BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF047P18

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AEA86340.1|  BES1/BZR1-like protein                                  180   3e-53   Solanum nigrum
ref|XP_009590977.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        183   1e-52   Nicotiana tomentosiformis
ref|XP_011101448.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        181   5e-52   Sesamum indicum [beniseed]
gb|EYU28126.1|  hypothetical protein MIMGU_mgv1a007967mg                179   3e-51   Erythranthe guttata [common monkey flower]
ref|XP_006358089.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    178   8e-51   Solanum tuberosum [potatoes]
gb|EYU28125.1|  hypothetical protein MIMGU_mgv1a007967mg                180   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_009785426.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        177   3e-50   Nicotiana sylvestris
ref|XP_004234074.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    176   4e-50   Solanum lycopersicum
ref|XP_009607196.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    176   1e-49   Nicotiana tomentosiformis
ref|XP_010242162.1|  PREDICTED: BES1/BZR1 homolog protein 4             174   4e-49   Nelumbo nucifera [Indian lotus]
ref|XP_006358087.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    174   4e-49   Solanum tuberosum [potatoes]
ref|XP_009800423.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    173   1e-48   Nicotiana sylvestris
ref|XP_011033513.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    172   2e-48   Populus euphratica
ref|XP_002305719.1|  hypothetical protein POPTR_0004s06100g             172   2e-48   Populus trichocarpa [western balsam poplar]
emb|CDO96875.1|  unnamed protein product                                171   3e-48   Coffea canephora [robusta coffee]
ref|XP_007025289.1|  BES1/BZR1                                          171   4e-48   Theobroma cacao [chocolate]
ref|XP_004233053.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    171   8e-48   Solanum lycopersicum
ref|XP_002522271.1|  BRASSINAZOLE-RESISTANT 2 protein, putative         171   8e-48   Ricinus communis
gb|KDP21147.1|  hypothetical protein JCGZ_21618                         170   2e-47   Jatropha curcas
ref|XP_010052157.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    169   2e-47   Eucalyptus grandis [rose gum]
gb|KJB68362.1|  hypothetical protein B456_010G240700                    167   4e-47   Gossypium raimondii
gb|KHG20428.1|  BES1/BZR1 4 -like protein                               169   4e-47   Gossypium arboreum [tree cotton]
gb|KJB68361.1|  hypothetical protein B456_010G240700                    168   5e-47   Gossypium raimondii
ref|XP_010316856.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    166   4e-46   Solanum lycopersicum
ref|XP_006449559.1|  hypothetical protein CICLE_v10015910mg             164   4e-45   Citrus clementina [clementine]
ref|XP_011039378.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        163   7e-45   Populus euphratica
gb|EPS61611.1|  hypothetical protein M569_13185                         162   2e-44   Genlisea aurea
ref|XP_004147390.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        162   2e-44   Cucumis sativus [cucumbers]
ref|XP_008443587.1|  PREDICTED: BES1/BZR1 homolog protein 4             162   2e-44   Cucumis melo [Oriental melon]
gb|KJB69669.1|  hypothetical protein B456_011G036300                    156   2e-43   Gossypium raimondii
gb|KJB69670.1|  hypothetical protein B456_011G036300                    156   8e-43   Gossypium raimondii
gb|KHG25078.1|  BES1/BZR1 4 -like protein                               157   1e-42   Gossypium arboreum [tree cotton]
gb|KJB69668.1|  hypothetical protein B456_011G036300                    157   2e-42   Gossypium raimondii
ref|XP_008371512.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        156   3e-42   Malus domestica [apple tree]
ref|XP_009352718.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        156   3e-42   Pyrus x bretschneideri [bai li]
ref|XP_008796066.1|  PREDICTED: protein BZR1 homolog 3                  156   3e-42   Phoenix dactylifera
ref|XP_008383594.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        155   1e-41   
ref|XP_010915465.1|  PREDICTED: protein BZR1 homolog 3-like             154   3e-41   Elaeis guineensis
ref|XP_007021866.1|  BES1/BZR1                                          153   4e-41   
ref|XP_008451746.1|  PREDICTED: BES1/BZR1 homolog protein 4             152   9e-41   Cucumis melo [Oriental melon]
ref|XP_006370100.1|  hypothetical protein POPTR_0001s39520g             152   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010916623.1|  PREDICTED: protein BZR1 homolog 3-like             152   2e-40   Elaeis guineensis
ref|XP_011002762.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    151   2e-40   Populus euphratica
ref|XP_004137229.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        151   2e-40   Cucumis sativus [cucumbers]
ref|XP_006442380.1|  hypothetical protein CICLE_v10021151mg             150   4e-40   Citrus clementina [clementine]
gb|KHG15415.1|  BES1/BZR1 4 -like protein                               150   4e-40   Gossypium arboreum [tree cotton]
ref|XP_002317445.1|  brassinosteroid signaling positive regulator...    150   6e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010644097.1|  PREDICTED: BES1/BZR1 homolog protein 4             150   6e-40   Vitis vinifera
ref|XP_006477843.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    150   8e-40   Citrus sinensis [apfelsine]
ref|XP_009359371.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        149   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_010518826.1|  PREDICTED: BES1/BZR1 homolog protein 3 isofo...    147   3e-39   Tarenaya hassleriana [spider flower]
gb|KJB13026.1|  hypothetical protein B456_002G052400                    148   3e-39   Gossypium raimondii
ref|XP_010518825.1|  PREDICTED: BES1/BZR1 homolog protein 3 isofo...    147   4e-39   Tarenaya hassleriana [spider flower]
ref|XP_011044050.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        147   5e-39   Populus euphratica
ref|XP_009416433.1|  PREDICTED: protein BZR1 homolog 3                  148   6e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007211637.1|  hypothetical protein PRUPE_ppa008675mg             147   7e-39   Prunus persica
ref|XP_006833072.1|  hypothetical protein AMTR_s00170p00061300          146   7e-39   Amborella trichopoda
gb|KJB45771.1|  hypothetical protein B456_007G327000                    147   7e-39   Gossypium raimondii
emb|CDP06034.1|  unnamed protein product                                147   1e-38   Coffea canephora [robusta coffee]
ref|XP_002267082.1|  PREDICTED: BES1/BZR1 homolog protein 4             147   2e-38   Vitis vinifera
ref|XP_007211588.1|  hypothetical protein PRUPE_ppa008637mg             146   2e-38   Prunus persica
ref|XP_009334016.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        146   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_007149549.1|  hypothetical protein PHAVU_005G079400g             145   3e-38   Phaseolus vulgaris [French bean]
ref|XP_004489001.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    145   5e-38   Cicer arietinum [garbanzo]
ref|XP_008386283.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        144   6e-38   
gb|KHG21553.1|  BES1/BZR1 4 -like protein                               144   7e-38   Gossypium arboreum [tree cotton]
ref|XP_010924706.1|  PREDICTED: protein BZR1 homolog 3-like             145   8e-38   Elaeis guineensis
ref|XP_004489004.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    144   1e-37   Cicer arietinum [garbanzo]
ref|XP_004489003.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    144   2e-37   
ref|XP_003540501.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    144   2e-37   Glycine max [soybeans]
ref|XP_006592939.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    143   3e-37   Glycine max [soybeans]
ref|XP_010429699.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        143   3e-37   Camelina sativa [gold-of-pleasure]
ref|NP_565187.1|  BES1/BZR1 homolog 4                                   142   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389963.1|  hypothetical protein EUTSA_v10018888mg             142   6e-37   Eutrema salsugineum [saltwater cress]
ref|XP_004294130.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        142   7e-37   Fragaria vesca subsp. vesca
ref|XP_010417476.1|  PREDICTED: BES1/BZR1 homolog protein 4             142   7e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009415180.1|  PREDICTED: protein BZR1 homolog 3-like             142   8e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008381083.1|  PREDICTED: BES1/BZR1 homolog protein 4             141   1e-36   
ref|XP_006302567.1|  hypothetical protein CARUB_v10020674mg             141   1e-36   Capsella rubella
ref|XP_002887754.1|  hypothetical protein ARALYDRAFT_895772             141   1e-36   Arabidopsis lyrata subsp. lyrata
gb|KHN36918.1|  BES1/BZR1 like protein 4                                141   2e-36   Glycine soja [wild soybean]
ref|XP_003543195.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        141   2e-36   Glycine max [soybeans]
ref|XP_003596275.1|  Brassinosteroid signaling positive regulator...    141   2e-36   Medicago truncatula
ref|XP_010537716.1|  PREDICTED: BES1/BZR1 homolog protein 4             140   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_009768995.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        140   2e-36   Nicotiana sylvestris
ref|XP_008226380.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        140   2e-36   Prunus mume [ume]
ref|XP_010925590.1|  PREDICTED: protein BZR1 homolog 3-like             140   3e-36   
ref|XP_009622768.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        139   5e-36   Nicotiana tomentosiformis
ref|XP_010665681.1|  PREDICTED: BES1/BZR1 homolog protein 4             139   8e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009381197.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        140   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397454.1|  PREDICTED: protein BZR1 homolog 2-like             139   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010472705.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        139   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_004309625.1|  PREDICTED: BES1/BZR1 homolog protein 4             138   2e-35   Fragaria vesca subsp. vesca
ref|XP_006594721.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    138   3e-35   Glycine max [soybeans]
ref|XP_003543196.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    138   3e-35   Glycine max [soybeans]
ref|XP_010062789.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        137   3e-35   Eucalyptus grandis [rose gum]
ref|XP_009388695.1|  PREDICTED: protein BZR1 homolog 3-like             137   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY14593.1|  BnaC02g25200D                                          137   4e-35   Brassica napus [oilseed rape]
emb|CDY26877.1|  BnaA02g19020D                                          136   4e-35   Brassica napus [oilseed rape]
ref|XP_009128310.1|  PREDICTED: BES1/BZR1 homolog protein 4             136   5e-35   Brassica rapa
ref|XP_003540502.1|  PREDICTED: BES1/BZR1 homolog protein 4             137   5e-35   Glycine max [soybeans]
gb|AES66525.2|  brassinazole-resistant 1 protein                        139   6e-35   Medicago truncatula
ref|XP_003596274.1|  Brassinosteroid signaling positive regulator...    139   6e-35   
ref|XP_006348323.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        136   7e-35   Solanum tuberosum [potatoes]
ref|XP_004244287.1|  PREDICTED: BES1/BZR1 homolog protein 4             136   7e-35   Solanum lycopersicum
ref|XP_010088009.1|  hypothetical protein L484_004599                   137   8e-35   
ref|XP_011082785.1|  PREDICTED: BES1/BZR1 homolog protein 4             134   7e-34   
emb|CDX88466.1|  BnaC06g39100D                                          132   2e-33   
emb|CDX87440.1|  BnaA07g34330D                                          132   3e-33   
emb|CDY01563.1|  BnaC07g35530D                                          130   6e-33   
ref|XP_009136969.1|  PREDICTED: BES1/BZR1 homolog protein 3-like        130   6e-33   Brassica rapa
emb|CDX98592.1|  BnaA03g43770D                                          130   7e-33   
gb|KFK42252.1|  hypothetical protein AALP_AA2G231000                    131   8e-33   Arabis alpina [alpine rockcress]
gb|ABK21940.1|  unknown                                                 132   1e-32   Picea sitchensis
ref|XP_006284265.1|  hypothetical protein CARUB_v10005431mg             130   1e-32   Capsella rubella
ref|NP_193624.1|  BES1/BZR1-like protein 3                              130   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132289.1|  PREDICTED: BES1/BZR1 homolog protein 3             129   1e-32   Brassica rapa
ref|XP_008792311.1|  PREDICTED: protein BZR1 homolog 3-like             130   2e-32   Phoenix dactylifera
ref|XP_009106588.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        129   3e-32   Brassica rapa
ref|XP_010434483.1|  PREDICTED: BES1/BZR1 homolog protein 3             128   5e-32   Camelina sativa [gold-of-pleasure]
gb|KFK28557.1|  hypothetical protein AALP_AA7G011700                    128   6e-32   Arabis alpina [alpine rockcress]
ref|XP_006414043.1|  hypothetical protein EUTSA_v10025918mg             127   8e-32   Eutrema salsugineum [saltwater cress]
ref|XP_002870016.1|  hypothetical protein ARALYDRAFT_492971             127   1e-31   
ref|XP_002437132.1|  hypothetical protein SORBIDRAFT_10g021750          127   3e-31   Sorghum bicolor [broomcorn]
ref|XP_004965584.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        126   8e-31   Setaria italica
ref|XP_008790049.1|  PREDICTED: protein BZR1 homolog 3-like             125   1e-30   Phoenix dactylifera
emb|CBI20158.3|  unnamed protein product                                119   2e-30   Vitis vinifera
ref|NP_001136786.1|  BES transcription factor                           125   3e-30   Zea mays [maize]
gb|EEC80795.1|  hypothetical protein OsI_23332                          120   1e-28   Oryza sativa Indica Group [Indian rice]
ref|NP_001057840.1|  Os06g0552300                                       120   1e-28   
ref|XP_003563774.1|  PREDICTED: protein BZR1 homolog 3                  120   1e-28   Brachypodium distachyon [annual false brome]
gb|ACU18376.1|  unknown                                                 115   1e-28   Glycine max [soybeans]
gb|EMT21245.1|  hypothetical protein F775_32777                         120   1e-28   
ref|XP_004968562.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        120   2e-28   Setaria italica
ref|XP_003565213.1|  PREDICTED: protein BZR1 homolog 2                  119   2e-28   
ref|XP_002454981.1|  hypothetical protein SORBIDRAFT_03g002480          119   4e-28   Sorghum bicolor [broomcorn]
gb|EYU29527.1|  hypothetical protein MIMGU_mgv1a010055mg                118   5e-28   Erythranthe guttata [common monkey flower]
gb|ACG41016.1|  brassinazole-resistant 1 protein                        118   5e-28   Zea mays [maize]
ref|NP_001132634.1|  uncharacterized protein LOC100194109               118   5e-28   Zea mays [maize]
ref|XP_010675300.1|  PREDICTED: BES1/BZR1 homolog protein 4             117   8e-28   Beta vulgaris subsp. vulgaris [field beet]
emb|CDM82126.1|  unnamed protein product                                117   9e-28   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001042330.1|  Os01g0203000                                       118   1e-27   
dbj|BAB33003.1|  unknown protein                                        117   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002983955.1|  hypothetical protein SELMODRAFT_451483             117   3e-27   Selaginella moellendorffii
ref|XP_002960716.1|  hypothetical protein SELMODRAFT_437216             117   3e-27   Selaginella moellendorffii
gb|EEC70129.1|  hypothetical protein OsI_00807                          115   5e-27   Oryza sativa Indica Group [Indian rice]
gb|EEE54074.1|  hypothetical protein OsJ_00786                          115   6e-27   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ97997.1|  predicted protein                                      115   7e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001782618.1|  predicted protein                                  114   1e-26   
emb|CDX99414.1|  BnaC01g11380D                                          112   1e-25   
ref|XP_001782551.1|  predicted protein                                  114   1e-25   
gb|EMT29878.1|  hypothetical protein F775_52316                         112   1e-25   
gb|ADE77805.1|  unknown                                                 110   4e-25   Picea sitchensis
gb|EMS63049.1|  hypothetical protein TRIUR3_11319                       112   5e-25   Triticum urartu
ref|XP_010559011.1|  PREDICTED: BES1/BZR1 homolog protein 3-like        104   1e-24   Tarenaya hassleriana [spider flower]
gb|ABR18463.1|  unknown                                                 109   2e-24   Picea sitchensis
ref|XP_003571150.2|  PREDICTED: protein BZR1 homolog 3-like             108   3e-24   Brachypodium distachyon [annual false brome]
sp|Q6EUF1.2|BZR4_ORYSJ  RecName: Full=Protein BZR1 homolog 4; Sho...    107   4e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010254939.1|  PREDICTED: BES1/BZR1 homolog protein 2             104   5e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010680895.1|  PREDICTED: BES1/BZR1 homolog protein 2-like        103   1e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009374228.1|  PREDICTED: BES1/BZR1 homolog protein 2             103   1e-22   Pyrus x bretschneideri [bai li]
ref|XP_006377532.1|  hypothetical protein POPTR_0011s06810g           99.0    2e-22   
ref|XP_009349751.1|  PREDICTED: BES1/BZR1 homolog protein 2-like        101   5e-22   Pyrus x bretschneideri [bai li]
ref|XP_002273547.1|  PREDICTED: BES1/BZR1 homolog protein 2             101   7e-22   Vitis vinifera
ref|XP_002965931.1|  hypothetical protein SELMODRAFT_407084             101   8e-22   Selaginella moellendorffii
ref|XP_008241630.1|  PREDICTED: BES1/BZR1 homolog protein 2             100   9e-22   Prunus mume [ume]
ref|XP_002968357.1|  hypothetical protein SELMODRAFT_409126             100   1e-21   Selaginella moellendorffii
ref|XP_007202252.1|  hypothetical protein PRUPE_ppa008842mg             100   1e-21   Prunus persica
ref|XP_010093488.1|  hypothetical protein L484_017551                   100   1e-21   
ref|XP_006383240.1|  hypothetical protein POPTR_0005s12790g             100   2e-21   
gb|ADE77262.1|  unknown                                               99.8    2e-21   Picea sitchensis
ref|XP_006383241.1|  hypothetical protein POPTR_0005s12790g           99.8    3e-21   Populus trichocarpa [western balsam poplar]
gb|EYU44662.1|  hypothetical protein MIMGU_mgv1a010729mg              99.4    3e-21   Erythranthe guttata [common monkey flower]
ref|XP_008795632.1|  PREDICTED: protein BZR1 homolog 1-like           99.4    3e-21   Phoenix dactylifera
ref|XP_010999949.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      99.8    3e-21   Populus euphratica
ref|XP_009379188.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      99.4    4e-21   Pyrus x bretschneideri [bai li]
ref|XP_009389663.1|  PREDICTED: protein BZR1 homolog 1-like           99.0    4e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008338783.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      99.0    4e-21   
emb|CDP02805.1|  unnamed protein product                              98.6    5e-21   Coffea canephora [robusta coffee]
ref|XP_010907212.1|  PREDICTED: protein BZR1 homolog 1-like           98.2    7e-21   Elaeis guineensis
ref|XP_009411027.1|  PREDICTED: protein BZR1 homolog 1                98.2    7e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010531182.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      98.2    7e-21   Tarenaya hassleriana [spider flower]
ref|XP_011097209.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      98.2    8e-21   Sesamum indicum [beniseed]
ref|XP_010070026.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      98.2    9e-21   
ref|XP_011099590.1|  PREDICTED: BES1/BZR1 homolog protein 2           97.8    1e-20   Sesamum indicum [beniseed]
ref|XP_002525100.1|  BRASSINAZOLE-RESISTANT 1 protein, putative       97.8    1e-20   Ricinus communis
ref|XP_007047017.1|  Brassinosteroid signaling positive regulator...  97.4    1e-20   
ref|XP_009394366.1|  PREDICTED: protein BZR1 homolog 1-like           97.4    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011025717.1|  PREDICTED: LOW QUALITY PROTEIN: BES1/BZR1 ho...  97.4    2e-20   Populus euphratica
ref|XP_007156899.1|  hypothetical protein PHAVU_002G0267001g          92.8    2e-20   Phaseolus vulgaris [French bean]
ref|XP_010558116.1|  PREDICTED: BES1/BZR1 homolog protein 1           96.7    2e-20   Tarenaya hassleriana [spider flower]
gb|KDP38469.1|  hypothetical protein JCGZ_04394                       97.1    2e-20   Jatropha curcas
ref|XP_003537545.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      97.1    2e-20   Glycine max [soybeans]
ref|XP_004958130.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      97.1    2e-20   Setaria italica
emb|CDY62653.1|  BnaAnng18240D                                        96.7    3e-20   Brassica napus [oilseed rape]
ref|XP_002310201.1|  hypothetical protein POPTR_0007s12370g           96.7    3e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010943157.1|  PREDICTED: protein BZR1 homolog 1-like           96.3    3e-20   Elaeis guineensis
gb|KDP31804.1|  hypothetical protein JCGZ_12265                       96.3    4e-20   Jatropha curcas
sp|Q7XI96.1|BZR1_ORYSJ  RecName: Full=Protein BZR1 homolog 1; Sho...  95.9    4e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060100.2|  Os07g0580500                                     95.9    4e-20   
ref|XP_002463083.1|  hypothetical protein SORBIDRAFT_02g037500        96.3    4e-20   Sorghum bicolor [broomcorn]
ref|XP_007156901.1|  hypothetical protein PHAVU_002G0268001g          91.7    4e-20   Phaseolus vulgaris [French bean]
emb|CDX90690.1|  BnaA03g40910D                                        95.9    4e-20   
ref|XP_009136556.1|  PREDICTED: BES1/BZR1 homolog protein 1           95.9    4e-20   Brassica rapa
ref|XP_008653282.1|  PREDICTED: protein BZR1 homolog 1-like           95.9    5e-20   
emb|CAN83287.1|  hypothetical protein VITISV_033232                   95.9    5e-20   Vitis vinifera
ref|XP_002283352.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      95.9    5e-20   Vitis vinifera
ref|NP_190644.1|  BES1/BZR1 1                                         95.5    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004300602.1|  PREDICTED: BES1/BZR1 homolog protein 2           95.9    5e-20   Fragaria vesca subsp. vesca
emb|CBI19651.3|  unnamed protein product                              95.5    6e-20   Vitis vinifera
ref|XP_003517250.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      95.5    6e-20   
ref|XP_002877766.1|  hypothetical protein ARALYDRAFT_485421           95.5    6e-20   
ref|NP_001151195.1|  BES1/BZR1 protein                                95.5    7e-20   
ref|XP_008440681.1|  PREDICTED: BES1/BZR1 homolog protein 2           95.5    7e-20   Cucumis melo [Oriental melon]
ref|XP_004143497.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      95.5    7e-20   Cucumis sativus [cucumbers]
ref|XP_008806188.1|  PREDICTED: protein BZR1 homolog 1-like           95.1    8e-20   Phoenix dactylifera
ref|XP_006404006.1|  hypothetical protein EUTSA_v10010593mg           95.1    8e-20   Eutrema salsugineum [saltwater cress]
ref|XP_002510347.1|  BRASSINAZOLE-RESISTANT 1 protein, putative       95.1    9e-20   Ricinus communis
gb|KDO79470.1|  hypothetical protein CISIN_1g020929mg                 95.1    9e-20   Citrus sinensis [apfelsine]
ref|XP_006291638.1|  hypothetical protein CARUB_v10017793mg           94.7    1e-19   
ref|XP_006425734.1|  hypothetical protein CICLE_v10026102mg           95.1    1e-19   Citrus clementina [clementine]
ref|XP_006466728.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      95.1    1e-19   Citrus sinensis [apfelsine]
emb|CDP07559.1|  unnamed protein product                              94.7    1e-19   Coffea canephora [robusta coffee]
gb|KJB59824.1|  hypothetical protein B456_009G274000                  94.4    2e-19   Gossypium raimondii
ref|XP_007047018.1|  Brassinosteroid signaling positive regulator...  94.4    2e-19   
ref|XP_006342599.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  94.4    2e-19   Solanum tuberosum [potatoes]
gb|KHN36916.1|  Protein BRASSINAZOLE-RESISTANT 2                      90.1    2e-19   Glycine soja [wild soybean]
emb|CBI20161.3|  unnamed protein product                              93.6    2e-19   Vitis vinifera
