEYFTR+G+G P +  +MVL
Sbjct  131  YTTQQDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVL  169



>ref|XP_008799310.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=507

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 57/108 (53%), Gaps = 24/108 (22%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATP-----KALFVKRLQRDaarakalsllaaaaPPHNATRG--  359
            L+L+LH  D + +   NA P     KAL + RL+RD+ R K+++   A A  H   R   
Sbjct  76   LTLELHSRDFLPT---NAQPRPTDYKALTLDRLRRDSTRVKSIAARLALAA-HGVKRSDL  131

Query  360  -------------RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
                               ++SG +QGSGEYF+R+G+G+PPK  +MVL
Sbjct  132  KPVTEEEEFEASAEAIRGPIVSGTSQGSGEYFSRVGIGSPPKPLYMVL  179



>gb|KJB52970.1| hypothetical protein B456_008G285900 [Gossypium raimondii]
Length=492

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
             S+ VISG +QGSGEYFTR+GVG P K  +MVL
Sbjct  141  LSTPVISGTSQGSGEYFTRVGVGNPAKQFYMVL  173



>ref|XP_002281973.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Vitis vinifera]
Length=491

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            ++SG +QGSGEYF+R+G+G+PPK+ +MV+
Sbjct  144  LVSGASQGSGEYFSRVGIGSPPKHVYMVV  172



>ref|XP_009356391.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=491

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  354  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              + F   +ISG +QGSGEYF+R+G+G PP  A++VL
Sbjct  137  EAKGFEGPIISGTSQGSGEYFSRVGIGKPPSQAYVVL  173



>emb|CDY51131.1| BnaA07g37140D [Brassica napus]
Length=436

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 8/68 (12%)
 Frame = +3

Query  261  KALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTP  440
            K+L + RL RD+AR    ++          T  ++  + +ISG  QGSGEYFTR+G+G P
Sbjct  89   KSLTLARLDRDSARPVITTMY--------TTEQQEIEAPLISGTTQGSGEYFTRVGIGNP  140

Query  441  PKYAFMVL  464
             +  +MVL
Sbjct  141  AREVYMVL  148



>ref|XP_006362549.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=482

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 53/108 (49%), Gaps = 17/108 (16%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATP----KALFVKRLQRDaarakalsl----------laa  329
            EN +S  L    L S  AV  T      +L + RL+RD+ARAK+L             + 
Sbjct  56   ENQISSSLLSFQLHSRVAVRGTSHKDYNSLMLARLERDSARAKSLQTRVDLVVQGIGKSD  115

Query  330  aaPPHNATR---GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              P     R     +    +ISG +QGSGEYF+R+G+G PP   +MVL
Sbjct  116  LKPMETEFREIQAEEIEGPIISGTSQGSGEYFSRIGIGHPPSQVYMVL  163



>ref|XP_010460347.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +3

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            T   D  + +ISG  QGSGEYFTR+G+G P +  +MVL
Sbjct  127  TDQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVL  164



>ref|XP_010499100.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +3

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
            T   D  + +ISG  QGSGEYFTR+G+G P +  +MVL
Sbjct  127  TDQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVL  164



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559272306750