ref|XP_007017466.1|  Brassinosteroid signaling positive regulator...  94.0    2e-19   Theobroma cacao [chocolate]
emb|CDY64371.1|  BnaC07g50000D                                        94.0    2e-19   Brassica napus [oilseed rape]
ref|XP_010471609.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  94.0    2e-19   Camelina sativa [gold-of-pleasure]
gb|KJB58324.1|  hypothetical protein B456_009G204600                  94.0    2e-19   Gossypium raimondii
gb|AFK40796.1|  unknown                                               93.2    2e-19   Lotus japonicus
ref|XP_006411962.1|  hypothetical protein EUTSA_v10025775mg           94.0    3e-19   Eutrema salsugineum [saltwater cress]
ref|NP_001172869.1|  Os02g0233200                                     94.0    3e-19   
gb|EAY85121.1|  hypothetical protein OsI_06471                        94.0    3e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_010521471.1|  PREDICTED: BES1/BZR1 homolog protein 1-like      93.2    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_006583443.1|  PREDICTED: protein argonaute 4-like              92.8    3e-19   Glycine max [soybeans]
ref|NP_195396.4|  BES1/BZR1-like protein 2                            92.8    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284125.1|  hypothetical protein CARUB_v10005257mg           93.6    4e-19   Capsella rubella
ref|XP_002866992.1|  hypothetical protein ARALYDRAFT_912686           93.2    4e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_010548357.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      93.2    4e-19   Tarenaya hassleriana [spider flower]
sp|Q94A43.1|BEH2_ARATH  RecName: Full=BES1/BZR1 homolog protein 2     93.2    4e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AFK43588.1|  unknown                                               92.8    5e-19   Medicago truncatula
ref|XP_010426615.1|  PREDICTED: BES1/BZR1 homolog protein 1           92.8    5e-19   Camelina sativa [gold-of-pleasure]
gb|KJB29554.1|  hypothetical protein B456_005G107000                  92.8    5e-19   Gossypium raimondii
ref|NP_001234745.1|  mature anther-specific protein LAT61             92.8    5e-19   
gb|AFG30996.1|  BES1S                                                 90.5    6e-19   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003611934.1|  BES1/BZR1-like protein                           92.8    6e-19   Medicago truncatula
gb|KFK30297.1|  hypothetical protein AALP_AA7G243400                  92.8    6e-19   Arabis alpina [alpine rockcress]
ref|XP_008220760.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      92.4    7e-19   Prunus mume [ume]
ref|XP_009142040.1|  PREDICTED: BES1/BZR1 homolog protein 2           92.4    7e-19   Brassica rapa
ref|XP_006367310.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  92.4    8e-19   
ref|XP_009414760.1|  PREDICTED: protein BZR1 homolog 1-like           92.4    8e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011083731.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      92.4    8e-19   Sesamum indicum [beniseed]
ref|XP_004238228.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      92.4    9e-19   Solanum lycopersicum
gb|EYU45114.1|  hypothetical protein MIMGU_mgv1a009718mg              92.4    9e-19   Erythranthe guttata [common monkey flower]
ref|XP_010428512.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      92.4    9e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010539923.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      92.0    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_006302529.1|  hypothetical protein CARUB_v10020629mg           92.0    1e-18   Capsella rubella
ref|XP_010416372.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      92.0    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006473462.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  92.0    1e-18   Citrus sinensis [apfelsine]
ref|XP_006434936.1|  hypothetical protein CICLE_v10001978mg           91.7    1e-18   Citrus clementina [clementine]
ref|XP_011074507.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1 ...  92.0    1e-18   Sesamum indicum [beniseed]
emb|CDY59466.1|  BnaCnng34980D                                        92.0    1e-18   Brassica napus [oilseed rape]
ref|XP_009765795.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      92.0    1e-18   Nicotiana sylvestris
ref|XP_009610833.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      91.7    1e-18   Nicotiana tomentosiformis
ref|XP_004512010.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      91.7    1e-18   
ref|XP_002887573.1|  At1g75080/F9E10_7                                91.7    1e-18   
ref|XP_010503740.1|  PREDICTED: BES1/BZR1 homolog protein 1-like      91.3    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009594614.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      91.7    2e-18   Nicotiana tomentosiformis
ref|XP_009781919.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  91.7    2e-18   Nicotiana sylvestris
ref|NP_565099.1|  brassinazole-resistant 1 protein                    91.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAL57684.1|  At1g75080/F9E10_7                                     91.7    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007223253.1|  hypothetical protein PRUPE_ppa009388mg           91.3    2e-18   Prunus persica
ref|XP_008444689.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  91.3    2e-18   Cucumis melo [Oriental melon]
ref|XP_004152709.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  91.3    2e-18   
ref|XP_007160782.1|  hypothetical protein PHAVU_001G016100g           91.3    2e-18   Phaseolus vulgaris [French bean]
gb|EPS60905.1|  hypothetical protein M569_13896                       91.3    2e-18   Genlisea aurea
emb|CDX72603.1|  BnaC07g46250D                                        91.3    2e-18   
gb|KHN20997.1|  Protein BRASSINAZOLE-RESISTANT 1                      91.3    2e-18   
ref|XP_003544426.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  91.3    2e-18   
emb|CAB16821.1|  putative protein                                     89.4    2e-18   
gb|KFK41947.1|  hypothetical protein AALP_AA2G192600                  91.3    2e-18   
ref|XP_006601311.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  91.3    2e-18   
ref|XP_006390354.1|  hypothetical protein EUTSA_v10018835mg           91.3    2e-18   
ref|XP_009104725.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      91.3    2e-18   
emb|CDX68150.1|  BnaA07g21900D                                        91.3    2e-18   
ref|XP_010437306.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      91.3    2e-18   
ref|XP_010446744.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      91.3    2e-18   
ref|XP_010432137.1|  PREDICTED: BES1/BZR1 homolog protein 2           91.3    2e-18   
ref|XP_009106166.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      90.9    2e-18   
emb|CDX69246.1|  BnaC01g02070D                                        90.9    2e-18   
ref|XP_010060920.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  90.9    3e-18   
ref|XP_004233505.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      90.9    3e-18   
ref|XP_010106032.1|  hypothetical protein L484_021209                 90.9    3e-18   
ref|XP_006596113.1|  PREDICTED: uncharacterized protein LOC100812053  90.5    3e-18   
ref|XP_010412706.1|  PREDICTED: BES1/BZR1 homolog protein 1-like      89.7    3e-18   
ref|XP_006856104.1|  hypothetical protein AMTR_s00059p00136790        87.8    4e-18   
ref|XP_009365607.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      90.1    4e-18   
ref|XP_006658737.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      90.1    4e-18   
gb|AAM64408.1|  unknown                                               90.1    5e-18   
gb|KHN22271.1|  Protein BRASSINAZOLE-RESISTANT 1                      90.1    5e-18   
ref|NP_564081.1|  protein brassinazole-resistant 2                    90.1    5e-18   
ref|XP_002890330.1|  bri1-ems-suppressor 1                            90.1    5e-18   
ref|XP_010498349.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  90.1    5e-18   
gb|AAF22161.1|AF134217_1  107 protein                                 90.1    5e-18   
ref|XP_010459601.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2      90.1    5e-18   
ref|XP_010477145.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  90.1    6e-18   
ref|XP_009110278.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  89.7    6e-18   
emb|CDX83768.1|  BnaC08g18770D                                        90.1    6e-18   
ref|NP_973863.1|  protein brassinazole-resistant 2                    90.1    6e-18   
emb|CDX96665.1|  BnaA08g22080D                                        89.7    6e-18   
gb|AFK41936.1|  unknown                                               86.7    7e-18   
ref|XP_003528182.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  89.7    7e-18   
ref|XP_006416513.1|  hypothetical protein EUTSA_v10008172mg           89.4    8e-18   
gb|KHN32496.1|  Protein argonaute 4                                   89.7    8e-18   
ref|XP_009767052.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  89.4    9e-18   
ref|XP_006346930.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      89.4    9e-18   
gb|AFG30995.1|  BES1                                                  89.4    9e-18   
gb|EMT13476.1|  hypothetical protein F775_16100                       89.4    1e-17   
ref|XP_003523854.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  89.4    1e-17   
dbj|BAJ85589.1|  predicted protein                                    89.4    1e-17   
ref|XP_006305153.1|  hypothetical protein CARUB_v10009520mg           89.4    1e-17   
gb|EPS60133.1|  hypothetical protein M569_14671                       89.0    1e-17   
gb|ACU23266.1|  unknown                                               88.2    1e-17   
ref|XP_009364430.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  89.0    1e-17   
ref|XP_008377432.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      89.0    1e-17   
ref|XP_003562829.1|  PREDICTED: protein BZR1 homolog 1-like           89.0    1e-17   
ref|XP_010095295.1|  hypothetical protein L484_014637                 89.0    1e-17   
ref|XP_011031482.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      88.6    1e-17   
ref|XP_009149416.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2      88.6    2e-17   
gb|AGJ98226.1|  BES-like transcription factor BEH2                    88.2    2e-17   
ref|XP_002453576.1|  hypothetical protein SORBIDRAFT_04g008380        89.4    2e-17   
ref|XP_007136574.1|  hypothetical protein PHAVU_009G056400g           88.2    2e-17   
emb|CDY26676.1|  BnaA06g13460D                                        88.2    2e-17   
ref|XP_006375071.1|  brassinazole-resistant 2 family protein          88.2    2e-17   
ref|XP_009587721.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  88.2    3e-17   
ref|NP_001168185.1|  hypothetical protein                             88.6    3e-17   
emb|CDX81925.1|  BnaC08g36760D                                        87.8    3e-17   
gb|ACJ84321.1|  unknown                                               87.8    3e-17   
emb|CDY69925.1|  BnaAnng32010D                                        87.4    4e-17   
ref|XP_004291900.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      87.4    4e-17   
ref|XP_004501038.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  87.4    4e-17   
emb|CDY21670.1|  BnaA09g44210D                                        88.2    4e-17   
ref|XP_011074506.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1 ...  87.4    5e-17   
ref|XP_011017294.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  87.0    5e-17   
ref|XP_009117543.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  87.0    5e-17   
ref|XP_002301217.1|  brassinazole-resistant 2 family protein          87.0    5e-17   
tpg|DAA41222.1|  TPA: hypothetical protein ZEAMMB73_149703            87.0    6e-17   
emb|CDX73140.1|  BnaC06g35880D                                        86.7    6e-17   
tpg|DAA52958.1|  TPA: hypothetical protein ZEAMMB73_916860            83.6    1e-16   
gb|EAZ22344.1|  hypothetical protein OsJ_05997                        85.5    1e-16   
ref|XP_008377452.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  85.5    1e-16   
ref|XP_010684125.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  85.5    2e-16   
ref|XP_008377342.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  85.5    2e-16   
ref|XP_002468545.1|  hypothetical protein SORBIDRAFT_01g047720        86.7    2e-16   
gb|EYU32803.1|  hypothetical protein MIMGU_mgv1a009986mg              85.5    2e-16   
gb|ACU18252.1|  unknown                                               84.7    4e-16   
gb|EPS68364.1|  hypothetical protein M569_06407                       84.0    7e-16   
gb|AGT17385.1|  hypothetical protein SHCRBa_176_L06_F_70              80.5    2e-15   
gb|AAG51929.1|AC013258_23  unknown protein; 17658-16304               82.0    3e-15   
ref|XP_006648481.1|  PREDICTED: LOW QUALITY PROTEIN: BES1/BZR1 ho...  80.9    5e-15   
ref|XP_002453577.1|  hypothetical protein SORBIDRAFT_04g008400        81.6    8e-15   
ref|XP_006429487.1|  hypothetical protein CICLE_v10013546mg           78.6    1e-14   
gb|KDO63263.1|  hypothetical protein CISIN_1g043700mg                 78.6    2e-14   
ref|XP_008679813.1|  PREDICTED: protein BZR1 homolog 4                79.0    3e-14   
ref|XP_002991405.1|  hypothetical protein SELMODRAFT_429765           79.3    3e-14   
gb|KEH40099.1|  brassinazole-resistant 1 protein                      77.4    7e-14   
gb|AFW65979.1|  hypothetical protein ZEAMMB73_636175                  79.0    1e-13   
ref|XP_009609992.1|  PREDICTED: BES1/BZR1 homolog protein 3-like      74.7    1e-13   
ref|XP_009797386.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  75.9    2e-13   
ref|XP_009795965.1|  PREDICTED: uncharacterized protein LOC104242587  75.5    2e-13   
ref|XP_007026585.1|  Brassinosteroid signaling positive regulator...  75.1    2e-13   
ref|XP_006829668.1|  hypothetical protein AMTR_s00122p00129760        75.1    3e-13   
gb|KDP22831.1|  hypothetical protein JCGZ_00418                       73.2    7e-13   
ref|XP_008645603.1|  PREDICTED: protein BZR1 homolog 4-like           75.9    8e-13   
ref|XP_010653393.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      72.8    9e-13   
ref|XP_001768561.1|  predicted protein                                76.6    1e-12   
ref|XP_010930840.1|  PREDICTED: protein BZR1 homolog 2-like           72.4    1e-12   
ref|XP_010677019.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  72.4    2e-12   
ref|XP_001760271.1|  predicted protein                                75.5    2e-12   
ref|XP_011095225.1|  PREDICTED: beta-amylase 7-like                   70.1    1e-11   
ref|XP_002323613.1|  hypothetical protein POPTR_0016s13350g           69.7    1e-11   
emb|CDP06431.1|  unnamed protein product                              70.1    1e-11   
ref|XP_010327721.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  68.2    6e-11   
gb|EYU41957.1|  hypothetical protein MIMGU_mgv1a026686mg              67.4    9e-11   
ref|XP_008786570.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  67.4    1e-10   
gb|KJB77048.1|  hypothetical protein B456_012G118900                  67.4    1e-10   
ref|XP_011046810.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  67.0    1e-10   
ref|XP_008451866.1|  PREDICTED: beta-amylase 8                        68.2    6e-10   
gb|KGN53462.1|  hypothetical protein Csa_4G056530                     68.2    6e-10   
ref|XP_004512346.1|  PREDICTED: beta-amylase 8-like                   66.6    2e-09   
ref|XP_007210828.1|  hypothetical protein PRUPE_ppa019231mg           66.2    3e-09   
ref|XP_003534334.1|  PREDICTED: beta-amylase 8-like                   65.9    3e-09   
ref|XP_008238070.1|  PREDICTED: beta-amylase 8                        66.2    3e-09   
ref|XP_009365721.1|  PREDICTED: beta-amylase 8                        65.9    3e-09   
ref|XP_002519919.1|  Beta-amylase, putative                           65.9    4e-09   
ref|XP_004150546.1|  PREDICTED: beta-amylase 8-like                   65.9    4e-09   
ref|XP_009398814.1|  PREDICTED: protein BZR1 homolog 1-like           62.8    4e-09   
ref|XP_008373437.1|  PREDICTED: beta-amylase 8                        65.5    4e-09   
gb|KDP28061.1|  hypothetical protein JCGZ_19469                       65.5    5e-09   
ref|XP_002270680.1|  PREDICTED: beta-amylase 8                        65.1    6e-09   
ref|XP_003612541.1|  Beta-amylase                                     65.1    6e-09   
ref|XP_010054915.1|  PREDICTED: beta-amylase 8                        65.1    6e-09   
ref|XP_007158095.1|  hypothetical protein PHAVU_002G123700g           65.1    6e-09   
gb|KHN41758.1|  Beta-amylase 8                                        64.3    1e-08   
ref|XP_010275178.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase 8   64.3    1e-08   
ref|XP_003516502.1|  PREDICTED: beta-amylase 8-like isoform X1        63.9    2e-08   
ref|XP_008803967.1|  PREDICTED: beta-amylase 8-like isoform X2        63.2    2e-08   
ref|XP_008803966.1|  PREDICTED: beta-amylase 8-like isoform X1        63.2    2e-08   
gb|AES95500.2|  beta-amylase-like protein                             63.2    2e-08   
ref|XP_001764738.1|  predicted protein                                63.5    2e-08   
ref|XP_003612542.1|  Beta-amylase                                     62.8    3e-08   
emb|CBI29216.3|  unnamed protein product                              62.8    3e-08   
gb|KJB51475.1|  hypothetical protein B456_008G218300                  62.8    3e-08   
ref|XP_010941426.1|  PREDICTED: uncharacterized protein LOC105059706  62.8    3e-08   
gb|KJB51478.1|  hypothetical protein B456_008G218300                  62.8    4e-08   
ref|XP_011465289.1|  PREDICTED: beta-amylase 8                        62.8    4e-08   
gb|KHG17783.1|  Beta-amylase 8 -like protein                          62.4    4e-08   
gb|KJB51477.1|  hypothetical protein B456_008G218300                  62.4    4e-08   
ref|NP_199343.1|  beta-amylase 2                                      62.4    4e-08   
ref|NP_001032014.1|  beta-amylase 2                                   62.4    5e-08   
ref|XP_002973760.1|  hypothetical protein SELMODRAFT_414095           61.6    5e-08   
ref|XP_001771848.1|  predicted protein                                62.0    6e-08   
ref|XP_002975808.1|  hypothetical protein SELMODRAFT_415870           61.6    6e-08   
ref|XP_006846017.1|  hypothetical protein AMTR_s00155p00073540        60.8    6e-08   
ref|XP_009384530.1|  PREDICTED: beta-amylase 8                        62.0    7e-08   
ref|XP_010232995.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      59.3    7e-08   
ref|XP_006432890.1|  hypothetical protein CICLE_v10000490mg           62.0    7e-08   
gb|KDO77946.1|  hypothetical protein CISIN_1g020318mg                 60.5    7e-08   
gb|KDO43644.1|  hypothetical protein CISIN_1g005715mg                 61.6    7e-08   
ref|XP_006432891.1|  hypothetical protein CICLE_v10000490mg           61.6    7e-08   
ref|XP_011027980.1|  PREDICTED: beta-amylase 8 isoform X2             61.6    7e-08   
ref|XP_011027979.1|  PREDICTED: beta-amylase 8 isoform X1             61.6    7e-08   
gb|AFQ33619.1|  beta-amylase 7                                        61.6    7e-08   
gb|KDO43643.1|  hypothetical protein CISIN_1g005715mg                 61.6    8e-08   
ref|XP_007040897.1|  Beta-amylase 2                                   61.6    8e-08   
ref|XP_010324505.1|  PREDICTED: beta-amylase 8 isoform X5             61.6    8e-08   
ref|XP_010324502.1|  PREDICTED: beta-amylase 8 isoform X1             61.6    8e-08   
ref|XP_002304400.1|  hypothetical protein POPTR_0003s10570g           61.6    8e-08   
ref|XP_004244442.1|  PREDICTED: beta-amylase 8 isoform X2             61.6    8e-08   
ref|XP_006878652.1|  hypothetical protein AMTR_s00011p00265640        61.6    9e-08   
ref|XP_011002765.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...  60.5    1e-07   
ref|XP_010529274.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase 8   61.2    1e-07   
ref|XP_010676684.1|  PREDICTED: beta-amylase 8                        61.2    1e-07   
ref|XP_006398198.1|  hypothetical protein EUTSA_v10001222mg           61.2    1e-07   
ref|XP_011082155.1|  PREDICTED: beta-amylase 8 isoform X1             61.2    1e-07   
gb|EPS74220.1|  hypothetical protein M569_00539                       57.4    1e-07   
ref|XP_010910608.1|  PREDICTED: beta-amylase 8                        60.8    1e-07   
ref|XP_002865252.1|  hypothetical protein ARALYDRAFT_356484           60.8    1e-07   
dbj|BAD67816.1|  hypothetical protein                                 58.2    2e-07   
gb|KFK31578.1|  hypothetical protein AALP_AA6G130300                  60.8    2e-07   
gb|KJB51476.1|  hypothetical protein B456_008G218300                  60.8    2e-07   
gb|KFK31577.1|  hypothetical protein AALP_AA6G130300                  60.8    2e-07   
ref|XP_006279583.1|  hypothetical protein CARUB_v10025996mg           60.8    2e-07   
ref|XP_010481609.1|  PREDICTED: beta-amylase 8-like                   60.8    2e-07   
gb|KDO43646.1|  hypothetical protein CISIN_1g005715mg                 60.5    2e-07   
ref|XP_010441757.1|  PREDICTED: beta-amylase 8-like                   60.5    2e-07   
ref|XP_010494622.1|  PREDICTED: beta-amylase 8                        60.5    2e-07   
ref|XP_009589916.1|  PREDICTED: beta-amylase 8                        60.5    2e-07   
ref|XP_011038890.1|  PREDICTED: BES1/BZR1 homolog protein 4-like      58.9    2e-07   
gb|EEE53973.1|  hypothetical protein OsJ_00591                        58.2    2e-07   
ref|XP_002979060.1|  hypothetical protein SELMODRAFT_418727           59.7    3e-07   
ref|XP_009769112.1|  PREDICTED: beta-amylase 8                        60.1    3e-07   
gb|KDO43645.1|  hypothetical protein CISIN_1g005715mg                 60.1    3e-07   
ref|XP_006432889.1|  hypothetical protein CICLE_v10000490mg           60.1    3e-07   
ref|XP_011082156.1|  PREDICTED: beta-amylase 8 isoform X2             59.7    3e-07   
ref|XP_002298893.2|  hypothetical protein POPTR_0001s38140g           58.2    3e-07   
ref|XP_010324503.1|  PREDICTED: beta-amylase 8 isoform X3             59.3    4e-07   
ref|XP_010324504.1|  PREDICTED: beta-amylase 8 isoform X4             59.3    4e-07   
ref|XP_010105162.1|  Beta-amylase 8                                   59.3    5e-07   
ref|XP_006361593.1|  PREDICTED: beta-amylase 8-like                   59.3    5e-07   
ref|XP_010241187.1|  PREDICTED: protein BZR1 homolog 3-like           58.2    5e-07   
emb|CDX87798.1|  BnaC02g31510D                                        59.3    5e-07   
ref|XP_008225589.1|  PREDICTED: BES1/BZR1 homolog protein 4-like      56.6    6e-07   
ref|XP_002455083.1|  hypothetical protein SORBIDRAFT_03g004070        56.6    7e-07   
emb|CDY69112.1|  BnaA02g36650D                                        58.9    7e-07   
ref|XP_006442379.1|  hypothetical protein CICLE_v10021151mg           58.2    7e-07   
ref|XP_006377531.1|  hypothetical protein POPTR_0011s06800g           57.8    8e-07   
ref|XP_009128781.1|  PREDICTED: beta-amylase 8                        58.5    9e-07   
ref|XP_011096676.1|  PREDICTED: BES1/BZR1 homolog protein 4-like      56.6    9e-07   
gb|EYU37446.1|  hypothetical protein MIMGU_mgv1a002385mg              58.2    1e-06   
ref|XP_006295619.1|  hypothetical protein CARUB_v10024732mg           54.3    1e-06   
emb|CDM81910.1|  unnamed protein product                              55.8    1e-06   
ref|XP_006468299.1|  PREDICTED: beta-amylase 7-like isoform X1        56.6    1e-06   
ref|XP_008808792.1|  PREDICTED: beta-amylase 8 isoform X1             57.8    1e-06   
ref|XP_006448917.1|  hypothetical protein CICLE_v10017778mg           56.6    1e-06   
ref|XP_004295606.1|  PREDICTED: protein BZR1 homolog 2-like           55.5    1e-06   
ref|XP_008808793.1|  PREDICTED: beta-amylase 8 isoform X2             57.8    2e-06   
gb|KDP34937.1|  hypothetical protein JCGZ_09225                       56.2    2e-06   
ref|XP_008383467.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      55.1    2e-06   
emb|CBI30731.3|  unnamed protein product                              54.7    3e-06   
gb|EYU19128.1|  hypothetical protein MIMGU_mgv1a013909mg              55.5    3e-06   
ref|XP_009344419.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  54.7    3e-06   
ref|NP_001045777.1|  Os02g0129600                                     56.2    4e-06   
ref|XP_003632998.2|  PREDICTED: protein BZR1 homolog 3-like           55.1    4e-06   
ref|XP_002523196.1|  BRASSINAZOLE-RESISTANT 1 protein, putative       55.5    4e-06   
ref|XP_004971713.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  53.9    6e-06   
ref|XP_007212847.1|  hypothetical protein PRUPE_ppa020974mg           53.9    6e-06   



>gb|AEA86340.1| BES1/BZR1-like protein [Solanum nigrum]
Length=174

 Score =   180 bits (456),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 152/171 (89%), Positives = 155/171 (91%), Gaps = 1/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTYRKGCKP ERMDI G SVSVSPCSSYQ S G SYNPSP SSS PSPVSS Y
Sbjct  61   WIVEEDGTTYRKGCKPVERMDI-GGSVSVSPCSSYQLSPGASYNPSPVSSSIPSPVSSHY  119

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + N  N++DPNSLIPWL NLSSGSS SSSK PHHL IPGGSISAPVTPPLS
Sbjct  120  VANVQNNSDPNSLIPWLKNLSSGSSSSSSKFPHHLCIPGGSISAPVTPPLS  170



>ref|XP_009590977.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana tomentosiformis]
Length=324

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLP+WKERENNKRRERRRRAIAAKIFAGLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPSWKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTY+KGCKP ERMDI+G S SV+PCSSYQPS G SYNPSPASSSFPSPVSS Y
Sbjct  61   WIVEEDGTTYKKGCKPVERMDIIGYSASVNPCSSYQPSPGASYNPSPASSSFPSPVSSHY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + N  N++DPNSLIPWL NLSSGSSPSSSK PHHLYIPG SISAPVTPPLS
Sbjct  121  VANTQNNSDPNSLIPWLKNLSSGSSPSSSKFPHHLYIPGSSISAPVTPPLS  171



>ref|XP_011101448.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Sesamum indicum]
Length=325

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 155/171 (91%), Gaps = 1/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTYRKGCKP ERMDI+G S +VSPCSSYQPS G S+NPSPASSSF SPVSS +
Sbjct  61   WIVEEDGTTYRKGCKPVERMDIIG-SAAVSPCSSYQPSPGASFNPSPASSSFASPVSSHF  119

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              + NN  DPNSLIPWL NLSSGS P+SSK PHHLYIPGGSISAPVTPPLS
Sbjct  120  AASVNNTADPNSLIPWLKNLSSGSLPASSKFPHHLYIPGGSISAPVTPPLS  170



>gb|EYU28126.1| hypothetical protein MIMGU_mgv1a007967mg [Erythranthe guttata]
Length=328

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 155/172 (90%), Gaps = 2/172 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTYRKGCKP ERMDIMG S +VSPC+SYQPS G S+NPSP+SSSF SPVSS Y
Sbjct  61   WIVEEDGTTYRKGCKPVERMDIMG-SSAVSPCTSYQPSPGTSFNPSPSSSSFASPVSSHY  119

Query  485  ITNNNNDTDPNSLIPWLXNLssgssp-sssKLPHHLYIPGGSISAPVTPPLS  637
            + N  N  DPNSLIPWL NLSSG +  SSSKLPHHLYIPGGSISAPVTPPLS
Sbjct  120  VGNATNTADPNSLIPWLKNLSSGGTLPSSSKLPHHLYIPGGSISAPVTPPLS  171



>ref|XP_006358089.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006358090.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X4 [Solanum 
tuberosum]
Length=325

 Score =   178 bits (452),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 151/171 (88%), Positives = 156/171 (91%), Gaps = 1/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRQPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTYRKGCKP ERMDI G SVSVSPCSSYQ S G SYNPSP SSS PSP+SS Y
Sbjct  61   WIVEEDGTTYRKGCKPVERMDI-GGSVSVSPCSSYQLSPGASYNPSPVSSSIPSPISSHY  119

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            ++N  N++DPNSLIPWL NLSSGSSPSSSK PHHL IPGGSISAPVTPPLS
Sbjct  120  VSNVQNNSDPNSLIPWLKNLSSGSSPSSSKFPHHLCIPGGSISAPVTPPLS  170



>gb|EYU28125.1| hypothetical protein MIMGU_mgv1a007967mg [Erythranthe guttata]
Length=389

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 148/172 (86%), Positives = 155/172 (90%), Gaps = 2/172 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  53   MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  112

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTYRKGCKP ERMDIMG S +VSPC+SYQPS G S+NPSP+SSSF SPVSS Y
Sbjct  113  WIVEEDGTTYRKGCKPVERMDIMG-SSAVSPCTSYQPSPGTSFNPSPSSSSFASPVSSHY  171

Query  485  ITNNNNDTDPNSLIPWLXNLssgssp-sssKLPHHLYIPGGSISAPVTPPLS  637
            + N  N  DPNSLIPWL NLSSG +  SSSKLPHHLYIPGGSISAPVTPPLS
Sbjct  172  VGNATNTADPNSLIPWLKNLSSGGTLPSSSKLPHHLYIPGGSISAPVTPPLS  223



>ref|XP_009785426.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana sylvestris]
Length=323

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLP+WKERENNKRRERRRRAIAAKIFAGLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPSWKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTY+KGCKP +RMD +  S SVSPCSSYQPS G SYNPSPASSSFPSPVSS Y
Sbjct  61   WIVEEDGTTYKKGCKPVQRMDNICYSASVSPCSSYQPSPGASYNPSPASSSFPSPVSSHY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            I N  N+TDPNSLIPWL NLSSGSSPSSSK PHHLYIPG SISAPVTPPLS
Sbjct  121  IANAQNNTDPNSLIPWLKNLSSGSSPSSSKFPHHLYIPGSSISAPVTPPLS  171



>ref|XP_004234074.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Solanum lycopersicum]
 ref|XP_004234075.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Solanum lycopersicum]
 ref|XP_006356092.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356093.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Solanum 
tuberosum]
Length=323

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTY+KGCKP   +DI+G S SVSPCSSYQPS G SYNPSPASSSFPSPVSS Y
Sbjct  61   WIVEEDGTTYKKGCKPVGHVDIIGYSASVSPCSSYQPSPGASYNPSPASSSFPSPVSSNY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + N  N+ DPN+LIPWL NLSSGSSPSSS+ PHHLYIPG SISAPVTPPLS
Sbjct  121  VANVQNNHDPNTLIPWLKNLSSGSSPSSSRFPHHLYIPGSSISAPVTPPLS  171



>ref|XP_009607196.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009607197.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=326

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE+DGTTYRKGCKP   MDI+G S SVSPCSSYQ S G SYNPSPASSS PSPVSS Y
Sbjct  61   WIVEDDGTTYRKGCKPVHHMDIIGGSASVSPCSSYQLSPGASYNPSPASSSIPSPVSSHY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            I N  N++DPNSLIPWL NLSSGSSPSSSK PHHL IPG SISAPVTPP S
Sbjct  121  IANVQNNSDPNSLIPWLKNLSSGSSPSSSKFPHHLCIPGDSISAPVTPPSS  171



>ref|XP_010242162.1| PREDICTED: BES1/BZR1 homolog protein 4 [Nelumbo nucifera]
Length=327

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMD++G S S SPCSSYQPS   SYNPSPA+SSFPSP SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVERMDVVGGSASASPCSSYQPSPCASYNPSPATSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N + D NSLIPWL NLSS SS +SSKLPHHLYI GGSISAPVTPPLS
Sbjct  121  AANANANGDGNSLIPWLKNLSSVSSSASSKLPHHLYITGGSISAPVTPPLS  171



>ref|XP_006358087.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006358088.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Solanum 
tuberosum]
Length=326

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 156/172 (91%), Gaps = 2/172 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRQPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRK-GCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVEEDGTTYRK GCKP ERMDI G SVSVSPCSSYQ S G SYNPSP SSS PSP+SS 
Sbjct  61   WIVEEDGTTYRKQGCKPVERMDI-GGSVSVSPCSSYQLSPGASYNPSPVSSSIPSPISSH  119

Query  482  YITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            Y++N  N++DPNSLIPWL NLSSGSSPSSSK PHHL IPGGSISAPVTPPLS
Sbjct  120  YVSNVQNNSDPNSLIPWLKNLSSGSSPSSSKFPHHLCIPGGSISAPVTPPLS  171



>ref|XP_009800423.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009800424.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Nicotiana 
sylvestris]
Length=326

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE+DGTTYRKGCKP   MDI+G S SVSPCSSYQ S G SYNPSPASSS PSPVSS Y
Sbjct  61   WIVEDDGTTYRKGCKPVHHMDIIGGSASVSPCSSYQLSPGASYNPSPASSSIPSPVSSHY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            I N  N++DPNSLIPWL NLSSGSSPSSS  PHHL IPG S+SAPVTPP S
Sbjct  121  IANVQNNSDPNSLIPWLKNLSSGSSPSSSNFPHHLCIPGDSVSAPVTPPSS  171



>ref|XP_011033513.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011033514.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Populus 
euphratica]
 ref|XP_011010915.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011010916.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Populus 
euphratica]
Length=331

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMDIMG S S SPCSSY  S   SYNPSPASSSFPSPVSS Y
Sbjct  61   WTVEEDGTTYRKGCKPVERMDIMGGSASASPCSSYHRSPCASYNPSPASSSFPSPVSSHY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N + DPNSLIPWL NLSSGSS +S K PHHL+I  GSISAPVTPPLS
Sbjct  121  AANANGNADPNSLIPWLKNLSSGSSSASPKHPHHLFIHTGSISAPVTPPLS  171



>ref|XP_002305719.1| hypothetical protein POPTR_0004s06100g [Populus trichocarpa]
 gb|EEE86230.1| hypothetical protein POPTR_0004s06100g [Populus trichocarpa]
Length=331

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMDIMG S S SPCSSY  S   SYNPSPASSSFPSPVSS Y
Sbjct  61   WTVEEDGTTYRKGCKPVERMDIMGGSASASPCSSYHRSPCASYNPSPASSSFPSPVSSHY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N + DPNSLIPWL NLSSGSS +S K PHHL+I  GSISAPVTPPLS
Sbjct  121  AANANGNADPNSLIPWLKNLSSGSSSASPKHPHHLFIHTGSISAPVTPPLS  171



>emb|CDO96875.1| unnamed protein product [Coffea canephora]
Length=295

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W+VEEDGTTYRKGCKP ERMDI+G S ++SPCSSYQPS G SYNPSP+SSSFPSPVSS Y
Sbjct  61   WVVEEDGTTYRKGCKPAERMDIIGGSATMSPCSSYQPSPGVSYNPSPSSSSFPSPVSSHY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAP  619
              N N   D NSLIPWL NLSSGSSP+SSKLPHH+YIPGGSISAP
Sbjct  121  AANANGSADANSLIPWLKNLSSGSSPASSKLPHHIYIPGGSISAP  165



>ref|XP_007025289.1| BES1/BZR1 [Theobroma cacao]
 gb|EOY27911.1| BES1/BZR1 [Theobroma cacao]
Length=327

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP +RMDI+G S S SPCSSY PS   SYNPSPASSSFPSP SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVDRMDIVGGSASASPCSSYHPSPCASYNPSPASSSFPSPASSHY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             +N N + D NSLIPWL NL+S SS +SSKL HHLYI GGSISAPVTPPLS
Sbjct  121  TSNANGNGDANSLIPWLKNLTSSSSSASSKLAHHLYIAGGSISAPVTPPLS  171



>ref|XP_004233053.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X3 [Solanum lycopersicum]
 ref|XP_010316857.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Solanum lycopersicum]
Length=324

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 146/171 (85%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTYRKGCKP  R+DI G        SSYQ S G SYNPSP SSS PSPVSS Y
Sbjct  61   WIVEEDGTTYRKGCKPVTRIDIGG--SVSVSSSSYQLSPGASYNPSPVSSSIPSPVSSHY  118

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + N  N++DPNSLIPWL NLSSGSSPS S  PHHL IPGGSISAPVTPPLS
Sbjct  119  VANVQNNSDPNSLIPWLKNLSSGSSPSLSNFPHHLCIPGGSISAPVTPPLS  169



>ref|XP_002522271.1| BRASSINAZOLE-RESISTANT 2 protein, putative [Ricinus communis]
 gb|EEF40129.1| BRASSINAZOLE-RESISTANT 2 protein, putative [Ricinus communis]
Length=331

 Score =   171 bits (433),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 144/171 (84%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MT+GTR+PTWKERENNKRRERRRRAIAAKI+AGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTAGTRMPTWKERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMDIMG S S SPCSSY PS   SYNPSP SSSFPSPVSSRY
Sbjct  61   WTVEEDGTTYRKGCKPVERMDIMGGSASASPCSSYHPSPCASYNPSPGSSSFPSPVSSRY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N + D NSLIPWL NLSSGSS +SSK PHHLYI  GSISAPVTPPLS
Sbjct  121  TANTNGNADANSLIPWLKNLSSGSSSASSKHPHHLYIHTGSISAPVTPPLS  171



>gb|KDP21147.1| hypothetical protein JCGZ_21618 [Jatropha curcas]
Length=331

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKI+AGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMDIMG S S SPCSSY PS   SYNPSP SSSFPSPVSSRY
Sbjct  61   WTVEEDGTTYRKGCKPMERMDIMGGSASASPCSSYHPSPCASYNPSPGSSSFPSPVSSRY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N + D NSLIPWL NLSSGSS +SSK PHHLYI  GSISAPVTPPLS
Sbjct  121  TANTNGNPDANSLIPWLKNLSSGSSSASSKHPHHLYIHTGSISAPVTPPLS  171



>ref|XP_010052157.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010052158.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Eucalyptus 
grandis]
 gb|KCW76060.1| hypothetical protein EUGRSUZ_D00428 [Eucalyptus grandis]
Length=320

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 150/171 (88%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGC+P ERMDIMG S S SPCSSY PS   SYNPSPASSSFPSP  S Y
Sbjct  61   WTVEEDGTTYRKGCRPLERMDIMGGSTSASPCSSYHPSPCASYNPSPASSSFPSPARSPY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              + + + D +SLIPWL NLSSGSS +SSKLPHHL+IPGGSISAPVTPPLS
Sbjct  121  PGHPHGNPDADSLIPWLKNLSSGSSSASSKLPHHLFIPGGSISAPVTPPLS  171



>gb|KJB68362.1| hypothetical protein B456_010G240700 [Gossypium raimondii]
Length=269

 Score =   167 bits (424),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTY+KGCKP +RMDI+G S S SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYKKGCKPVDRMDILGGSASASPCSSYHPSPCASYNPSPGSSSFPSPASSHY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N + D NSLIPWL NLSSGSS +SSKL HHLY  GGSISAPVTPPLS
Sbjct  121  RANGNGNADANSLIPWLKNLSSGSSSASSKLAHHLYFAGGSISAPVTPPLS  171



>gb|KHG20428.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=322

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTY+KGCKP +RMDI+G S S S CSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYKKGCKPVDRMDILGGSASASRCSSYHPSPCASYNPSPGSSSFPSPASSHY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N + D NSLIPWL NLSSGSS +SSKL HHLY  GGSISAPVTPPLS
Sbjct  121  RANGNGNADANSLIPWLKNLSSGSSSASSKLAHHLYFAGGSISAPVTPPLS  171



>gb|KJB68361.1| hypothetical protein B456_010G240700 [Gossypium raimondii]
Length=322

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 141/171 (82%), Positives = 147/171 (86%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTY+KGCKP +RMDI+G S S SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYKKGCKPVDRMDILGGSASASPCSSYHPSPCASYNPSPGSSSFPSPASSHY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N + D NSLIPWL NLSSGSS +SSKL HHLY  GGSISAPVTPPLS
Sbjct  121  RANGNGNADANSLIPWLKNLSSGSSSASSKLAHHLYFAGGSISAPVTPPLS  171



>ref|XP_010316856.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Solanum lycopersicum]
Length=325

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 146/172 (85%), Gaps = 3/172 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRK-GCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVEEDGTTYRK GCKP  R+DI G        SSYQ S G SYNPSP SSS PSPVSS 
Sbjct  61   WIVEEDGTTYRKQGCKPVTRIDIGG--SVSVSSSSYQLSPGASYNPSPVSSSIPSPVSSH  118

Query  482  YITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            Y+ N  N++DPNSLIPWL NLSSGSSPS S  PHHL IPGGSISAPVTPPLS
Sbjct  119  YVANVQNNSDPNSLIPWLKNLSSGSSPSLSNFPHHLCIPGGSISAPVTPPLS  170



>ref|XP_006449559.1| hypothetical protein CICLE_v10015910mg [Citrus clementina]
 ref|XP_006467592.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006467593.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Citrus 
sinensis]
 gb|ESR62799.1| hypothetical protein CICLE_v10015910mg [Citrus clementina]
 gb|KDO77944.1| hypothetical protein CISIN_1g020318mg [Citrus sinensis]
 gb|KDO77945.1| hypothetical protein CISIN_1g020318mg [Citrus sinensis]
Length=327

 Score =   164 bits (414),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKER+NNKRRERRRRAIAAKI+AGLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERDNNKRRERRRRAIAAKIYAGLRMYGNYRLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP E MD+MG S S S CSSYQ S   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVEYMDVMGGSASASACSSYQQSPCASYNPSPGSSSFPSPRSSHY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              + N   D NSLIPWL NLSS SS +SSK PHH+YI GGSISAPVTPPLS
Sbjct  121  TPHANGSADANSLIPWLKNLSSSSSSASSKDPHHMYIHGGSISAPVTPPLS  171



>ref|XP_011039378.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Populus euphratica]
Length=333

 Score =   163 bits (413),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 148/173 (86%), Gaps = 2/173 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKI+AGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMDI G S S SPCSSY+ S   SYNPSPASSSFPSPVSSRY
Sbjct  61   WTVEEDGTTYRKGCKPVERMDITGGSASASPCSSYRQSPCASYNPSPASSSFPSPVSSRY  120

Query  485  ITNNNN--DTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N   D D NSLIPWL NLSSGSS +S K P+HL+I  GSISAPVTPPLS
Sbjct  121  AANGNGNVDADANSLIPWLRNLSSGSSSASPKHPNHLFIHTGSISAPVTPPLS  173



>gb|EPS61611.1| hypothetical protein M569_13185 [Genlisea aurea]
Length=307

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 125/171 (73%), Gaps = 16/171 (9%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTS TRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSSTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCHEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE+DGTTYRKGCKP ER+DI+    S  P SS   S     +                
Sbjct  61   WIVEDDGTTYRKGCKPVERVDIITPCSSYPPSSSGTSSFASPVSS---------------  105

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             T   + TDPNSLIPWL NLSS S P  SK PH LYIPGGSISAP+TPPLS
Sbjct  106  -TIPKHSTDPNSLIPWLKNLSSSSIPVPSKRPHQLYIPGGSISAPITPPLS  155



>ref|XP_004147390.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 ref|XP_004172293.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 gb|KGN65601.1| hypothetical protein Csa_1G467200 [Cucumis sativus]
Length=327

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIF GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFLGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ER +IMG S S SPCSSYQPS   SYNPSPASSSFPSP SSRY
Sbjct  61   WTVEEDGTTYRKGCKPVER-NIMGGSASASPCSSYQPSPRASYNPSPASSSFPSPKSSRY  119

Query  485  ITN-NNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N+N TDPNSLIPWL NLSSGSS +SS+LPHHL+I  GSISAPVTPP S
Sbjct  120  AMNGNDNGTDPNSLIPWLKNLSSGSSSASSRLPHHLFINCGSISAPVTPPSS  171



>ref|XP_008443587.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
Length=327

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIF GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFLGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ER +IMG S S SPCSSYQPS   SYNPSPASSSFPSP SSRY
Sbjct  61   WTVEEDGTTYRKGCKPVER-NIMGGSASGSPCSSYQPSPRASYNPSPASSSFPSPKSSRY  119

Query  485  ITN-NNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N+N TDPNSLIPWL NLSSGSS +SS+LPHHL+I  GSISAPVTPP S
Sbjct  120  AMNSNDNGTDPNSLIPWLKNLSSGSSSASSRLPHHLFINCGSISAPVTPPSS  171



>gb|KJB69669.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
Length=213

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 143/171 (84%), Gaps = 8/171 (5%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP +RMDIMG S S SPC         SY+PSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVDRMDIMGGSASASPC--------SSYHPSPGSSSFPSPASSHY  112

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N + D NSLIPWL NLSSGSS +SSKL HHL+I GGSISAPVTPPLS
Sbjct  113  TANANGNADANSLIPWLKNLSSGSSSASSKLAHHLFIAGGSISAPVTPPLS  163



>gb|KJB69670.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
Length=285

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 143/171 (84%), Gaps = 8/171 (5%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP +RMDIMG S S SPC         SY+PSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVDRMDIMGGSASASPC--------SSYHPSPGSSSFPSPASSHY  112

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N + D NSLIPWL NLSSGSS +SSKL HHL+I GGSISAPVTPPLS
Sbjct  113  TANANGNADANSLIPWLKNLSSGSSSASSKLAHHLFIAGGSISAPVTPPLS  163



>gb|KHG25078.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=319

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 143/171 (84%), Gaps = 8/171 (5%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP +RMDIMG S S SPC         SY+PSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVDRMDIMGGSASASPC--------SSYHPSPGSSSFPSPASSHY  112

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N + D NSLIPWL NLSSGSS +SSKL HHL+I GGSISAPVTPPLS
Sbjct  113  TANANGNADANSLIPWLKNLSSGSSSASSKLAHHLFIAGGSISAPVTPPLS  163



>gb|KJB69668.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
 gb|KJB69671.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
Length=319

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 143/171 (84%), Gaps = 8/171 (5%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP +RMDIMG S S SPC         SY+PSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVDRMDIMGGSASASPC--------SSYHPSPGSSSFPSPASSHY  112

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N + D NSLIPWL NLSSGSS +SSKL HHL+I GGSISAPVTPPLS
Sbjct  113  TANANGNADANSLIPWLKNLSSGSSSASSKLAHHLFIAGGSISAPVTPPLS  163



>ref|XP_008371512.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
 ref|XP_009351745.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=331

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 139/177 (79%), Gaps = 7/177 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNK+RERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  2    MTSGTRMPTWKERENNKKRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCNEAG  61

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcss------yqpsqGpsynpspasssfps  466
            W VEEDGTTYRKGCKP +RMDIMG S S SPCSS         +  P  + +P+ +S   
Sbjct  62   WTVEEDGTTYRKGCKPVDRMDIMGGSTSASPCSSYQPSPCASYNPSPGASYNPSPASSSF  121

Query  467  pvssRYITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            P  +RY  N N + D NSLIPWL  LSSGSS ++SKLP  L++ GGSISAPVTPPLS
Sbjct  122  PSPARYPANGNGNADANSLIPWLKTLSSGSSSATSKLP-QLFVQGGSISAPVTPPLS  177



>ref|XP_009352718.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=331

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 134/177 (76%), Gaps = 7/177 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNK+RERR  A AAKI++GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  2    MTSGTRMPTWKERENNKKRERRGPATAAKIYSGLRMYGNYKLPKHCDNNEVLKALCNEAG  61

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcss------yqpsqGpsynpspasssfps  466
            W VEEDGTTYRKGCKP +RMDIMG S S SPCSS         +  P  + +P+ +S   
Sbjct  62   WTVEEDGTTYRKGCKPVDRMDIMGGSTSASPCSSYQPSPCASYNPSPGASYNPSPASSSF  121

Query  467  pvssRYITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            P  +RY  N N + D NSLIPWL  LSSGSS + SKLP   ++ GGSISAPVTPPLS
Sbjct  122  PSPARYHANENGNADANSLIPWLKTLSSGSSSAMSKLP-QFFVQGGSISAPVTPPLS  177



>ref|XP_008796066.1| PREDICTED: protein BZR1 homolog 3 [Phoenix dactylifera]
Length=338

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 133/175 (76%), Gaps = 4/175 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            M SGTRLPTW+ERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MPSGTRLPTWRERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsyn-pspasssfpspvssR  481
            W VEEDGTTYRKGCKP ERMD++    SVSP         P  +     +SS     SS 
Sbjct  61   WTVEEDGTTYRKGCKPVERMDVVAVGGSVSPSPCTSYQPSPRASYNPSPASSSFPSPSSS  120

Query  482  YITNNNNDTDPNSLIPWLXNL-ssgsspsssKL--PHHLYIPGGSISAPVTPPLS  637
            YITN    TD NSLIPWL NL S+ SS SSSKL  PHHL+I GGSISAPVTPPLS
Sbjct  121  YITNAYKGTDGNSLIPWLKNLSSASSSTSSSKLPNPHHLFIHGGSISAPVTPPLS  175



>ref|XP_008383594.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
Length=331

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 137/177 (77%), Gaps = 7/177 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNK+RERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  2    MTSGTRMPTWKERENNKKRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCNEAG  61

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcss------yqpsqGpsynpspasssfps  466
            W VEEDGTTYRKGCKP +RMDIMG S S SPCSS         +  P  + +P+ +S   
Sbjct  62   WTVEEDGTTYRKGCKPVDRMDIMGGSTSASPCSSYQPSPCASYNPSPGASYNPSPASSSF  121

Query  467  pvssRYITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            P  +RY  N N   D NSLIPWL  LSSGSS ++SKLP   ++ GGSISAPVTPPLS
Sbjct  122  PSPARYHANENGXADANSLIPWLKTLSSGSSSATSKLP-QFFVQGGSISAPVTPPLS  177



>ref|XP_010915465.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=343

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 149/177 (84%), Gaps = 6/177 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKI+AGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCK--PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvss  478
            W VE DGTTYRKGC   P ERMD++G SVS SPCSSYQPS   SYNPSPASSSFPSP SS
Sbjct  61   WTVESDGTTYRKGCNPPPAERMDVVGCSVSPSPCSSYQPSPRASYNPSPASSSFPSPASS  120

Query  479  RYITNNNND---TDPNSLIPWLXNLssgsspsssKLP-HHLYIPGGSISAPVTPPLS  637
             YITN NN     D  SLIPWL NLSS SS S+SK P HHLY+ GGSISAPVTPPLS
Sbjct  121  SYITNANNAISVADGKSLIPWLKNLSSVSSGSASKFPQHHLYMHGGSISAPVTPPLS  177



>ref|XP_007021866.1| BES1/BZR1 [Theobroma cacao]
 gb|EOY13391.1| BES1/BZR1 [Theobroma cacao]
Length=325

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 147/172 (85%), Gaps = 4/172 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRM+GNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMFGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S ++SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVESDGTTYRKGCKPVERMDIVGGSATMSPCSSYHPSPCASYNPSPVSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNL-ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + N N D   NSLIPWL NL S+ SS SSSKLP HLYI GGSISAPVTPPLS
Sbjct  121  VVNPNGDG--NSLIPWLKNLSSASSSASSSKLP-HLYIHGGSISAPVTPPLS  169



>ref|XP_008451746.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
 ref|XP_008451748.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
Length=325

 Score =   152 bits (384),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 147/172 (85%), Gaps = 4/172 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTW+ERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWRERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMD++G S + SP +S+QPS   S+NPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPIERMDVVGGSAAASPYTSHQPSPCASFNPSPGSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNL-ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + N N  TD +SLIPWL NL +S SS SSSKLP+H YI GGSISAPVTPPLS
Sbjct  121  VGNPN--TDGSSLIPWLKNLSTSSSSASSSKLPNH-YIHGGSISAPVTPPLS  169



>ref|XP_006370100.1| hypothetical protein POPTR_0001s39520g [Populus trichocarpa]
 ref|XP_006370101.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
 gb|ABK93591.1| unknown [Populus trichocarpa]
 gb|ERP66669.1| hypothetical protein POPTR_0001s39520g [Populus trichocarpa]
 gb|ERP66670.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
Length=328

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTT+RKGCKP ERMDI+G S + SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTFRKGCKPVERMDILGVSATTSPCSSYHPSPCASYNPSPGSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D   NSLIPWL NLSS SS +SS    HLYI GGSISAPVTPPLS
Sbjct  121  AANANMDC--NSLIPWLKNLSSASSSASSSKFPHLYIHGGSISAPVTPPLS  169



>ref|XP_010916623.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=340

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 130/177 (73%), Gaps = 6/177 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            M SGTRLPTW+ERENNKRRERRRRAIAAKIFAGLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MPSGTRLPTWRERENNKRRERRRRAIAAKIFAGLRMYGNYRLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYR+GCKP ERMD+           +       +      +SS     SS Y
Sbjct  61   WTVEEDGTTYRQGCKPVERMDVGVGGSVSPSPCTSYQPSPHASYNPSPASSSFPSPSSSY  120

Query  485  ITNNNN---DTDPNSLIPWLXNL-ssgsspsssKL--PHHLYIPGGSISAPVTPPLS  637
            ITN NN    TD NSLIPWL NL S+ SS SSSKL  PH+L+I GGSISAPVTPPLS
Sbjct  121  ITNANNANKGTDGNSLIPWLKNLSSASSSSSSSKLPNPHYLFIHGGSISAPVTPPLS  177



>ref|XP_011002762.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Populus euphratica]
 ref|XP_011002763.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Populus euphratica]
Length=328

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTT+RKGCKP ERMDI+G S + SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTFRKGCKPVERMDILGVSATTSPCSSYHPSPCASYNPSPGSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D   NSLIPWL NLSS SS +SS    HLYI GGSISAPVTPPLS
Sbjct  121  AANANMDC--NSLIPWLKNLSSASSSASSSKFPHLYIHGGSISAPVTPPLS  169



>ref|XP_004137229.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 ref|XP_004156512.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 gb|KGN53574.1| hypothetical protein Csa_4G083490 [Cucumis sativus]
Length=325

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 146/172 (85%), Gaps = 4/172 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTW+ERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWRERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMD++G S + SP +S+QPS   S+NPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPIERMDVVGGSAAASPYTSHQPSPCASFNPSPGSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNL-ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            I N N D   +SLIPWL NL +S SS SSSKLP+H YI GGSISAPVTPPLS
Sbjct  121  IGNPNADG--SSLIPWLKNLSTSSSSASSSKLPNH-YIHGGSISAPVTPPLS  169



>ref|XP_006442380.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
 gb|ESR55620.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
Length=324

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 143/172 (83%), Gaps = 5/172 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG RLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S   SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPVERMDIVGGSAVASPCSSYHPSPCASYNPSPTSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNL-ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N+D   NSLIPWL NL S+ SS SSSKLP HLYI  GSISAPVTPPLS
Sbjct  121  AANPNSD---NSLIPWLKNLSSASSSASSSKLP-HLYIHTGSISAPVTPPLS  168



>gb|KHG15415.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=325

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 143/171 (84%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S +VSPCSSY PS   SYNPSPASSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPVERMDIVGGSATVSPCSSYHPSPRASYNPSPASSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + N N D   NSL PWL NLSS SS +SS    + YI GGSISAPVTPPLS
Sbjct  121  VVNPNGDV--NSLFPWLKNLSSASSSASSSKRPYSYIHGGSISAPVTPPLS  169



>ref|XP_002317445.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
 gb|EEE98057.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
Length=319

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 143/171 (84%), Gaps = 6/171 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP E MDI+G S + SPCSSY PS   SYNPSP SSSFPSPVSS Y
Sbjct  61   WAVEPDGTTYRKGCKPAEHMDIIGGSATASPCSSYLPSPCASYNPSPGSSSFPSPVSSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N   D NSL+PWL NL   SS SSSKLP HLYI GGSISAPVTPPLS
Sbjct  121  AANAN--LDDNSLLPWLKNL---SSASSSKLP-HLYIHGGSISAPVTPPLS  165



>ref|XP_010644097.1| PREDICTED: BES1/BZR1 homolog protein 4 [Vitis vinifera]
Length=326

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG RLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S S SPCSSY PS   SYNPSPASSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPVERMDIVGGSASASPCSSYHPSPCASYNPSPASSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNL-ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D   NSLIPWL NL S+ SS SSSKLP HLYI  GSISAPVTPPLS
Sbjct  121  AANPNADG--NSLIPWLKNLSSASSSASSSKLP-HLYIHSGSISAPVTPPLS  169



>ref|XP_006477843.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006477844.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Citrus 
sinensis]
 gb|KDO43794.1| hypothetical protein CISIN_1g020567mg [Citrus sinensis]
Length=324

 Score =   150 bits (378),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 143/172 (83%), Gaps = 5/172 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG RLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S   SPCSSY PS   SYNPSPASSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPVERMDIVGGSAVASPCSSYHPSPCASYNPSPASSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNL-ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D   NSLIPWL NL S+ SS SSSKLP HLYI  GSISAPVTPPLS
Sbjct  121  AANPNAD---NSLIPWLKNLSSASSSASSSKLP-HLYIHTGSISAPVTPPLS  168



>ref|XP_009359371.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=324

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 137/171 (80%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLR+YGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRLYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP E+MD+MG S   SP SS+  S   SYNPSP SSS PSP SS Y
Sbjct  61   WTVELDGTTYRKGCKPVEQMDVMGGSTLASPSSSFLQSNRASYNPSPGSSSIPSPTSSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D    SLIPWL NLSS SS +SS    +LYI GGSISAPVTPPLS
Sbjct  121  AANQNADG--RSLIPWLKNLSSASSSASSSKLPNLYIHGGSISAPVTPPLS  169



>ref|XP_010518826.1| PREDICTED: BES1/BZR1 homolog protein 3 isoform X2 [Tarenaya hassleriana]
Length=294

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 141/171 (82%), Gaps = 6/171 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP  RMDI+G S S SPCSSYQPS   SYNPSP+SSSFPSP +S Y
Sbjct  61   WTVEEDGTTYRKGCKPVNRMDIIGGSTSASPCSSYQPSPRASYNPSPSSSSFPSPRASHY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             ++ N   D NSLIPWL NL   SS S +KLP   +  G SISAPVTPPL+
Sbjct  121  PSSTNPFGDANSLIPWLKNL---SSNSPTKLP---FFHGSSISAPVTPPLA  165



>gb|KJB13026.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13027.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13028.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13029.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
Length=325

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYR GCKP ERMDI+G S +VSPCSSY PS   SYNPSPASSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRNGCKPVERMDIVGGSATVSPCSSYHPSSRASYNPSPASSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + N N D   NSL PWL NLSS SS +SS    + YI GGSISAPVTPPLS
Sbjct  121  MVNPNGDV--NSLFPWLKNLSSASSSASSSKRPYSYIHGGSISAPVTPPLS  169



>ref|XP_010518825.1| PREDICTED: BES1/BZR1 homolog protein 3 isoform X1 [Tarenaya hassleriana]
Length=311

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 141/171 (82%), Gaps = 6/171 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP  RMDI+G S S SPCSSYQPS   SYNPSP+SSSFPSP +S Y
Sbjct  61   WTVEEDGTTYRKGCKPVNRMDIIGGSTSASPCSSYQPSPRASYNPSPSSSSFPSPRASHY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             ++ N   D NSLIPWL NL   SS S +KLP   +  G SISAPVTPPL+
Sbjct  121  PSSTNPFGDANSLIPWLKNL---SSNSPTKLP---FFHGSSISAPVTPPLA  165



>ref|XP_011044050.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Populus euphratica]
Length=319

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 141/171 (82%), Gaps = 6/171 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCK  E MDI+G S + SPCSSY PS   SYNPSP SSSFPS VSS Y
Sbjct  61   WAVEPDGTTYRKGCKTAEHMDIIGGSATASPCSSYLPSPCASYNPSPGSSSFPSSVSSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N   D NSL+PWL NL   SS SSSKLP HLYI GGSISAPVTPPLS
Sbjct  121  AANAN--VDDNSLLPWLKNL---SSASSSKLP-HLYIHGGSISAPVTPPLS  165



>ref|XP_009416433.1| PREDICTED: protein BZR1 homolog 3 [Musa acuminata subsp. malaccensis]
Length=337

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 140/184 (76%), Gaps = 14/184 (8%)
 Frame = +2

Query  104  RNGRRREMTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLK  283
            + GR  EMTSGTR+PTW+ERENNKRRERRRRAIAAKI+AGLRMYGNYKLPKHCDNN VLK
Sbjct  2    KEGRVEEMTSGTRMPTWRERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNAVLK  61

Query  284  ALCKEAGWIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfp  463
            ALC+EAGW VEEDGTTYRKGCKP E +DI+GSS S SPC SY PS   S   SP SS+  
Sbjct  62   ALCEEAGWAVEEDGTTYRKGCKPVEHVDIVGSSASPSPCVSYNPSPASSTLASPMSST--  119

Query  464  spvssRYITNNNN---DTDPNSLIPWLXNLssgsspsssKLP---HHLYIPGGSISAPVT  625
                   ITN  N    T+ NSL+PWL +LSS SS S+S      HHLY+ GGSISAPVT
Sbjct  120  ------LITNAKNLTSGTEGNSLVPWLKSLSSASSTSTSSKLPDLHHLYVHGGSISAPVT  173

Query  626  PPLS  637
            PPLS
Sbjct  174  PPLS  177



>ref|XP_007211637.1| hypothetical protein PRUPE_ppa008675mg [Prunus persica]
 ref|XP_008225238.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Prunus mume]
 ref|XP_008225239.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Prunus mume]
 gb|EMJ12836.1| hypothetical protein PRUPE_ppa008675mg [Prunus persica]
Length=323

 Score =   147 bits (371),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 142/171 (83%), Gaps = 3/171 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNK+RERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  2    MTSGTRMPTWKERENNKKRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCNEAG  61

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP +RMDIMG S S SPCSSYQPS  P  + +P+ +S   P  +RY
Sbjct  62   WTVEEDGTTYRKGCKPVDRMDIMGGSTSASPCSSYQPS--PCQSYNPSPASSSFPSPARY  119

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N + D NSLIPWL  LSSGSS ++SKLP  L+I GGSISAPVTPPLS
Sbjct  120  PANANGNADANSLIPWLKTLSSGSSSATSKLP-QLFIQGGSISAPVTPPLS  169



>ref|XP_006833072.1| hypothetical protein AMTR_s00170p00061300 [Amborella trichopoda]
 gb|ERM98350.1| hypothetical protein AMTR_s00170p00061300 [Amborella trichopoda]
Length=293

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 136/171 (80%), Gaps = 12/171 (7%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKI+AGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCAEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMDI+G S S SPCSSY PS G         S  PSP SS +
Sbjct  61   WTVEEDGTTYRKGCKPVERMDIVGGSASASPCSSYHPSPG--------PSYNPSPASSSF  112

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             +  ++ TD +SLIPWL NL    SPSS KLP  LYI GGSISAPVTPPLS
Sbjct  113  PSPASSYTDGSSLIPWLKNL---PSPSSHKLP-SLYIHGGSISAPVTPPLS  159



>gb|KJB45771.1| hypothetical protein B456_007G327000 [Gossypium raimondii]
Length=317

 Score =   147 bits (370),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 134/171 (78%), Gaps = 10/171 (6%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S + SP          SY+PSP SSSFPS  SS Y
Sbjct  61   WTVEPDGTTYRKGCKPLERMDIVGGSATASPS--------SSYHPSPMSSSFPSSASSSY  112

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + N+N D   +SLIPWL NLSS SS   S    H+YI  GSISAPVTPPLS
Sbjct  113  VVNSNGDG--SSLIPWLKNLSSASSSPMSSKLPHIYIHSGSISAPVTPPLS  161



>emb|CDP06034.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 140/171 (82%), Gaps = 3/171 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAA IFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAANIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGC+P +RMDIMG S S SPCSSY PS G SYNPSPASSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCRPVDRMDIMGGSTSASPCSSYHPSPGTSYNPSPASSSFPSPASSPY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D   NSLIPWL NLSS SS +SS     L   GGSISAPVTPPLS
Sbjct  121  AANINGDG--NSLIPWLKNLSSSSSSTSSTK-FQLLCHGGSISAPVTPPLS  168



>ref|XP_002267082.1| PREDICTED: BES1/BZR1 homolog protein 4 [Vitis vinifera]
Length=341

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 148/185 (80%), Gaps = 16/185 (9%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            +GTRLPTWKERENNKRRERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALC EAGW 
Sbjct  2    TGTRLPTWKERENNKRRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCNEAGWT  61

Query  311  VEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspass------------  454
            VEEDGTTYRKGCKP ERMDIMG S S SPCSSYQPS   SYNPSP +S            
Sbjct  62   VEEDGTTYRKGCKPVERMDIMGGSASASPCSSYQPSPCASYNPSPCASYNPSPCASYNPS  121

Query  455  ----sfpspvssRYITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPV  622
                SFPSPVSSRY  N N   D N+LIPWL NLSSGSS +SSK PHHLYI GGSISAPV
Sbjct  122  PASSSFPSPVSSRYAANANASADANALIPWLKNLSSGSSSTSSKFPHHLYIHGGSISAPV  181

Query  623  TPPLS  637
            TPPLS
Sbjct  182  TPPLS  186



>ref|XP_007211588.1| hypothetical protein PRUPE_ppa008637mg [Prunus persica]
 gb|EMJ12787.1| hypothetical protein PRUPE_ppa008637mg [Prunus persica]
Length=324

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 140/171 (82%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MT GTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTYGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMD++G S   SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPAERMDVVGGSTLASPCSSYHPSTCASYNPSPGSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D    SLIPWL NLSSGSS +SS    +LYI GGSISAPVTPPLS
Sbjct  121  AANQNADG--RSLIPWLKNLSSGSSSASSSKLPNLYIHGGSISAPVTPPLS  169



>ref|XP_009334016.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=324

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 138/171 (81%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPT KERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTSKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMD+MG S   SP SS+ PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVELDGTTYRKGCKPVERMDVMGGSTVASPSSSFHPSNCASYNPSPGSSSFPSPTSSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D+   SLIPWL NLSS SS +SS    +LYI  GSISAPVTPPLS
Sbjct  121  AANQNADS--RSLIPWLRNLSSASSSASSSKLPNLYIHSGSISAPVTPPLS  169



>ref|XP_007149549.1| hypothetical protein PHAVU_005G079400g [Phaseolus vulgaris]
 gb|ESW21543.1| hypothetical protein PHAVU_005G079400g [Phaseolus vulgaris]
Length=325

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S + SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPLERMDIVGGSSAASPCSSYHPSPCASYNPSPGSSSFPSPSSSPY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsss-KLPHHLYIPGGSISAPVTPPLS  637
               N  + D NSLIPWL NLS+ SS +SS KLP HLY+  GSISAPVTPPLS
Sbjct  121  T--NIPNADGNSLIPWLKNLSTASSSASSPKLP-HLYLHSGSISAPVTPPLS  169



>ref|XP_004489001.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Cicer 
arietinum]
 ref|XP_004489002.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Cicer 
arietinum]
Length=321

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 139/171 (81%), Gaps = 6/171 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MT GTRLPTWKERENNK+RERRRRAIAAKIF+GLRMYGN++LPKHCDNNEVLKALC EAG
Sbjct  1    MTLGTRLPTWKERENNKKRERRRRAIAAKIFSGLRMYGNFRLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP E MDI+G S + SPCSSY  S   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPLEHMDIVGGSSAASPCSSYHQSPCASYNPSPVSSSFPSPSSSPY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             TN+N   D NSLIPWL NL   S+ SS KLP H Y+  GSISAPVTPPLS
Sbjct  121  TTNHN--VDGNSLIPWLKNL---STASSPKLP-HPYLHSGSISAPVTPPLS  165



>ref|XP_008386283.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
Length=324

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 137/171 (80%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIF GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFXGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP E MD+MG S   SP SS+ PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVELDGTTYRKGCKPVEHMDVMGGSTLASPSSSFLPSNCASYNPSPGSSSFPSPTSSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D    SLIPWL NLSS SS +SS    +LYI GGSISAPVTPPLS
Sbjct  121  AXNXNADG--RSLIPWLKNLSSASSSASSSKLPNLYIHGGSISAPVTPPLS  169



>gb|KHG21553.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=317

 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 134/171 (78%), Gaps = 10/171 (6%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRK CKP ERMDI+G S + SP          SY+PSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKDCKPLERMDIVGGSATASPS--------SSYHPSPMSSSFPSPASSSY  112

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + N+N D   +SLIPWL NLSS SS   S    H+YI  GSISAPVTPPLS
Sbjct  113  VVNSNGDG--SSLIPWLKNLSSASSSPMSSKLPHIYIHSGSISAPVTPPLS  161



>ref|XP_010924706.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=339

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 122/177 (69%), Gaps = 6/177 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            M SGTRLPTW+ERENNKRRERRRRAIAAKI+ GLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MPSGTRLPTWRERENNKRRERRRRAIAAKIYTGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMD+     +     +       +       SS     SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVERMDVGVGGSASPSPCTSYQPSPRASYNHSPPSSSLPSPSSSY  120

Query  485  I-----TNNNNDTDPNSLIPWLXNLssgsspsssKLP-HHLYIPGGSISAPVTPPLS  637
            I      N N  TD NS IPWL NLSS SS S  K P HH YI GGSISAPVTPPLS
Sbjct  121  ITNTNNNNANKGTDGNSHIPWLKNLSSASSTSCLKPPNHHFYIHGGSISAPVTPPLS  177



>ref|XP_004489004.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Cicer 
arietinum]
Length=325

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE DGTTYRKGCKP ERMD+ G S   +PCSSY PS   SYNPSP SSSFPSP SS +
Sbjct  61   WIVEPDGTTYRKGCKPIERMDVAGGSAMATPCSSYHPSPCASYNPSPGSSSFPSPRSSSH  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D   NSLIPWL NLSSGSS +SS     LYI  GSISAPVTPPLS
Sbjct  121  AVNPNGDG--NSLIPWLKNLSSGSSSTSSSKLPQLYIHTGSISAPVTPPLS  169



>ref|XP_004489003.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Cicer 
arietinum]
Length=342

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE DGTTYRKGCKP ERMD+ G S   +PCSSY PS   SYNPSP SSSFPSP SS +
Sbjct  61   WIVEPDGTTYRKGCKPIERMDVAGGSAMATPCSSYHPSPCASYNPSPGSSSFPSPRSSSH  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D   NSLIPWL NLSSGSS +SS     LYI  GSISAPVTPPLS
Sbjct  121  AVNPNGDG--NSLIPWLKNLSSGSSSTSSSKLPQLYIHTGSISAPVTPPLS  169



>ref|XP_003540501.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Glycine 
max]
Length=330

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 139/172 (81%), Gaps = 3/172 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG R PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCK-PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE DGTTYRKGCK P ERMDI+G S + SPCSSY PS   SYNPSP SS  PSP +S 
Sbjct  61   WTVEADGTTYRKGCKPPVERMDIVGGSAAASPCSSYHPSPCASYNPSPGSSCLPSPRASP  120

Query  482  YITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            Y  N+N D   NSLIPWL NLSSGSS +SS     LYIP GSISAPVTPP+S
Sbjct  121  YPPNHNADG--NSLIPWLKNLSSGSSSASSSKLPQLYIPNGSISAPVTPPIS  170



>ref|XP_006592939.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Glycine 
max]
Length=334

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 139/172 (81%), Gaps = 3/172 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG R PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCK-PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE DGTTYRKGCK P ERMDI+G S + SPCSSY PS   SYNPSP SS  PSP +S 
Sbjct  61   WTVEADGTTYRKGCKPPVERMDIVGGSAAASPCSSYHPSPCASYNPSPGSSCLPSPRASP  120

Query  482  YITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            Y  N+N D   NSLIPWL NLSSGSS +SS     LYIP GSISAPVTPP+S
Sbjct  121  YPPNHNADG--NSLIPWLKNLSSGSSSASSSKLPQLYIPNGSISAPVTPPIS  170



>ref|XP_010429699.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Camelina sativa]
Length=325

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 145/175 (83%), Gaps = 6/175 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGC-KPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKGC +P ERM+I G S + SPCSSYQPS   SYNPSPASS+F SP SS 
Sbjct  61   WIVEPDGTTYRKGCSRPVERMEIGGGSATASPCSSYQPSPCASYNPSPASSNFMSPASSS  120

Query  482  YITNNNNDTDPNSLIPWLXNL---ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            +   N    D  SLIPWL +L   SS S+ SSS+LP++LYIPGGSISAPVTPPLS
Sbjct  121  FA--NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLYIPGGSISAPVTPPLS  173



>ref|NP_565187.1| BES1/BZR1 homolog 4 [Arabidopsis thaliana]
 sp|Q9ZV88.1|BEH4_ARATH RecName: Full=BES1/BZR1 homolog protein 4 [Arabidopsis thaliana]
 gb|AAC83038.1| EST gb|R30300 comes from this gene [Arabidopsis thaliana]
 gb|AAK91446.1| At1g78700/F9K20_26 [Arabidopsis thaliana]
 gb|AAL90992.1| At1g78700/F9K20_26 [Arabidopsis thaliana]
 gb|AEE36140.1| BES1/BZR1 homolog 4 [Arabidopsis thaliana]
Length=325

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 144/175 (82%), Gaps = 6/175 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGC-KPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKGC +P ERM+I G S + SPCSSYQPS   SYNPSP SS+F SP SS 
Sbjct  61   WIVEPDGTTYRKGCSRPVERMEIGGGSATASPCSSYQPSPCASYNPSPGSSNFMSPASSS  120

Query  482  YITNNNNDTDPNSLIPWLXNL---ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            +   N    D  SLIPWL +L   SS S+ SSS+LP++LYIPGGSISAPVTPPLS
Sbjct  121  FA--NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLYIPGGSISAPVTPPLS  173



>ref|XP_006389963.1| hypothetical protein EUTSA_v10018888mg [Eutrema salsugineum]
 gb|ESQ27249.1| hypothetical protein EUTSA_v10018888mg [Eutrema salsugineum]
Length=319

 Score =   142 bits (357),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 143/174 (82%), Gaps = 5/174 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRM+GNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMFGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE DGTTYRKG +P ERM+I G S + SPCSSYQPS   SYNPSP SS+F SP SS +
Sbjct  61   WIVEPDGTTYRKGSRPVERMEIGGGSATASPCSSYQPSPCASYNPSPGSSNFMSPASSSF  120

Query  485  ITNNNNDTDPNSLIPWLXNL---ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
               N    D  SLIPWL +L   SS S+ SSS+LP++LYIPGGSISAPVTPPLS
Sbjct  121  P--NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLYIPGGSISAPVTPPLS  172



>ref|XP_004294130.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Fragaria vesca subsp. 
vesca]
Length=324

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 143/172 (83%), Gaps = 4/172 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLP+WKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPSWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+  S + SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVELDGTTYRKGCKPVERMDIVDGSAAASPCSSYHPSNYASYNPSPGSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNL-ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              + N   D +SLIPWL +L S  SS SSSKLP ++YI GGSISAPVTPPLS
Sbjct  121  AAHQN--VDGSSLIPWLKHLSSGSSSASSSKLP-NMYIHGGSISAPVTPPLS  169



>ref|XP_010417476.1| PREDICTED: BES1/BZR1 homolog protein 4 [Camelina sativa]
Length=325

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 145/175 (83%), Gaps = 6/175 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGC-KPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKGC +P ERM+I G S + SPCSSYQPS   SYNPSPASS+F SP SS 
Sbjct  61   WIVEPDGTTYRKGCSRPVERMEIGGGSATASPCSSYQPSPCASYNPSPASSNFMSPASSS  120

Query  482  YITNNNNDTDPNSLIPWLXNL---ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            +   N    D  SLIPWL +L   SS S+ SSS+LP++LY+PGGSISAPVTPPLS
Sbjct  121  FA--NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLYVPGGSISAPVTPPLS  173



>ref|XP_009415180.1| PREDICTED: protein BZR1 homolog 3-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 131/177 (74%), Gaps = 6/177 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG+R PTW+ERENNKRRERRRRAIAAK+++GLR+YGNYKLPKHCDNN VL+ALC+EAG
Sbjct  1    MTSGSRTPTWRERENNKRRERRRRAIAAKMYSGLRLYGNYKLPKHCDNNAVLRALCEEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKPTE  D++G S S SP SS              +SS  +   S  
Sbjct  61   WTVEEDGTTYRKGCKPTEGRDVVGPSASPSPRSSSHQPSPCISYNPSPASSTLASPESST  120

Query  485  ITNNNND----TDPNSLIPWLXNLssgsspsssKLP--HHLYIPGGSISAPVTPPLS  637
            +  N  +    T+ NSL+PWL +LS  SS +SSK+P  HHLYI GGSISAPVTPPLS
Sbjct  121  LVTNTKNTASGTEGNSLVPWLKSLSPASSSTSSKIPNIHHLYIHGGSISAPVTPPLS  177



>ref|XP_008381083.1| PREDICTED: BES1/BZR1 homolog protein 4 [Malus domestica]
Length=324

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 139/172 (81%), Gaps = 4/172 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPT KERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTSKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERM++M  S   SP SS+ PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVELDGTTYRKGCKPVERMEVMXGSTVASPSSSFHPSNCASYNPSPGSSSFPSPTSSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNL-ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D+   SLIPWL NL S+ SS  SSKLP +LYI  GSISAPVTPPLS
Sbjct  121  XANQNADS--RSLIPWLRNLSSASSSAFSSKLP-NLYIHSGSISAPVTPPLS  169



>ref|XP_006302567.1| hypothetical protein CARUB_v10020674mg [Capsella rubella]
 gb|EOA35465.1| hypothetical protein CARUB_v10020674mg [Capsella rubella]
Length=317

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 137/175 (78%), Gaps = 14/175 (8%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGC-KPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKGC +P ERM+I G S + SPCSSYQPS   S   SPASSSF       
Sbjct  61   WIVELDGTTYRKGCSRPVERMEIGGGSATASPCSSYQPSPASSNFMSPASSSFA------  114

Query  482  YITNNNNDTDPNSLIPWLXNL---ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                N    D  SLIPWL +L   SS S+ SSS+LP++LYIPGGSISAPVTPPLS
Sbjct  115  ----NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLYIPGGSISAPVTPPLS  165



>ref|XP_002887754.1| hypothetical protein ARALYDRAFT_895772 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64013.1| hypothetical protein ARALYDRAFT_895772 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 143/175 (82%), Gaps = 6/175 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGC-KPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKGC +P ERM++ G S + SPCSSYQPS   SYNPSP  S+F SP SS 
Sbjct  61   WIVEPDGTTYRKGCSRPVERMEVGGGSATASPCSSYQPSPCASYNPSPGPSNFMSPASSS  120

Query  482  YITNNNNDTDPNSLIPWLXNL---ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            +   N    D  SLIPWL +L   SS S+ SSS+LP++LYIPGGSISAPVTPPLS
Sbjct  121  FA--NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLYIPGGSISAPVTPPLS  173



>gb|KHN36918.1| BES1/BZR1 like protein 4 [Glycine soja]
Length=331

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 142/172 (83%), Gaps = 4/172 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPT KERENNKRRERRRRAIAAKIFAGLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTSKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S + SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPLERMDIVGGSSAASPCSSYHPSPCASYNPSPGSSSFPSPSSSPY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsss-KLPHHLYIPGGSISAPVTPPLS  637
                N D   NSLIPWL NLS+ SS +SS KLP HLY+  GSISAPVTPPLS
Sbjct  121  TQIPNADG--NSLIPWLKNLSTASSSASSPKLP-HLYLHSGSISAPVTPPLS  169



>ref|XP_003543195.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Glycine max]
Length=325

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 142/172 (83%), Gaps = 4/172 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPT KERENNKRRERRRRAIAAKIFAGLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTSKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S + SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPLERMDIVGGSSAASPCSSYHPSPCASYNPSPGSSSFPSPSSSPY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsss-KLPHHLYIPGGSISAPVTPPLS  637
                N D   NSLIPWL NLS+ SS +SS KLP HLY+  GSISAPVTPPLS
Sbjct  121  TQIPNADG--NSLIPWLKNLSTASSSASSPKLP-HLYLHSGSISAPVTPPLS  169



>ref|XP_003596275.1| Brassinosteroid signaling positive regulator-related protein 
[Medicago truncatula]
 gb|AES66526.1| brassinazole-resistant 1 protein [Medicago truncatula]
Length=323

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 140/172 (81%), Gaps = 5/172 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE DGTTYRKGCKP ER+D++G S   SPCSSY  S   SYNPSP SSSFPSP SS  
Sbjct  61   WIVEPDGTTYRKGCKPAERIDVIGGSTMGSPCSSYHVSPCASYNPSPGSSSFPSPRSSHA  120

Query  485  ITNNNNDTDPNSLIPWLXNL-ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            +   N + D NSLIPWL NL S  SS SSSKLP  LYI  GSISAPVTPPLS
Sbjct  121  V---NPNGDGNSLIPWLKNLSSGSSSASSSKLP-QLYIHTGSISAPVTPPLS  168



>ref|XP_010537716.1| PREDICTED: BES1/BZR1 homolog protein 4 [Tarenaya hassleriana]
Length=309

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 117/171 (68%), Gaps = 13/171 (8%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRA+AAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAMAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE DGTTYRKGCKP ER +                           S S     +S  
Sbjct  61   WIVEPDGTTYRKGCKPVERTNYA-------------SPCSSFQPSPFTSYSHSPASASSS  107

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            +  N    D  SLIPWL NLS+ SS SSS    +LY+PGGSISAPVTPPLS
Sbjct  108  LAANLTTADGQSLIPWLRNLSTSSSSSSSSRFPYLYVPGGSISAPVTPPLS  158



>ref|XP_009768995.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana sylvestris]
Length=316

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYQLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ER+D +G S S+SPCSSYQPS   S NPSPASSS  SP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPMERLDFIGGSTSISPCSSYQPSPFTSNNPSPASSSLHSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             TN N D    SLIPWL NLSSGSS +SS    H +I  GSISAPVTPP S
Sbjct  121  ATNLNMDG--KSLIPWLKNLSSGSSSASSSKLPHFHIHTGSISAPVTPPFS  169



>ref|XP_008226380.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Prunus mume]
Length=324

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 138/171 (81%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MT GTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTYGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP E MD++G S   SPCSS  PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPAECMDVVGGSTLASPCSSCHPSTCASYNPSPGSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D    SLIPWL NLSSGSS +SS    +L+I GGSISAPVTPPLS
Sbjct  121  AANQNADG--RSLIPWLKNLSSGSSSASSSKLPNLHIHGGSISAPVTPPLS  169



>ref|XP_010925590.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=337

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 140/176 (80%), Gaps = 5/176 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKI++GLRM GNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRIPTWKERENNKRRERRRRAIAAKIYSGLRMCGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCK--PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvss  478
            W VE DGTTYRKGCK  P E MD++G S S S CSSYQPS   SYNPSPA SSF SP SS
Sbjct  61   WTVEPDGTTYRKGCKPPPAECMDVVGCSTSPSLCSSYQPSPCASYNPSPALSSFASPASS  120

Query  479  RYITNNNND---TDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             YITN +N     D NSLIP L NLSS  S S+    HHLY+ GGSISAPVTPPLS
Sbjct  121  SYITNAHNADHFVDGNSLIPRLKNLSSACSASTKFPQHHLYMHGGSISAPVTPPLS  176



>ref|XP_009622768.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana tomentosiformis]
Length=316

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 138/171 (81%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYQLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ER+D  G S S+SPCSSYQPS   S NPSPASSS  SP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPMERLDFKGGSTSISPCSSYQPSPFTSNNPSPASSSLHSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             TN N D    SLIPWL NLSSGSS +SS    H +I  GSISAPVTPP S
Sbjct  121  ATNLNMDG--KSLIPWLKNLSSGSSSASSSKLPHFHIHTGSISAPVTPPFS  169



>ref|XP_010665681.1| PREDICTED: BES1/BZR1 homolog protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=329

 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 139/171 (81%), Gaps = 4/171 (2%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            +GTR+PTW+ERENNK+RERRRRAIAAKI+ GLRMYGNYKLPKHCDNNEVLKAL +EAGW+
Sbjct  2    TGTRMPTWRERENNKKRERRRRAIAAKIYTGLRMYGNYKLPKHCDNNEVLKALAREAGWV  61

Query  311  VEEDGTTYRKGCKPTERMDIMGssvsvs--pcssyqpsqGpsynpspasssfpspvssRY  484
            VEEDGTTYR+GCKP E +DI+G S SVS        P  G SYNPSPASSSFPSP  S +
Sbjct  62   VEEDGTTYRQGCKPMEPIDIIGGSASVSPCSSYPVSPRAGASYNPSPASSSFPSPAHSYF  121

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsss-KLPHHLYIPGGSISAPVTPPL  634
              + N  TDPNSLIPWL NLSS  S S+S KLP ++Y+PGGSISAPVTP L
Sbjct  122  APSANGTTDPNSLIPWLKNLSSSGSSSASPKLP-YIYMPGGSISAPVTPLL  171



>ref|XP_009381197.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Musa acuminata subsp. 
malaccensis]
Length=411

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 142/186 (76%), Gaps = 7/186 (4%)
 Frame = +2

Query  101  KRNGRRREMTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVL  280
            +  G    MTSGTR+PTW+ERENN+RRERRRRAIAA I+AGLRMYGNYKLPKHCDNNEVL
Sbjct  50   EAGGSCEGMTSGTRMPTWRERENNRRRERRRRAIAANIYAGLRMYGNYKLPKHCDNNEVL  109

Query  281  KALCKEAGWIVEEDGTTYRKGCKPT-ERMDIMGssvsvspcssyqpsqGpsynpspasss  457
            KALC EAGW VE DGTTYRKG KP+ E MD++G S S SP SS Q S   SYN SPASSS
Sbjct  110  KALCDEAGWTVEPDGTTYRKGSKPSVECMDVVGGSTSPSPYSSNQASPCASYNHSPASSS  169

Query  458  fpspvssRYITNNNND---TDPNSLIPWLXNLssgsspsssKLPHH---LYIPGGSISAP  619
            F SP SS YITN NN     D NSLIPWL NL S SS +SS +  H   L++ GGSISAP
Sbjct  170  FASPASSSYITNTNNSINGADGNSLIPWLKNLYSASSSASSSMFRHQQPLFMGGGSISAP  229

Query  620  VTPPLS  637
            VTPP+S
Sbjct  230  VTPPMS  235



>ref|XP_009397454.1| PREDICTED: protein BZR1 homolog 2-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 137/177 (77%), Gaps = 6/177 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENN+RRERRRRA+AAKI+ GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNRRRERRRRAVAAKIYTGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCK-PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE DGTTYRKGCK P E MDI+G S S SP SS QPS   SYNPSPASSS+ SP SS 
Sbjct  61   WSVEPDGTTYRKGCKPPAEHMDIVGGSNSHSPYSSNQPSPCTSYNPSPASSSYASPASSS  120

Query  482  YITNNNND---TDPNSLIPWLXNLssgsspsssKLPHH--LYIPGGSISAPVTPPLS  637
            YI   NN     D NSLIPWL NLSS S+   ++  H     + GGSISAPVTPPLS
Sbjct  121  YIVATNNSINAADANSLIPWLKNLSSASTSDLTRFLHQHPFSMHGGSISAPVTPPLS  177



>ref|XP_010472705.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Camelina sativa]
Length=325

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 143/175 (82%), Gaps = 6/175 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKG  +P ERM+I G S + SPCSSYQPS   SYNPSP SS+F SP SS 
Sbjct  61   WIVEPDGTTYRKGSSRPVERMEIGGGSATASPCSSYQPSPCASYNPSPVSSNFMSPASSS  120

Query  482  YITNNNNDTDPNSLIPWLXNL---ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            +   N    D  SLIPWL +L   SS S+ SSS+LP++LYIPGGSISAPVTPPLS
Sbjct  121  FA--NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLYIPGGSISAPVTPPLS  173



>ref|XP_004309625.1| PREDICTED: BES1/BZR1 homolog protein 4 [Fragaria vesca subsp. 
vesca]
Length=329

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 135/177 (76%), Gaps = 6/177 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MT+GTR+PTWKERENNK+RERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  2    MTTGTRMPTWKERENNKKRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCNEAG  61

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcss------yqpsqGpsynpspasssfps  466
            W VEEDGTTYRKGCKP +RMDI+G S S SPCSS         +  P  + +P+ +S   
Sbjct  62   WTVEEDGTTYRKGCKPVDRMDIIGGSTSASPCSSYQPSPCASYNPSPCASYNPSPASSSF  121

Query  467  pvssRYITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            P  +RY  N N + D NSLIPWL  LSS  S S++     L+IPGGSISAPVTPPLS
Sbjct  122  PSPARYPANANGNADANSLIPWLKTLSSTGSSSATSKLPQLFIPGGSISAPVTPPLS  178



>ref|XP_006594721.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Glycine 
max]
Length=330

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 137/172 (80%), Gaps = 3/172 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTS  R PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSVARQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCK-PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE DGTTYRKGCK P ERMDI+G S + SPCSSY PS   SYNPSP SS  PSP +S 
Sbjct  61   WTVEADGTTYRKGCKPPVERMDIVGGSAAASPCSSYHPSPCASYNPSPGSSCLPSPRASP  120

Query  482  YITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            +  N N D   NSLIPWL NLSSGSS +SS     LYIP GSISAPVTPP+S
Sbjct  121  FPPNPNADG--NSLIPWLKNLSSGSSSASSSKLPQLYIPNGSISAPVTPPIS  170



>ref|XP_003543196.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Glycine 
max]
Length=334

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 137/172 (80%), Gaps = 3/172 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTS  R PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSVARQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCK-PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE DGTTYRKGCK P ERMDI+G S + SPCSSY PS   SYNPSP SS  PSP +S 
Sbjct  61   WTVEADGTTYRKGCKPPVERMDIVGGSAAASPCSSYHPSPCASYNPSPGSSCLPSPRASP  120

Query  482  YITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            +  N N D   NSLIPWL NLSSGSS +SS     LYIP GSISAPVTPP+S
Sbjct  121  FPPNPNADG--NSLIPWLKNLSSGSSSASSSKLPQLYIPNGSISAPVTPPIS  170



>ref|XP_010062789.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Eucalyptus grandis]
 gb|KCW69907.1| hypothetical protein EUGRSUZ_F03236 [Eucalyptus grandis]
Length=320

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 131/172 (76%), Gaps = 8/172 (5%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG+R+PTW+ERENNKRRERRRRA+AAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGSRMPTWRERENNKRRERRRRAVAAKIFSGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE DGTTYRKGCKP E +D++  S +VSP SSY P+  PS   S   S   S     Y
Sbjct  61   WIVEADGTTYRKGCKPVEHVDMVARSETVSPSSSYYPTHNPSPGSSSFPSPASSF----Y  116

Query  485  ITNNNNDTDPNSLIPWLXNL-ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D   + LIPWL N  S+ SS SSSKLP HLYIPG SISAPVTP LS
Sbjct  117  AANANADG--SFLIPWLKNFSSASSSASSSKLP-HLYIPGSSISAPVTPHLS  165



>ref|XP_009388695.1| PREDICTED: protein BZR1 homolog 3-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 140/177 (79%), Gaps = 6/177 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTS +R+PTW+ERENN+RRERRRRAIAAKI+AGLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSRSRMPTWRERENNRRRERRRRAIAAKIYAGLRMYGNYRLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCK-PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKGCK P + MD++G S S SP SS QPS   SYNPSPASSS+ SP SS 
Sbjct  61   WIVEPDGTTYRKGCKPPADHMDVVGGSTSPSPYSSNQPSPCASYNPSPASSSYASPASSS  120

Query  482  YITNNNND---TDPNSLIPWLXNLssgsspsssKLPHH--LYIPGGSISAPVTPPLS  637
            YI   NN     D NSLIPWL NLSS SS   SK+ H    Y+ GGSISAPVTPPLS
Sbjct  121  YIATANNSINGADANSLIPWLKNLSSASSSGPSKILHQHPFYMHGGSISAPVTPPLS  177



>emb|CDY14593.1| BnaC02g25200D [Brassica napus]
Length=293

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 122/175 (70%), Gaps = 27/175 (15%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKG  +P ERM+I GS  S +  S    S                     
Sbjct  61   WIVEPDGTTYRKGSSRPVERMEIGGSPCSSNFMSPASSSFA-------------------  101

Query  482  YITNNNNDTDPNSLIPWLXNL---ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                N    D  SLIPWL +L   SS S+ SSS+LP++LYIPGGSISAPVTPPLS
Sbjct  102  ----NLTPGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLYIPGGSISAPVTPPLS  152



>emb|CDY26877.1| BnaA02g19020D [Brassica napus]
Length=293

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 122/175 (70%), Gaps = 27/175 (15%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKG  +P ERM+I GS  S +  S    S                     
Sbjct  61   WIVEPDGTTYRKGSSRPVERMEIGGSPCSSNFMSPASSSFA-------------------  101

Query  482  YITNNNNDTDPNSLIPWLXNL---ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                N    D  SLIPWL +L   SS S+ SSS+LP++LYIPGGSISAPVTPPLS
Sbjct  102  ----NLTPGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLYIPGGSISAPVTPPLS  152



>ref|XP_009128310.1| PREDICTED: BES1/BZR1 homolog protein 4 [Brassica rapa]
Length=292

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 122/175 (70%), Gaps = 27/175 (15%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKG  +P ERM+I GS  S +  S    S                     
Sbjct  61   WIVEPDGTTYRKGSSRPVERMEIGGSPCSSNFMSPASSSFA-------------------  101

Query  482  YITNNNNDTDPNSLIPWLXNL---ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                N    D  SLIPWL +L   SS S+ SSS+LP++LYIPGGSISAPVTPPLS
Sbjct  102  ----NLTPGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLYIPGGSISAPVTPPLS  152



>ref|XP_003540502.1| PREDICTED: BES1/BZR1 homolog protein 4 [Glycine max]
Length=322

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 129/172 (75%), Gaps = 9/172 (5%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNK+RERRRRAIAAKIFAGLRMYGN+KLPKHCDNNEVLKALC +AG
Sbjct  1    MTSGTRLPTWKERENNKKRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNKAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP+E M+I+G S + +   S        +    AS +     SS Y
Sbjct  61   WTVEPDGTTYRKGCKPSEGMEIVGGSSAAASPCS------SYHPSPCASYNPSPGSSSPY  114

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsss-KLPHHLYIPGGSISAPVTPPLS  637
             T   N  D NSLIPWL NLS+ SS +SS KLP HLY+  GSISAPVTPPLS
Sbjct  115  YTQIPNP-DGNSLIPWLKNLSTASSSASSPKLP-HLYLHSGSISAPVTPPLS  164



>gb|AES66525.2| brassinazole-resistant 1 protein [Medicago truncatula]
Length=517

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 135/172 (78%), Gaps = 12/172 (7%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGN++LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNFRLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP E MD++G S + SPC         SY+PSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPLENMDMVGGSSAASPC--------SSYHPSPGSSSFPSPSSSPY  112

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsss-KLPHHLYIPGGSISAPVTPPLS  637
              N N   D NSLIPWL NLS+ SS  SS KLPH  Y   GSISAPVTPPLS
Sbjct  113  AANRN--ADGNSLIPWLKNLSTASSSGSSPKLPHP-YFHSGSISAPVTPPLS  161



>ref|XP_003596274.1| Brassinosteroid signaling positive regulator-related protein 
[Medicago truncatula]
Length=447

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 135/172 (78%), Gaps = 12/172 (7%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGN++LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNFRLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP E MD++G S + SPC         SY+PSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPLENMDMVGGSSAASPC--------SSYHPSPGSSSFPSPSSSPY  112

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsss-KLPHHLYIPGGSISAPVTPPLS  637
              N N   D NSLIPWL NLS+ SS  SS KLPH  Y   GSISAPVTPPLS
Sbjct  113  AANRN--ADGNSLIPWLKNLSTASSSGSSPKLPHP-YFHSGSISAPVTPPLS  161



>ref|XP_006348323.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Solanum tuberosum]
Length=315

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 140/171 (82%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYQLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ER+D +G S S+SPCSSYQPS   S NPSPASSSFPSP SS Y
Sbjct  61   WTVELDGTTYRKGCKPVERLDFLGGSTSLSPCSSYQPSPFTSNNPSPASSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D    SLIPWL NLSSGSS +SS    + +I  GSISAPVTPP S
Sbjct  121  AANLNMDG--KSLIPWLKNLSSGSSSASSSKLPNFHIHTGSISAPVTPPFS  169



>ref|XP_004244287.1| PREDICTED: BES1/BZR1 homolog protein 4 [Solanum lycopersicum]
Length=315

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 140/171 (82%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYQLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ER+D +G S S+SPCSSYQPS   S NPSPASSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPMERLDFLGGSTSLSPCSSYQPSPFTSNNPSPASSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N N D    SLIPWL NLSSGSS +SS    + +I  GSISAPVTPP S
Sbjct  121  AANLNMDG--KSLIPWLKNLSSGSSSASSSKLPNFHIHTGSISAPVTPPFS  169



>ref|XP_010088009.1| hypothetical protein L484_004599 [Morus notabilis]
 gb|EXB31125.1| hypothetical protein L484_004599 [Morus notabilis]
Length=368

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 150/195 (77%), Gaps = 24/195 (12%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKI+ GLR YGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIYTGLRKYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRK---------------------GCKPT-ERMDIMGssvsvspcssyqps  418
            W VEEDGTTYRK                     G KP  +RMDIMG S S SPCSSYQPS
Sbjct  61   WTVEEDGTTYRKIPGGKFHYPFFSFDLETMHMMGSKPVLDRMDIMGGSTSASPCSSYQPS  120

Query  419  qGpsynpspasssfpspvssRYITN-NNNDTDPNSLIPWLXNL-ssgsspsssKLPHHLY  592
               SYNPSPASSSFPSPVSS Y T+ NN + DPNSLIPWL NL SSGSS ++SK PHHL+
Sbjct  121  PCASYNPSPASSSFPSPVSSHYKTSTNNTNHDPNSLIPWLKNLSSSGSSSATSKFPHHLF  180

Query  593  IPGGSISAPVTPPLS  637
            +  GSISAPVTPPLS
Sbjct  181  VHCGSISAPVTPPLS  195



>ref|XP_011082785.1| PREDICTED: BES1/BZR1 homolog protein 4 [Sesamum indicum]
 ref|XP_011082786.1| PREDICTED: BES1/BZR1 homolog protein 4 [Sesamum indicum]
Length=325

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MT GTR+P+WKERENNKRRERRRRAIAAKIFAGLR+YGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTGGTRMPSWKERENNKRRERRRRAIAAKIFAGLRLYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGC+P E MDI+G S SV+PCSSYQPS   SYNPSPASSSFPSPVSS Y
Sbjct  61   WTVEPDGTTYRKGCRPAENMDILGGSASVTPCSSYQPSPHTSYNPSPASSSFPSPVSSAY  120

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              + +   D NSLIPWL NLSS SS +SS    H Y+ GGSISAPVTPP S
Sbjct  121  --DPSIVADGNSLIPWLRNLSSSSSSASSSKFIHNYMHGGSISAPVTPPSS  169



>emb|CDX88466.1| BnaC06g39100D [Brassica napus]
Length=307

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 124/176 (70%), Gaps = 19/176 (11%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDI-MGssvsvspcssyqpsqGpsynpspasssfpspvss  478
            WIVE+DGTTYRKG  +P ERM+I +GS+ +    S        ++     +         
Sbjct  61   WIVEQDGTTYRKGSSRPVERMEIGVGSATTSPCASYNPSPVSSNFMSPSYA---------  111

Query  479  RYITNNNNDTDPNSLIPWLXNL---ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                 N    D  SLIPWL +L   SS S+ SSS+LP  +Y+PGGSISAPVTPPLS
Sbjct  112  -----NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPSFMYLPGGSISAPVTPPLS  162



>emb|CDX87440.1| BnaA07g34330D [Brassica napus]
Length=307

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 123/175 (70%), Gaps = 17/175 (10%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE+DGTTYRKG  +P ERM+ MG   + +   +       S +    S +        
Sbjct  61   WIVEQDGTTYRKGSSRPVERME-MGIGSATTSPCASFNPSPVSSSFMSPSYA--------  111

Query  482  YITNNNNDTDPNSLIPWLXNL---ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                N    D  SLIPWL +L   SS S+ SSS+LP  +Y+PGGSISAPVTPPLS
Sbjct  112  ----NLTTGDGQSLIPWLKHLSTTSSSSASSSSRLPSFMYLPGGSISAPVTPPLS  162



>emb|CDY01563.1| BnaC07g35530D [Brassica napus]
Length=276

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 126/172 (73%), Gaps = 16/172 (9%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIM-GssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE+DGTTYRKGCKPT+RM++M GS+ +    S     +G         S  PSP SS 
Sbjct  61   WTVEDDGTTYRKGCKPTDRMELMNGSTSASPCSSYQPSPRG---------SYNPSPSSSS  111

Query  482  YITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + +  N   D NSLIPWL NL   SS S SKLP   +  G SISAPVTPPL+
Sbjct  112  FPSPTNPFGDANSLIPWLKNL---SSKSPSKLP---FFNGNSISAPVTPPLA  157



>ref|XP_009136969.1| PREDICTED: BES1/BZR1 homolog protein 3-like [Brassica rapa]
Length=276

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 126/172 (73%), Gaps = 16/172 (9%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIM-GssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE+DGTTYRKGCKPT+RM++M GS+ +    S     +G         S  PSP SS 
Sbjct  61   WTVEDDGTTYRKGCKPTDRMELMNGSTSASPCSSYQPSPRG---------SYNPSPSSSS  111

Query  482  YITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + +  N   D NSLIPWL NL   SS S SKLP   +  G SISAPVTPPL+
Sbjct  112  FPSPTNPFGDANSLIPWLKNL---SSNSPSKLP---FFNGNSISAPVTPPLA  157



>emb|CDX98592.1| BnaA03g43770D [Brassica napus]
Length=276

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 126/172 (73%), Gaps = 16/172 (9%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIM-GssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE+DGTTYRKGCKPT+RM++M GS+ +    S     +G         S  PSP SS 
Sbjct  61   WTVEDDGTTYRKGCKPTDRMELMNGSTSASPCSSYQPSPRG---------SYNPSPSSSS  111

Query  482  YITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + +  N   D NSLIPWL NL   SS S SKLP   +  G SISAPVTPPL+
Sbjct  112  FPSPTNPFGDANSLIPWLKNL---SSNSPSKLP---FFNGNSISAPVTPPLA  157



>gb|KFK42252.1| hypothetical protein AALP_AA2G231000 [Arabis alpina]
Length=317

 Score =   131 bits (329),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 142/175 (81%), Gaps = 6/175 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PT++ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTYRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKG  +P ERM++   S + SPCSSYQPS   SYNPSP SS+F SP SS 
Sbjct  61   WIVELDGTTYRKGSSRPIERMELGNGSATASPCSSYQPSPCASYNPSPGSSNFMSPNSSS  120

Query  482  YITNNNNDTDPNSLIPWLXNL---ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            +   N    D  SLIPWL +L   SS S+ SSS+LP++LYIPGGSISAPVTPPLS
Sbjct  121  FA--NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLYIPGGSISAPVTPPLS  173



>gb|ABK21940.1| unknown [Picea sitchensis]
Length=367

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 124/171 (73%), Gaps = 6/171 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG+RLPTWKERENNK+RERRRRAIAAKI+AGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGSRLPTWKERENNKKRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCAEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W+VEEDGTTYRKGCKPTER+++ GSS      S +     P+ +  P+ +S      +  
Sbjct  61   WMVEEDGTTYRKGCKPTERIEVAGSSSVSPASSYHPS---PAPSYQPSPASSSFASPASS  117

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                      NSLIPWL NLSS SS SSS     L   GGSISAPVTPPLS
Sbjct  118  SFEPAGTGAANSLIPWLKNLSSSSSASSSG---RLIHGGGSISAPVTPPLS  165



>ref|XP_006284265.1| hypothetical protein CARUB_v10005431mg [Capsella rubella]
 gb|EOA17163.1| hypothetical protein CARUB_v10005431mg [Capsella rubella]
Length=284

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 128/171 (75%), Gaps = 14/171 (8%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP +RM++M  S S SPC         SY  SP +S  PSP SS +
Sbjct  61   WTVEEDGTTYRKGCKPMDRMELMNGSTSASPC--------SSYQHSPRASYNPSPSSSSF  112

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             +  N   D NSLIPWL NL   SS S SKLP   +  G SISAPVTPPL+
Sbjct  113  PSPTNPFGDANSLIPWLKNL---SSNSPSKLP---FFHGNSISAPVTPPLA  157



>ref|NP_193624.1| BES1/BZR1-like protein 3 [Arabidopsis thaliana]
 sp|O49404.1|BEH3_ARATH RecName: Full=BES1/BZR1 homolog protein 3 [Arabidopsis thaliana]
 emb|CAA16746.1| putative protein [Arabidopsis thaliana]
 emb|CAB78891.1| putative protein [Arabidopsis thaliana]
 gb|AAM65918.1| unknown [Arabidopsis thaliana]
 dbj|BAC43438.1| unknown protein [Arabidopsis thaliana]
 gb|ABD19693.1| At4g18890 [Arabidopsis thaliana]
 gb|AEE84102.1| BES1/BZR1-like protein 3 [Arabidopsis thaliana]
Length=284

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 128/171 (75%), Gaps = 14/171 (8%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE+DGTTYRKGCKP +RMD+M  S S SPC         SY  SP +S  PSP SS +
Sbjct  61   WTVEDDGTTYRKGCKPMDRMDLMNGSTSASPC--------SSYQHSPRASYNPSPSSSSF  112

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             +  N   D NSLIPWL NL   SS S SKLP   +  G SISAPVTPPL+
Sbjct  113  PSPTNPFGDANSLIPWLKNL---SSNSPSKLP---FFHGNSISAPVTPPLA  157



>ref|XP_009132289.1| PREDICTED: BES1/BZR1 homolog protein 3 [Brassica rapa]
 emb|CDX78903.1| BnaA01g09700D [Brassica napus]
Length=276

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 125/172 (73%), Gaps = 16/172 (9%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIM-GssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VEEDGTTYRKGCKP +RM++M GS+ +    S     +G         S  PSP SS 
Sbjct  61   WTVEEDGTTYRKGCKPMDRMELMNGSTSASPCSSYQPSPRG---------SYNPSPSSSS  111

Query  482  YITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + +  N   D NSLIPWL NL   SS S SKLP   +  G SISAPVTPPL+
Sbjct  112  FPSPTNIFGDANSLIPWLKNL---SSNSPSKLP---FFHGNSISAPVTPPLA  157



>ref|XP_008792311.1| PREDICTED: protein BZR1 homolog 3-like [Phoenix dactylifera]
Length=339

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 115/176 (65%), Gaps = 5/176 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            M SG RLPTW+ERENNKRRERRRRAIAAKI+ GLR YG++KLPKHCDNNEVLKALC EAG
Sbjct  1    MPSGARLPTWRERENNKRRERRRRAIAAKIYTGLRAYGDFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYR G KP  R+D      +     +       +       SS     SS Y
Sbjct  61   WTVEEDGTTYRTGSKPAARVDAAAGGSASPSPCTSYQPSPRASYNPSPPSSSFPSPSSSY  120

Query  485  IT---NNNNDTDPNSLIPWLXNLssgsspsssKLP--HHLYIPGGSISAPVTPPLS  637
            +T   N N   D  SLIPWL NLSS SS SS   P  HH Y+  GSISAPVTPPLS
Sbjct  121  VTHAHNANQGADGTSLIPWLKNLSSASSTSSLNPPSHHHFYMHAGSISAPVTPPLS  176



>ref|XP_009106588.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Brassica rapa]
Length=307

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 123/175 (70%), Gaps = 17/175 (10%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE+DGTTYRKG  +P ERM+ MG   + +   +       S +    S +        
Sbjct  61   WIVEQDGTTYRKGSSRPVERME-MGIGSATTSPCASYNPCPVSSSFMSPSYA--------  111

Query  482  YITNNNNDTDPNSLIPWLXNL---ssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                N    D  SLIPWL +L   SS S+ SSS+LP  +Y+PGGSISAP+TPPLS
Sbjct  112  ----NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPSFMYLPGGSISAPLTPPLS  162



>ref|XP_010434483.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
 ref|XP_010439796.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
 ref|XP_010449452.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
Length=284

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 128/171 (75%), Gaps = 14/171 (8%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE+DGTTYRKGCKP +RM++M  S S SPC         SY  SP +S  PSP SS +
Sbjct  61   WTVEDDGTTYRKGCKPMDRMELMNGSTSASPC--------SSYQHSPRASYNPSPSSSSF  112

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             +  N   D NSLIPWL NL   SS S SKLP   +  G SISAPVTPPL+
Sbjct  113  PSPTNPFGDANSLIPWLKNL---SSNSPSKLP---FFHGNSISAPVTPPLA  157



>gb|KFK28557.1| hypothetical protein AALP_AA7G011700 [Arabis alpina]
Length=284

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 129/171 (75%), Gaps = 14/171 (8%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCTEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE+DGTTYRKGCKP +RM++M  S S SPC         SY PSP +S  PSP SS +
Sbjct  61   WTVEDDGTTYRKGCKPMDRMELMNGSTSASPC--------SSYQPSPRASYNPSPSSSSF  112

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             +  N   D NSLIPWL NL   SS S SKLP   +  G SISAPVTPPL+
Sbjct  113  ASPTNPFGDANSLIPWLKNL---SSNSPSKLP---FFHGNSISAPVTPPLA  157



>ref|XP_006414043.1| hypothetical protein EUTSA_v10025918mg [Eutrema salsugineum]
 gb|ESQ55496.1| hypothetical protein EUTSA_v10025918mg [Eutrema salsugineum]
Length=285

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 125/172 (73%), Gaps = 16/172 (9%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIF+GLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFSGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIM-GssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE+DGTTYRKGCKP +RM++M GS+ +    S     +G         S  PSP SS 
Sbjct  61   WTVEDDGTTYRKGCKPMDRMELMNGSTSASPCSSYQPSPRG---------SYNPSPSSSS  111

Query  482  YITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + +  N   D NSLIPWL NL   SS S SKLP   +  G SISAPVTPPL+
Sbjct  112  FPSPTNPFGDANSLIPWLKNL---SSNSPSKLP---FFHGSSISAPVTPPLA  157



>ref|XP_002870016.1| hypothetical protein ARALYDRAFT_492971 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46275.1| hypothetical protein ARALYDRAFT_492971 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 128/171 (75%), Gaps = 14/171 (8%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE+DGTTYRKGC+P +RM++M  S S SPC         SY  SP +S  PSP SS +
Sbjct  61   WTVEDDGTTYRKGCRPMDRMELMNGSTSASPC--------SSYQHSPRASYNPSPSSSTF  112

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             +  N   D NSLIPWL NL   SS S SKLP   +  G SISAPVTPPL+
Sbjct  113  PSPTNPFGDANSLIPWLKNL---SSNSPSKLP---FFHGNSISAPVTPPLA  157



>ref|XP_002437132.1| hypothetical protein SORBIDRAFT_10g021750 [Sorghum bicolor]
 gb|EER88499.1| hypothetical protein SORBIDRAFT_10g021750 [Sorghum bicolor]
Length=356

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 138/176 (78%), Gaps = 9/176 (5%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            TR+PTW+ERENN+RRERRRRAIAAKIFAGLR YGNY LPKHCDNNEVLKALC EAGW VE
Sbjct  15   TRVPTWRERENNRRRERRRRAIAAKIFAGLRAYGNYNLPKHCDNNEVLKALCNEAGWTVE  74

Query  317  EDGTTYRKGCKP--TERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
             DGTTYRKGCKP  TER D +G S S SPCSSYQPS   SYNPSPASSSFPS  SS +IT
Sbjct  75   PDGTTYRKGCKPLATERPDPIGRSASPSPCSSYQPSPRASYNPSPASSSFPSSGSSSHIT  134

Query  491  NNNND----TDPNSLIPWLXNL-ssgsspsssKLP--HHLYIPGGSISAPVTPPLS  637
               N+     + NSLIPWL NL SS S  SSSK P  HHLY  GGSISAPVTPP S
Sbjct  135  LGGNNFMGGVEGNSLIPWLKNLSSSSSFASSSKFPQLHHLYFNGGSISAPVTPPSS  190



>ref|XP_004965584.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Setaria italica]
Length=356

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 138/176 (78%), Gaps = 9/176 (5%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            TR+PTW+ERENN+RRERRRRAIAAKIFAGLR YGNY LPKHCDNNEVLKALC EAGW VE
Sbjct  14   TRVPTWRERENNRRRERRRRAIAAKIFAGLRAYGNYNLPKHCDNNEVLKALCNEAGWTVE  73

Query  317  EDGTTYRKGCKPT--ERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
             DGTTYRKGCKPT  ER D +G S S SPCSSYQPS   SYNPSPASSSFPS  SS +IT
Sbjct  74   PDGTTYRKGCKPTAAERHDPIGRSASPSPCSSYQPSPRASYNPSPASSSFPSSGSSSHIT  133

Query  491  NNNND----TDPNSLIPWLXNL-ssgsspsssKLP--HHLYIPGGSISAPVTPPLS  637
               N+     + +SLIPWL NL SS S  SSSK P  HHLY  GGSISAPVTPP S
Sbjct  134  LGGNNFIGGVEGSSLIPWLKNLSSSSSIASSSKFPQLHHLYFNGGSISAPVTPPSS  189



>ref|XP_008790049.1| PREDICTED: protein BZR1 homolog 3-like [Phoenix dactylifera]
Length=315

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 128/174 (74%), Gaps = 27/174 (16%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKI+ GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIYTGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCK--PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvss  478
            WIVE DGTTYRKG K  P ERMD++G SVS SPC         SYNPSPASSSFPSP SS
Sbjct  61   WIVEPDGTTYRKGYKPPPAERMDVVGCSVSPSPC--------ASYNPSPASSSFPSPASS  112

Query  479  RYITNNNNDTDPNSLIPWLXNLssgsspsssKLP-HHLYIPGGSISAPVTPPLS  637
             YITN NN  +                 +    P HHLY+ GGSISAPVTPPLS
Sbjct  113  SYITNANNAVN----------------VADGNFPQHHLYMHGGSISAPVTPPLS  150



>emb|CBI20158.3| unnamed protein product [Vitis vinifera]
Length=106

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG RLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMG  376
            W VE DGTTYRKGCKP ERMDI+G
Sbjct  61   WTVEPDGTTYRKGCKPVERMDIVG  84



>ref|NP_001136786.1| BES transcription factor [Zea mays]
 gb|ACF82630.1| unknown [Zea mays]
 gb|ACG34754.1| brassinazole-resistant 1 protein [Zea mays]
 gb|ACR37890.1| unknown [Zea mays]
 gb|ADX60154.1| BES transcription factor [Zea mays]
 gb|ADX60163.1| MYBGA transcription factor, partial [Zea mays]
 gb|AFW86961.1| brassinazole-resistant 1 protein [Zea mays]
Length=355

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 136/176 (77%), Gaps = 9/176 (5%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            TR+PTW+ERENN+RRERRRRAIAAKIFAGLR YGNY LPKHCDNNEVLKALC EAGW VE
Sbjct  15   TRVPTWRERENNRRRERRRRAIAAKIFAGLRAYGNYNLPKHCDNNEVLKALCNEAGWTVE  74

Query  317  EDGTTYRKGCKP--TERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
             DGTTYRKGCKP  TER D +G S S SPCSSYQPS   SYNPS ASSSFPS  SS +IT
Sbjct  75   PDGTTYRKGCKPLATERPDPIGRSASPSPCSSYQPSPRASYNPSAASSSFPSSGSSSHIT  134

Query  491  ----NNNNDTDPNSLIPWLXNL-ssgsspsssKLP--HHLYIPGGSISAPVTPPLS  637
                N     + +SLIPWL NL SS S  SSSK P  HHLY  GGSISAPVTPP S
Sbjct  135  LGGSNFMGGVEGSSLIPWLKNLSSSSSFASSSKFPQLHHLYFNGGSISAPVTPPSS  190



>gb|EEC80795.1| hypothetical protein OsI_23332 [Oryza sativa Indica Group]
Length=354

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 134/176 (76%), Gaps = 9/176 (5%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            TR+PTW+ERENN+RRERRRRAIAAKI+AGLR YGNY LPKHCDNNEVLKALC EAGW VE
Sbjct  16   TRVPTWRERENNRRRERRRRAIAAKIYAGLRAYGNYNLPKHCDNNEVLKALCNEAGWTVE  75

Query  317  EDGTTYRKGCKP--TERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
             DGTTYRKGCKP   ER D +G S S SPCSSYQPS   SYNPSPASSSFPS  SS +IT
Sbjct  76   PDGTTYRKGCKPPQAERPDPIGRSASPSPCSSYQPSPRASYNPSPASSSFPSSGSSSHIT  135

Query  491  NNNND----TDPNSLIPWLXNLs-sgsspsssKLP--HHLYIPGGSISAPVTPPLS  637
               N      + +SLIPWL  L  S S  SSSK P  HHLY  GGSISAPVTPP S
Sbjct  136  IGGNSLIGGVEGSSLIPWLKTLPLSSSYASSSKFPQLHHLYFNGGSISAPVTPPSS  191



>ref|NP_001057840.1| Os06g0552300 [Oryza sativa Japonica Group]
 sp|Q5Z9E5.1|BZR3_ORYSJ RecName: Full=Protein BZR1 homolog 3; Short=OsBZR3; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 3 [Oryza sativa 
Japonica Group]
 dbj|BAD53662.1| putative mature anther-specific protein LAT61 [Oryza sativa Japonica 
Group]
 dbj|BAF19754.1| Os06g0552300 [Oryza sativa Japonica Group]
 dbj|BAG94965.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 134/176 (76%), Gaps = 9/176 (5%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            TR+PTW+ERENN+RRERRRRAIAAKI+AGLR YGNY LPKHCDNNEVLKALC EAGW VE
Sbjct  17   TRVPTWRERENNRRRERRRRAIAAKIYAGLRAYGNYNLPKHCDNNEVLKALCNEAGWTVE  76

Query  317  EDGTTYRKGCKP--TERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
             DGTTYRKGCKP   ER D +G S S SPCSSYQPS   SYNPSPASSSFPS  SS +IT
Sbjct  77   PDGTTYRKGCKPPQAERPDPIGRSASPSPCSSYQPSPRASYNPSPASSSFPSSGSSSHIT  136

Query  491  NNNND----TDPNSLIPWLXNLs-sgsspsssKLP--HHLYIPGGSISAPVTPPLS  637
               N      + +SLIPWL  L  S S  SSSK P  HHLY  GGSISAPVTPP S
Sbjct  137  IGGNSLIGGVEGSSLIPWLKTLPLSSSYASSSKFPQLHHLYFNGGSISAPVTPPSS  192



>ref|XP_003563774.1| PREDICTED: protein BZR1 homolog 3 [Brachypodium distachyon]
Length=355

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 136/176 (77%), Gaps = 9/176 (5%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            TR+PTW+ERENN+RRERRRRAIAAKI+ GLR YGNY LPKHCDNNEVLKALC EAGW+VE
Sbjct  17   TRVPTWRERENNRRRERRRRAIAAKIYTGLRAYGNYNLPKHCDNNEVLKALCNEAGWVVE  76

Query  317  EDGTTYRKGCK--PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
             DGTTYRKGCK  P  R D +G S S SPCSSYQPS   SYNPSPASSSFPS  SS +IT
Sbjct  77   PDGTTYRKGCKPPPQARHDPLGRSASPSPCSSYQPSPRASYNPSPASSSFPSSGSSSHIT  136

Query  491  NNNND----TDPNSLIPWLXNL-ssgsspsssKLP--HHLYIPGGSISAPVTPPLS  637
               N+     + +SLIPWL NL S+ S  SSSK P  HHLY  GGSISAPVTPP S
Sbjct  137  LGGNNLIGGVEGSSLIPWLKNLSSNPSFASSSKFPQLHHLYFNGGSISAPVTPPSS  192



>gb|ACU18376.1| unknown [Glycine max]
Length=125

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNK+RERRRRAIAAKIFAGLR+YGN+KLPKHCDNNEVLKALC +AG
Sbjct  1    MTSGTRLPTWKERENNKKRERRRRAIAAKIFAGLRVYGNFKLPKHCDNNEVLKALCNKAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMG  376
            W VE DGTTYRKGCKP+E M+I+G
Sbjct  61   WTVEPDGTTYRKGCKPSEGMEIVG  84



>gb|EMT21245.1| hypothetical protein F775_32777 [Aegilops tauschii]
Length=335

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 132/171 (77%), Gaps = 7/171 (4%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKI+ GLR YGNY LPKHCDNNEVLKALC EAGW+VE 
Sbjct  25   RMPTWRERENNKRRERRRRAIAAKIYTGLRAYGNYNLPKHCDNNEVLKALCNEAGWVVEP  84

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKGC+P ERMD +G SVS SPCSSYQPS   SYN SP SSSFPS  SS ++ ++N
Sbjct  85   DGTTYRKGCRPAERMDGIGCSVSPSPCSSYQPSPRASYNASPTSSSFPSGASSPFLPHSN  144

Query  500  ---NDTDPNSLIPWLXNLssgsspsssKLPH--HLYIPGGSISAPVTPPLS  637
               N  D   ++PWL      +S +S+K PH   L I GGSISAPVTPPLS
Sbjct  145  NMVNGVDATPILPWLQTF--SNSTASNKRPHLPPLLIHGGSISAPVTPPLS  193



>ref|XP_004968562.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Setaria italica]
Length=347

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 128/168 (76%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE 
Sbjct  21   RMPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEP  80

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKG KP ER+D +G SVS SPCSSYQ S   SYN SP SSSFPS  SS ++  N 
Sbjct  81   DGTTYRKGSKPQERVDAIGCSVSPSPCSSYQLSPRASYNASPTSSSFPSGASSPFLPPNE  140

Query  500  --NDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N  D N ++PWL  LS+G+      L   L I GGSISAPVTPPLS
Sbjct  141  MANGIDGNPILPWLKTLSNGTPSKKHPLLPPLLIHGGSISAPVTPPLS  188



>ref|XP_003565213.1| PREDICTED: protein BZR1 homolog 2 [Brachypodium distachyon]
Length=355

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 130/169 (77%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKIF+GLR +G YKLPKHCDNNEVLKALC EAGW+VE 
Sbjct  22   RMPTWRERENNKRRERRRRAIAAKIFSGLRSHGGYKLPKHCDNNEVLKALCNEAGWVVEP  81

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKGC+PTERMD +G SVS SPCSSYQPS   SY+ SP SSSFPS  SS +  ++N
Sbjct  82   DGTTYRKGCRPTERMDAIGCSVSPSPCSSYQPSPRASYHGSPTSSSFPSGASSPFPPHSN  141

Query  500  ND---TDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            N     D   ++PWL   S+ ++ +       L I GGSISAPVTPPLS
Sbjct  142  NTVNGVDATPILPWLQTFSNSTTSNKRPYLPPLLIHGGSISAPVTPPLS  190



>ref|XP_002454981.1| hypothetical protein SORBIDRAFT_03g002480 [Sorghum bicolor]
 gb|EES00101.1| hypothetical protein SORBIDRAFT_03g002480 [Sorghum bicolor]
Length=348

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 127/169 (75%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE 
Sbjct  21   RMPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEP  80

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNN-  496
            DGTTYRKG KP ERMD +G SVS SPCSSYQ S   SYN SP SSSFPS  SS ++  N 
Sbjct  81   DGTTYRKGSKPMERMDHIGCSVSPSPCSSYQVSPRASYNASPTSSSFPSGASSPFLPPNE  140

Query  497  --NNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N   D N ++PWL   S+G+      L   L I GGSISAPVTPPLS
Sbjct  141  MVNGGIDGNPILPWLKTFSNGTPSKKHPLLPPLLIHGGSISAPVTPPLS  189



>gb|EYU29527.1| hypothetical protein MIMGU_mgv1a010055mg [Erythranthe guttata]
Length=324

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 124/182 (68%), Gaps = 11/182 (6%)
 Frame = +2

Query  125  MTSG--TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKE  298
            MT G   R+P+WKERENNKRRERRRRAIAAKIFAGLR+YGNYKLPKHCDNNEVLKALC E
Sbjct  1    MTGGGAARMPSWKERENNKRRERRRRAIAAKIFAGLRLYGNYKLPKHCDNNEVLKALCDE  60

Query  299  AGWIVEEDGTTYRKGCKPTERMDIM------GssvsvspcssyqpsqGpsynpspasssf  460
            AGW VE DGTTYRKGC+P E MD M       +  S +P      +  P  + +P+ +S 
Sbjct  61   AGWTVEHDGTTYRKGCRPVENMDTMETSYNPSTHTSYNPSPHTSYNPSPHTSYNPSPASS  120

Query  461  pspvssRYITNNNNDTDPNSLIPWLXNL--ssgsspsssKLPHHLYIP-GGSISAPVTPP  631
              P     I   +   D NSLIPWL NL  SS S+ SSSK  HH Y+   G++SAPVTPP
Sbjct  121  SFPSPVSSIYAPSIIADGNSLIPWLRNLSSSSSSATSSSKFVHHHYMHNSGTVSAPVTPP  180

Query  632  LS  637
            LS
Sbjct  181  LS  182



>gb|ACG41016.1| brassinazole-resistant 1 protein [Zea mays]
Length=346

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 128/168 (76%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE 
Sbjct  17   RMPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEP  76

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYR+G KP ERMD +G SVS SPCSSYQPS   SYN SP SSSFPS  SS ++  N 
Sbjct  77   DGTTYRQGSKPMERMDPIGCSVSPSPCSSYQPSPRASYNASPTSSSFPSGASSPFLPPNE  136

Query  500  --NDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N  D N ++PWL   S+G+      L   L I GGSISAPVTPPLS
Sbjct  137  MPNGIDGNPILPWLKTFSNGTPSKKHPLLPPLLIHGGSISAPVTPPLS  184



>ref|NP_001132634.1| uncharacterized protein LOC100194109 [Zea mays]
 gb|ACF81562.1| unknown [Zea mays]
 gb|ACG40609.1| brassinazole-resistant 1 protein [Zea mays]
Length=345

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 128/168 (76%), Gaps = 2/168 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE 
Sbjct  17   RMPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEP  76

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYR+G KP ERMD +G SVS SPCSSYQPS   SYN SP SSSFPS  SS ++  N 
Sbjct  77   DGTTYRQGSKPMERMDPIGCSVSPSPCSSYQPSPRASYNASPTSSSFPSGASSPFLPPNE  136

Query  500  --NDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N  D N ++PWL   S+G+      L   L I GGSISAPVTPPLS
Sbjct  137  MPNGIDGNPILPWLKTFSNGTPSKKHPLLPPLLIHGGSISAPVTPPLS  184



>ref|XP_010675300.1| PREDICTED: BES1/BZR1 homolog protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=286

 Score =   117 bits (292),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 130/169 (77%), Gaps = 4/169 (2%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            ++ TR P+WKERENNK+RER+RRAI+AKIF+GLR YGNYKLPKHCDNN+VLKALC EAGW
Sbjct  9    STSTRTPSWKERENNKKRERKRRAISAKIFSGLRTYGNYKLPKHCDNNQVLKALCNEAGW  68

Query  308  IVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYI  487
             VE DGTTYRKGCKP + +DI+ +S+S SP SSYQPS+  S++ SPASSS  SP SS Y 
Sbjct  69   TVEPDGTTYRKGCKPIKPLDIIHTSISTSPNSSYQPSRSASFHASPASSSLASPASSSY-  127

Query  488  TNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPL  634
            T N       SLIPWL N+   S  SSSKLP HL I   SISAPVTP L
Sbjct  128  TANTIFLQGTSLIPWLKNI--SSPASSSKLP-HLCIHKNSISAPVTPAL  173



>emb|CDM82126.1| unnamed protein product [Triticum aestivum]
Length=333

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 132/170 (78%), Gaps = 7/170 (4%)
 Frame = +2

Query  143  LPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEED  322
            +PTW+ERENNKRRERRRRAIAAKIF+GLR +G YKLPKHCDNNEVLKALC EAGW+VE D
Sbjct  1    MPTWRERENNKRRERRRRAIAAKIFSGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEPD  60

Query  323  GTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN-  499
            GTTYRKGC+P ERMD +G SVS SPCSSYQPS   SYN SP SSSFPS  SS ++ ++N 
Sbjct  61   GTTYRKGCRPAERMDGIGCSVSPSPCSSYQPSPRASYNASPTSSSFPSGASSPFLPHSNN  120

Query  500  --NDTDPNSLIPWLXNLssgsspsssKLPH--HLYIPGGSISAPVTPPLS  637
              N  D   ++PWL      +S +S+K PH   L I GGSISAPVTPPLS
Sbjct  121  MVNGVDATPILPWLQTF--SNSTASNKRPHLPPLLIHGGSISAPVTPPLS  168



>ref|NP_001042330.1| Os01g0203000 [Oryza sativa Japonica Group]
 sp|Q0JPT4.1|BZR2_ORYSJ RecName: Full=Protein BZR1 homolog 2; Short=OsBZR2; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 2 [Oryza sativa 
Japonica Group]
 dbj|BAF04244.1| Os01g0203000, partial [Oryza sativa Japonica Group]
Length=365

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 129/169 (76%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE 
Sbjct  31   RMPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEP  90

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKG KP ERM+++G SVS SPCSSYQPS   SYN SP SSSFPS  SS ++ + N
Sbjct  91   DGTTYRKGYKPPERMEVIGCSVSPSPCSSYQPSPRASYNASPTSSSFPSGASSPFLPHPN  150

Query  500  ---NDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
               N  D N ++PWL  LS+  S         L I GGSISAPVTPPLS
Sbjct  151  NMANGVDGNPILPWLKTLSNSPSSKKHPQLPPLLIHGGSISAPVTPPLS  199



>dbj|BAB33003.1| unknown protein [Oryza sativa Japonica Group]
Length=354

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 129/169 (76%), Gaps = 3/169 (2%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE 
Sbjct  20   RMPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEP  79

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKG KP ERM+++G SVS SPCSSYQPS   SYN SP SSSFPS  SS ++ + N
Sbjct  80   DGTTYRKGYKPPERMEVIGCSVSPSPCSSYQPSPRASYNASPTSSSFPSGASSPFLPHPN  139

Query  500  ---NDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
               N  D N ++PWL  LS+  S         L I GGSISAPVTPPLS
Sbjct  140  NMANGVDGNPILPWLKTLSNSPSSKKHPQLPPLLIHGGSISAPVTPPLS  188



>ref|XP_002983955.1| hypothetical protein SELMODRAFT_451483 [Selaginella moellendorffii]
 gb|EFJ14967.1| hypothetical protein SELMODRAFT_451483 [Selaginella moellendorffii]
Length=531

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 110/171 (64%), Gaps = 17/171 (10%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG RLPTWKERENNK+RERRRRAIA+KIF+GLR +GNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARLPTWKERENNKKRERRRRAIASKIFSGLRQFGNYKLPKHCDNNEVLKALCAEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W+VEEDGTTYRKG KP ERM++  S+ +    +S     G         S+  +  ++  
Sbjct  61   WVVEEDGTTYRKGAKPVERMEVCASAPASPSPTSSYHGGG---------SNGHTLTTTTP  111

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                       SLIPWL  L      S +  P   +   G+ SAPVTPPLS
Sbjct  112  TEQGTTTASGASLIPWLKGL------SGTTTPTSCFH--GASSAPVTPPLS  154



>ref|XP_002960716.1| hypothetical protein SELMODRAFT_437216 [Selaginella moellendorffii]
 gb|EFJ38255.1| hypothetical protein SELMODRAFT_437216 [Selaginella moellendorffii]
Length=530

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 110/171 (64%), Gaps = 17/171 (10%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG RLPTWKERENNK+RERRRRAIA+KIF+GLR +GNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARLPTWKERENNKKRERRRRAIASKIFSGLRQFGNYKLPKHCDNNEVLKALCAEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W+VEEDGTTYRKG KP ERM++  S+ +    +S     G         S+  +  ++  
Sbjct  61   WVVEEDGTTYRKGAKPVERMEVCASAPASPSPTSSYHGGG---------SNGHTLTTTTP  111

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                       SLIPWL  L      S +  P   +   G+ SAPVTPPLS
Sbjct  112  TEQGTTTASGASLIPWLKGL------SGTTTPTSCFH--GASSAPVTPPLS  154



>gb|EEC70129.1| hypothetical protein OsI_00807 [Oryza sativa Indica Group]
Length=334

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 128/168 (76%), Gaps = 3/168 (2%)
 Frame = +2

Query  143  LPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEED  322
            +PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE D
Sbjct  1    MPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEPD  60

Query  323  GTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN-  499
            GTTYRKG KP ERM+++G SVS SPCSSYQPS   SYN SP SSSFPS  SS ++ + N 
Sbjct  61   GTTYRKGYKPPERMEVIGCSVSPSPCSSYQPSPRASYNASPTSSSFPSGASSPFLPHPNN  120

Query  500  --NDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N  D N ++PWL  LS+  S         L I GGSISAPVTPPLS
Sbjct  121  MANGVDGNPILPWLKTLSNSPSSKKHPQLPPLLIHGGSISAPVTPPLS  168



>gb|EEE54074.1| hypothetical protein OsJ_00786 [Oryza sativa Japonica Group]
Length=334

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 128/168 (76%), Gaps = 3/168 (2%)
 Frame = +2

Query  143  LPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEED  322
            +PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE D
Sbjct  1    MPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEPD  60

Query  323  GTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN-  499
            GTTYRKG KP ERM+++G SVS SPCSSYQPS   SYN SP SSSFPS  SS ++ + N 
Sbjct  61   GTTYRKGYKPPERMEVIGCSVSPSPCSSYQPSPRASYNASPTSSSFPSGASSPFLPHPNN  120

Query  500  --NDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
              N  D N ++PWL  LS+  S         L I GGSISAPVTPPLS
Sbjct  121  MANGVDGNPILPWLKTLSNSPSSKKHPQLPPLLIHGGSISAPVTPPLS  168



>dbj|BAJ97997.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91390.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=357

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 118/176 (67%), Gaps = 9/176 (5%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            TR+PTW+ERENN+RRERRRRAIAAKI+ GLR YGNY LPKHCDNNEVLKALC EAGW+VE
Sbjct  17   TRVPTWRERENNRRRERRRRAIAAKIYTGLRAYGNYNLPKHCDNNEVLKALCNEAGWVVE  76

Query  317  EDGTTYRKGCK--PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
             DGTTYR+GCK  P  R D M S+ +    S     +        +SS   S  SS    
Sbjct  77   PDGTTYRRGCKPPPQARPDPMRSASASPCSSYQPSPRASYNPSPASSSFPSSGSSSHITL  136

Query  491  NNNND----TDPNSLIPWLXNL-ssgsspsssKLP--HHLYIPGGSISAPVTPPLS  637
               N+     + +SLIPWL NL S+ S  SSSKLP  HHLY  GGSISAPVTPP S
Sbjct  137  GGGNNFIGGVEGSSLIPWLKNLSSNPSFASSSKLPQLHHLYFNGGSISAPVTPPSS  192



>ref|XP_001782618.1| predicted protein [Physcomitrella patens]
 gb|EDQ52607.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 110/178 (62%), Gaps = 36/178 (20%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLR+YGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRLYGNYKLPKHCDNNEVLKALCVEAG  60

Query  305  WIVEEDGTTYRKGCK-PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VEEDGTTYRKG K P + M++                               SP    
Sbjct  61   WTVEEDGTTYRKGSKPPAQPMEVC-----------------------------TSPSEVS  91

Query  482  YITNNNNDTDPNSLIPWLXNLs------sgsspsssKLPHHLYIPGGSISAPVTPPLS  637
               +    TD  SLIPWL  LS      + +  SS+ LP    + GGS SAPVTPPLS
Sbjct  92   PTNSYPGATDGTSLIPWLKGLSSNGGSGAATPSSSAGLPPLHVMHGGSSSAPVTPPLS  149



>emb|CDX99414.1| BnaC01g11380D [Brassica napus]
Length=308

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 122/204 (60%), Gaps = 48/204 (24%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRK--------------------------------GCKPTERMDIM-Gssv  385
            W VEEDGTTYRK                                GCKP +R+++M GS+ 
Sbjct  61   WTVEEDGTTYRKRKRKILMMQIGRLRFSFYRFSGHGKRQIETVLGCKPMDRVELMNGSTS  120

Query  386  svspcssyqpsqGpsynpspasssfpspvssRYITNNNNDTDPNSLIPWLXNLssgssps  565
            +    S     +G       +SS         + +  N   D NSLIPWL NL   SS S
Sbjct  121  ASPCSSYQPSPRGSYNPSPSSSS---------FPSPTNIFGDANSLIPWLKNL---SSNS  168

Query  566  ssKLPHHLYIPGGSISAPVTPPLS  637
             SKLP   +  G SISAPVTPPL+
Sbjct  169  PSKLP---FFHGNSISAPVTPPLA  189



>ref|XP_001782551.1| predicted protein [Physcomitrella patens]
 gb|EDQ52626.1| predicted protein [Physcomitrella patens]
Length=633

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 112/179 (63%), Gaps = 36/179 (20%)
 Frame = +2

Query  122  EMTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEA  301
            +MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLR+YGNYKLPKHCDNNEVLKALC EA
Sbjct  177  DMTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRLYGNYKLPKHCDNNEVLKALCVEA  236

Query  302  GWIVEEDGTTYRKGCK-PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvss  478
            GW VEEDGTTYRKG K P + M++                               SP  +
Sbjct  237  GWTVEEDGTTYRKGSKPPAQPMEVC-----------------------------TSPSEA  267

Query  479  RYITNNNNDTDPNSLIPWLXNLss------gsspsssKLPHHLYIPGGSISAPVTPPLS  637
               ++     +  SLIPWL  LSS       +  SS+ LP    + GGS SAPVTPPLS
Sbjct  268  SPTSSYPGAAEGTSLIPWLKGLSSNGGSGTATPSSSAGLPPLHVMHGGSSSAPVTPPLS  326



>gb|EMT29878.1| hypothetical protein F775_52316 [Aegilops tauschii]
Length=355

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 92/150 (61%), Gaps = 9/150 (6%)
 Frame = +2

Query  215  FAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCK--PTERMDIMGssvs  388
            + GLR YGNY LPKHCDNNEVLKALC EAGW+VE DGTTYR+GCK  P  R D M S+ +
Sbjct  42   YTGLRAYGNYNLPKHCDNNEVLKALCNEAGWVVEPDGTTYRRGCKPPPQARTDPMRSASA  101

Query  389  vspcssyqpsqGpsynpspasssfpspvssRYITNNNND----TDPNSLIPWLXNL-ssg  553
                S     +        +SS   S  SS       N+     + +SLIPWL NL S+ 
Sbjct  102  SPCSSYQPSPRASYNPSPASSSFPSSGSSSHITLGGGNNFIGGVEGSSLIPWLKNLSSNP  161

Query  554  sspsssKLP--HHLYIPGGSISAPVTPPLS  637
            S  SSSKLP  HHLY  GGSISAPVTPP S
Sbjct  162  SFASSSKLPQLHHLYFNGGSISAPVTPPSS  191



>gb|ADE77805.1| unknown [Picea sitchensis]
Length=302

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 109/175 (62%), Gaps = 35/175 (20%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG RLPT KERENNKRRERRRRAIAA+IFAGLR+YGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGGRLPTSKERENNKRRERRRRAIAARIFAGLRLYGNYKLPKHCDNNEVLKALCAEAG  60

Query  305  WIVEEDGTTYR---KGC-KPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspv  472
            WIV++DGTTYR    GC + +ER D                            SS PS V
Sbjct  61   WIVDQDGTTYRPGTHGCTRISEREDC-------------------------GISSSPSAV  95

Query  473  ssRYITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            ++ Y + N       SLIPWL  L S    +   LP    I GGS SAPVTPPL+
Sbjct  96   AATYQSGN------GSLIPWLKGLGSNRLATQRALPPLQIITGGSCSAPVTPPLT  144



>gb|EMS63049.1| hypothetical protein TRIUR3_11319 [Triticum urartu]
Length=544

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 116/174 (67%), Gaps = 9/174 (5%)
 Frame = +2

Query  143  LPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEED  322
            +PTW+ERENN+RRERRRRAIAAKI+ GLR YGNY LPKHCDNNEVLKALC EAGW+VE D
Sbjct  207  VPTWRERENNRRRERRRRAIAAKIYTGLRAYGNYNLPKHCDNNEVLKALCNEAGWVVEPD  266

Query  323  GTTYRKGCK--PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNN  496
            GTTYR+GCK  P  R D M S+ +    S     +        +SS   S  SS      
Sbjct  267  GTTYRRGCKPPPQARPDPMRSASASPCSSYQPSPRASYNPSPASSSFPSSGSSSHITLGG  326

Query  497  NND----TDPNSLIPWLXNL-ssgsspsssKLP--HHLYIPGGSISAPVTPPLS  637
             N+     + +SLIPWL NL S+ S  SSSKLP  HHLY  GGSISAPVTPP S
Sbjct  327  GNNFIGGVEGSSLIPWLKNLSSNPSFASSSKLPQLHHLYFNGGSISAPVTPPSS  380



>ref|XP_010559011.1| PREDICTED: BES1/BZR1 homolog protein 3-like [Tarenaya hassleriana]
Length=135

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRK  340
            W VEEDGTTYRK
Sbjct  61   WTVEEDGTTYRK  72



>gb|ABR18463.1| unknown [Picea sitchensis]
Length=407

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            +G+RLPTWKERENNKRRERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALC EAGW 
Sbjct  2    TGSRLPTWKERENNKRRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCNEAGWQ  61

Query  311  VEEDGTTYRKGCKPTERMDIMG  376
            VEEDGTTYRKGC P ERM+  G
Sbjct  62   VEEDGTTYRKGCPPPERMETGG  83



>ref|XP_003571150.2| PREDICTED: protein BZR1 homolog 3-like [Brachypodium distachyon]
Length=378

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 110/179 (61%), Gaps = 23/179 (13%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            +R+PTW+ERENN+RRERRRRAIAAKIF+GLR YGNY LPKHCDNNEVLKALC EAGW VE
Sbjct  17   SRVPTWRERENNRRRERRRRAIAAKIFSGLRSYGNYTLPKHCDNNEVLKALCDEAGWTVE  76

Query  317  EDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT--  490
             DGTTYRKG KP    +  G               G     S    S  +  SS +IT  
Sbjct  77   PDGTTYRKGSKPPTAAERAG---------DLLAHSGSPSPCSSYQVSPRASSSSSHITLG  127

Query  491  ------NNNNDTDPNSLIPWLXNLssgss---psssKLP---HHLYIPGGSISAPVTPP  631
                        + +SLIPWL NLSS +S    SSSK P   HH Y  GGSISAPVTPP
Sbjct  128  AGCGGGYFGGGVEGSSLIPWLKNLSSSTSNNIASSSKYPGGAHHPYFNGGSISAPVTPP  186



>sp|Q6EUF1.2|BZR4_ORYSJ RecName: Full=Protein BZR1 homolog 4; Short=OsBZR4; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 4 [Oryza sativa 
Japonica Group]
Length=351

 Score =   107 bits (268),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 115/173 (66%), Gaps = 13/173 (8%)
 Frame = +2

Query  134  GTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIV  313
            G R+PTW+ERENN+RRERRRRAIAAKI+AGLR YGNY LPKHCDNNEVLKALC EAGW V
Sbjct  7    GGRVPTWRERENNRRRERRRRAIAAKIYAGLRAYGNYTLPKHCDNNEVLKALCNEAGWTV  66

Query  314  EEDGTTYRKGCKP--TERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYI  487
            E DGTTYRKGCKP  +E  D +G S S SPCSS         +P   SS   S  SS+  
Sbjct  67   EPDGTTYRKGCKPPASELADQLGRSPSASPCSS------YQPSPRGTSSFPSSGSSSQIT  120

Query  488  TNNNNDTDPNSLIPWLXNL----ssgsspsssKLP-HHLYIPGGSISAPVTPP  631
                   + +SLIPWL  L          SSSK P H+ Y  GGSISAPVTPP
Sbjct  121  LGGGGGGEGSSLIPWLKTLSSAGVGIGGGSSSKFPAHYSYFGGGSISAPVTPP  173



>ref|XP_010254939.1| PREDICTED: BES1/BZR1 homolog protein 2 [Nelumbo nucifera]
Length=316

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 122/170 (72%), Gaps = 9/170 (5%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR YGNYKLPKHCDNNEVLKALC EAGWI
Sbjct  5    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAYGNYKLPKHCDNNEVLKALCAEAGWI  64

Query  311  VEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
            VEEDGTTYRKGCKP       G+S ++SPCSSYQPS   S  PSP  S   SP SS + +
Sbjct  65   VEEDGTTYRKGCKPPPSDAAAGTSTNISPCSSYQPSPASSSFPSPVPSYHASPTSSSFPS  124

Query  491  NNNNDTDPNS-LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             +  D +P+S ++P+L NL        + +P  L     S SAPVTPPLS
Sbjct  125  PSRMDANPSSYILPFLRNL--------AAIPSSLPPLRISNSAPVTPPLS  166



>ref|XP_010680895.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=320

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 120/167 (72%), Gaps = 10/167 (6%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            RLPTWKERENNK+RERRRRAIAAKIF GLR  G+YKLPKHCDNNEVLKALC+EAGWIVEE
Sbjct  7    RLPTWKERENNKKRERRRRAIAAKIFTGLRAQGSYKLPKHCDNNEVLKALCREAGWIVEE  66

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKGC P   MD+ G+S ++S CSS Q S   S  PSP  S   SP SS + + + 
Sbjct  67   DGTTYRKGCNPPP-MDMAGTSANISACSSLQQSPQSSAYPSPIPSYHASPTSSSFPSPSR  125

Query  500  NDTDP-NSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             D++P N L+P+L NL        + +P +L     S SAPVTPPLS
Sbjct  126  YDSNPSNYLLPFLRNL--------ASIPTNLPPIRISSSAPVTPPLS  164



>ref|XP_009374228.1| PREDICTED: BES1/BZR1 homolog protein 2 [Pyrus x bretschneideri]
Length=315

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 120/169 (71%), Gaps = 9/169 (5%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  G+YKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWV  65

Query  311  VEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
            VEEDGTTYRKGCKP+  M+I G+  ++S CSS Q S   S  PSP  S   SP SS + +
Sbjct  66   VEEDGTTYRKGCKPSP-MEIAGAPTNMSACSSIQQSPQSSAFPSPVPSYHASPSSSSFPS  124

Query  491  NNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                D +P+ L+P+L N+        + +P +L     S SAPVTPPLS
Sbjct  125  PTRFDGNPSYLLPFLRNI--------ASIPTNLPPLRISNSAPVTPPLS  165



>ref|XP_006377532.1| hypothetical protein POPTR_0011s06810g [Populus trichocarpa]
 gb|ERP55329.1| hypothetical protein POPTR_0011s06810g [Populus trichocarpa]
Length=124

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKI+AGLRMYG+YKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIYAGLRMYGSYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRK  340
            W VEEDGTTYRK
Sbjct  61   WTVEEDGTTYRK  72



>ref|XP_009349751.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Pyrus x bretschneideri]
Length=316

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 120/170 (71%), Gaps = 10/170 (6%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  G+YKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWV  65

Query  311  VEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
            VEEDGTTYRKGCKP+  M+I G+  ++S CSS   S   S  PSP  S   SP SS + +
Sbjct  66   VEEDGTTYRKGCKPSP-MEIAGTPTNISACSSILQSPQSSAFPSPVPSYHASPSSSSFPS  124

Query  491  NNNNDTDPNS-LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                D +P+S L+P+L N+        + +P +L     S SAPVTPPLS
Sbjct  125  PARFDGNPSSYLLPFLRNI--------ASIPTNLPPLRISNSAPVTPPLS  166



>ref|XP_002273547.1| PREDICTED: BES1/BZR1 homolog protein 2 [Vitis vinifera]
Length=316

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 119/170 (70%), Gaps = 10/170 (6%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNK+RERRRRAIAAKI+AGLR  GNYKLPKHCDNNEVLKALC EAGW 
Sbjct  6    SSGRLPTWKERENNKKRERRRRAIAAKIYAGLRAQGNYKLPKHCDNNEVLKALCSEAGWT  65

Query  311  VEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
            VEEDGTTYRKGCKP    +I G+S ++S CSS QPS   S  PSP  S   SP SS + +
Sbjct  66   VEEDGTTYRKGCKPPP-TEIAGASANISACSSMQPSPQSSSFPSPVPSYHASPSSSSFPS  124

Query  491  NNNNDTDPNS-LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                D +P+S L+P+L NL        + +P  L     S SAPVTPPLS
Sbjct  125  PTRFDGNPSSYLLPFLRNL--------ASIPTSLPPLRISNSAPVTPPLS  166



>ref|XP_002965931.1| hypothetical protein SELMODRAFT_407084 [Selaginella moellendorffii]
 gb|EFJ33351.1| hypothetical protein SELMODRAFT_407084 [Selaginella moellendorffii]
Length=358

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG+R PT++ERENNKRRERRRRAIAAKIF GLR  GNY LPKHCDNNEVLKALC+EAG
Sbjct  1    MTSGSRTPTFRERENNKRRERRRRAIAAKIFNGLRQLGNYNLPKHCDNNEVLKALCREAG  60

Query  305  WIVEEDGTTYRKGCKPTERMD  367
            W+VE+DGTTYRKG +P ER+D
Sbjct  61   WVVEDDGTTYRKGSRPMERLD  81



>ref|XP_008241630.1| PREDICTED: BES1/BZR1 homolog protein 2 [Prunus mume]
Length=317

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 121/170 (71%), Gaps = 10/170 (6%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  G+YKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWV  65

Query  311  VEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
            VEEDGTTYRKGCKP+  M+I G+  ++S CSS Q S   S  PSP  S   SP SS + +
Sbjct  66   VEEDGTTYRKGCKPSP-MEIAGTPTNMSACSSIQQSPQSSAFPSPVPSYHASPSSSSFPS  124

Query  491  NNNNDTDPNS-LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                D +P+S L+P+L N+        + +P +L     S SAPVTPPLS
Sbjct  125  PTRFDGNPSSYLLPFLRNI--------ASIPANLPPLRISNSAPVTPPLS  166



>ref|XP_002968357.1| hypothetical protein SELMODRAFT_409126 [Selaginella moellendorffii]
 gb|EFJ30611.1| hypothetical protein SELMODRAFT_409126 [Selaginella moellendorffii]
Length=359

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG+R PT++ERENNKRRERRRRAIAAKIF GLR  GNY LPKHCDNNEVLKALC+EAG
Sbjct  1    MTSGSRTPTFRERENNKRRERRRRAIAAKIFNGLRQLGNYNLPKHCDNNEVLKALCREAG  60

Query  305  WIVEEDGTTYRKGCKPTERMD  367
            W+VE+DGTTYRKG +P ER+D
Sbjct  61   WVVEDDGTTYRKGSRPMERLD  81



>ref|XP_007202252.1| hypothetical protein PRUPE_ppa008842mg [Prunus persica]
 gb|EMJ03451.1| hypothetical protein PRUPE_ppa008842mg [Prunus persica]
Length=317

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 121/170 (71%), Gaps = 10/170 (6%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  G+YKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWV  65

Query  311  VEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
            VEEDGTTYRKGCKP+  M+I G+  ++S CSS Q S   S  PSP  S   SP SS + +
Sbjct  66   VEEDGTTYRKGCKPSP-MEIAGTPTNMSACSSIQQSPQSSAFPSPVPSYHASPSSSSFPS  124

Query  491  NNNNDTDPNS-LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                D +P+S L+P+L N+        + +P +L     S SAPVTPPLS
Sbjct  125  PTRFDGNPSSYLLPFLRNI--------ASIPTNLPPLRISNSAPVTPPLS  166



>ref|XP_010093488.1| hypothetical protein L484_017551 [Morus notabilis]
 gb|EXB54112.1| hypothetical protein L484_017551 [Morus notabilis]
Length=391

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/72 (94%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNK+RERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKKRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRK  340
            W VE DGTTYRK
Sbjct  61   WTVEPDGTTYRK  72


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 91/143 (64%), Gaps = 5/143 (3%)
 Frame = +2

Query  215  FAGLRMYGNYKLPKHCDNNEV-LKALCKEAGWIVEEDGTTYRKGCKPTERMDIMGssvsv  391
            F+ L ++   +   H D  E  +  L +  G+   E+     +GCKP E M++ G S + 
Sbjct  97   FSSLLLFLVSEPCNHVDLEETKIPFLEQPIGFWDFENSEGCIQGCKPAECMEVAGGSAAA  156

Query  392  spcssyqpsqGpsynpspasssfpspvssRYITNNNNDTDPNSLIPWLXNLssgsspsss  571
            SPCSSY PS   SYNPSP SSSFPSP SS Y+ N N D   +SLIPWL NLSS SS +SS
Sbjct  157  SPCSSYHPSPCASYNPSPGSSSFPSPASSSYVANPNGDG--SSLIPWLKNLSSASSSASS  214

Query  572  -KLPHHLYIPGGSISAPVTPPLS  637
             KLPH LYI  GSISAPVTPPLS
Sbjct  215  SKLPH-LYIHSGSISAPVTPPLS  236



>ref|XP_006383240.1| hypothetical protein POPTR_0005s12790g [Populus trichocarpa]
 gb|ERP61037.1| hypothetical protein POPTR_0005s12790g [Populus trichocarpa]
Length=319

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENN RRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSARLPTWKERENNMRRERRRRAIAAKIYTGLRTQGNYKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>gb|ADE77262.1| unknown [Picea sitchensis]
Length=305

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 103/171 (60%), Gaps = 31/171 (18%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MT+G+ LPT KERENNK+RER+RRA+AAKIFAGLR+YGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTAGSALPTSKERENNKKRERKRRALAAKIFAGLRLYGNYKLPKHCDNNEVLKALCAEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIV  DGTTYR      ER D MG S   +  ++                         Y
Sbjct  61   WIVHPDGTTYRPDTGIPERAD-MGISAPPTAVAAP------------------------Y  95

Query  485  ITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             + N      +SLIPWL  L S +   + +    L I  G+ SAPVTPPL+
Sbjct  96   PSEN------SSLIPWLKGLGSINRLGTQRTLLPLQIDRGNCSAPVTPPLT  140



>ref|XP_006383241.1| hypothetical protein POPTR_0005s12790g [Populus trichocarpa]
 gb|ABK96008.1| unknown [Populus trichocarpa]
 gb|ERP61038.1| hypothetical protein POPTR_0005s12790g [Populus trichocarpa]
Length=331

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENN RRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSARLPTWKERENNMRRERRRRAIAAKIYTGLRTQGNYKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>gb|EYU44662.1| hypothetical protein MIMGU_mgv1a010729mg [Erythranthe guttata]
Length=304

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            +S  RLPTWKERENNK+RERRRRAIAAKI+AGLR  GNYKLPKHCDNNEVLKALC EAGW
Sbjct  6    SSTGRLPTWKERENNKKRERRRRAIAAKIYAGLRSQGNYKLPKHCDNNEVLKALCSEAGW  65

Query  308  IVEEDGTTYRKGCKP  352
            +VE+DGTTYRKGCKP
Sbjct  66   VVEDDGTTYRKGCKP  80



>ref|XP_008795632.1| PREDICTED: protein BZR1 homolog 1-like [Phoenix dactylifera]
Length=309

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 72/77 (94%), Gaps = 1/77 (1%)
 Frame = +2

Query  125  MTSGT-RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEA  301
            MTSG  RLPTW+ERENNKRRERRRRAIAAKIF+GLR  GNYKLPKHCDNNEVLKALC EA
Sbjct  1    MTSGGGRLPTWRERENNKRRERRRRAIAAKIFSGLRTLGNYKLPKHCDNNEVLKALCSEA  60

Query  302  GWIVEEDGTTYRKGCKP  352
            GW+VE+DGTTYRKGCKP
Sbjct  61   GWVVEDDGTTYRKGCKP  77



>ref|XP_010999949.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Populus euphratica]
Length=332

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENN RRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSARLPTWKERENNMRRERRRRAIAAKIYTGLRTQGNYKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>ref|XP_009379188.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Pyrus x bretschneideri]
Length=316

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  G+YKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWV  65

Query  311  VEEDGTTYRKGCKPTERMDIMG  376
            VEEDGTTYRKGCKP+  M+I G
Sbjct  66   VEEDGTTYRKGCKPSP-MEIAG  86



>ref|XP_009389663.1| PREDICTED: protein BZR1 homolog 1-like [Musa acuminata subsp. 
malaccensis]
Length=310

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 72/76 (95%), Gaps = 1/76 (1%)
 Frame = +2

Query  125  MTSGT-RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEA  301
            MTSG  RLPTWKERENNKRRERRRRAIAAKIF+GLR  GNYKLPKHCDNNEVLKALC+EA
Sbjct  1    MTSGGGRLPTWKERENNKRRERRRRAIAAKIFSGLRALGNYKLPKHCDNNEVLKALCREA  60

Query  302  GWIVEEDGTTYRKGCK  349
            GWIVE+DGTTYRKGCK
Sbjct  61   GWIVEDDGTTYRKGCK  76



>ref|XP_008338783.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Malus domestica]
Length=316

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 121/170 (71%), Gaps = 10/170 (6%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  G+YKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWV  65

Query  311  VEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
            VEEDGTTYRKGCKP+  M+I G+  ++S CSS Q S   S  PSP  S   SP SS + +
Sbjct  66   VEEDGTTYRKGCKPSP-MEIAGTPTNMSACSSIQQSPQSSAFPSPVPSYHASPSSSSFPS  124

Query  491  NNNNDTDPNS-LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                + +P+S L+P+L N+        + +P +L     S SAPVTPPLS
Sbjct  125  PTRFEGNPSSYLLPFLCNI--------ASIPTNLPPLRISNSAPVTPPLS  166



>emb|CDP02805.1| unnamed protein product [Coffea canephora]
Length=317

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 124/171 (73%), Gaps = 10/171 (6%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            +S  RLPTWKERENNKRRERRRRAIAAKIFAGLR  GNYKLPKHCDNNEVLKALC EAGW
Sbjct  8    SSSGRLPTWKERENNKRRERRRRAIAAKIFAGLRAQGNYKLPKHCDNNEVLKALCSEAGW  67

Query  308  IVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYI  487
            IVE+DGTTYRKG KP   +++ G+S S+S CSS QPS   S  PSPA S   SP SS + 
Sbjct  68   IVEDDGTTYRKGGKP-PLVELTGASASISACSSIQPSPASSSFPSPAPSYHASPGSSSFP  126

Query  488  TNNNNDTDPNS-LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + +  DT+P S ++P+L NL        + +P+ L     S SAPVTPPLS
Sbjct  127  SPSRGDTNPPSYILPFLHNL--------ASIPNSLPPLRISNSAPVTPPLS  169



>ref|XP_010907212.1| PREDICTED: protein BZR1 homolog 1-like [Elaeis guineensis]
Length=309

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            + G RLPTWKERENNKRRERRRRAI AKIF GLR  GNYKLPKHCDNNEVLKALC EAGW
Sbjct  3    SGGGRLPTWKERENNKRRERRRRAIGAKIFYGLRTQGNYKLPKHCDNNEVLKALCAEAGW  62

Query  308  IVEEDGTTYRKGCKP  352
            +VEEDGTTYR+GCKP
Sbjct  63   VVEEDGTTYRRGCKP  77



>ref|XP_009411027.1| PREDICTED: protein BZR1 homolog 1 [Musa acuminata subsp. malaccensis]
Length=310

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = +2

Query  125  MTSGT-RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEA  301
            MTSG  R PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC+EA
Sbjct  1    MTSGGGRQPTWKERENNKRRERRRRAIAAKIFTGLRAMGNYKLPKHCDNNEVLKALCREA  60

Query  302  GWIVEEDGTTYRKGCK  349
            GWIVEEDGTTYRKGCK
Sbjct  61   GWIVEEDGTTYRKGCK  76



>ref|XP_010531182.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Tarenaya hassleriana]
Length=302

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 118/171 (69%), Gaps = 9/171 (5%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            +S  R PTWKERENNKRRERRRRAI AKI+AGLR  GNYKLPKHCDNNEVLKALC EAGW
Sbjct  6    SSTGRTPTWKERENNKRRERRRRAITAKIYAGLRAQGNYKLPKHCDNNEVLKALCAEAGW  65

Query  308  IVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYI  487
            IVE+DGTTYR+GCKP    +I G     S  SS QPS   S  PSPA S   SPVSS + 
Sbjct  66   IVEDDGTTYRQGCKPPP-AEISGIPTKASAHSSVQPSPQSSAFPSPAPSYHASPVSSSFP  124

Query  488  TNNNNDTDPNS-LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            +    D +P++ L+P+L N+       +S +P +L     S SAPVTPPLS
Sbjct  125  SPTRYDANPSTYLLPFLHNI-------ASSIPSNLPPLRISNSAPVTPPLS  168



>ref|XP_011097209.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Sesamum indicum]
Length=316

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 120/171 (70%), Gaps = 11/171 (6%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            +S  RLP+W+ERENNKRRERRRRAIAAKI++GLR  GNYKLPKHCDNNEVLKALC EAGW
Sbjct  6    SSTGRLPSWRERENNKRRERRRRAIAAKIYSGLRAQGNYKLPKHCDNNEVLKALCAEAGW  65

Query  308  IVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYI  487
            +VEEDGTTYRKGCKP    D   +S ++S CSS QPS   S  PSP  S   SP SS + 
Sbjct  66   VVEEDGTTYRKGCKPPP-ADTPMTSTNISACSSMQPSPNSSAFPSPLPSYHASPTSSSFP  124

Query  488  TNNNNDTDPNSLI-PWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + +  D +P S I P+L NL        S LP HL I   S SAPVTPPLS
Sbjct  125  SPSRCDGNPTSFILPYLRNL-----AIPSSLP-HLRI---SNSAPVTPPLS  166



>ref|XP_010070026.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Eucalyptus grandis]
 gb|KCW58581.1| hypothetical protein EUGRSUZ_H01239 [Eucalyptus grandis]
Length=320

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 120/167 (72%), Gaps = 10/167 (6%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            RLPTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGW+VEE
Sbjct  8    RLPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCTEAGWVVEE  67

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKG KP    +IMG+S ++S CSSYQPS   S  PSP  S   SP SS + +   
Sbjct  68   DGTTYRKGSKPPP-GEIMGASANISACSSYQPSPQSSAFPSPVPSYHASPTSSSFPSPTR  126

Query  500  NDTDPNS-LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             D +P+S L+P+L N+        + +P +L     S SAPVTPPLS
Sbjct  127  FDANPSSYLLPFLRNI--------ASIPTNLPPLRISSSAPVTPPLS  165



>ref|XP_011099590.1| PREDICTED: BES1/BZR1 homolog protein 2 [Sesamum indicum]
Length=316

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            +S  RLPTWKERENNKRRERRRRAIAAKI++GLR  GNY+LPKHCDNNEVLKALC EAGW
Sbjct  6    SSTGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGNYRLPKHCDNNEVLKALCAEAGW  65

Query  308  IVEEDGTTYRKGCKP  352
            IVEEDGTTYRKGCKP
Sbjct  66   IVEEDGTTYRKGCKP  80



>ref|XP_002525100.1| BRASSINAZOLE-RESISTANT 1 protein, putative [Ricinus communis]
 gb|EEF37227.1| BRASSINAZOLE-RESISTANT 1 protein, putative [Ricinus communis]
Length=317

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGNFKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>ref|XP_007047017.1| Brassinosteroid signaling positive regulator family protein isoform 
1 [Theobroma cacao]
 gb|EOX91174.1| Brassinosteroid signaling positive regulator family protein isoform 
1 [Theobroma cacao]
Length=320

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 119/167 (71%), Gaps = 10/167 (6%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            RLPTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWIVEE
Sbjct  7    RLPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCAEAGWIVEE  66

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKGCKP    ++ G+S ++S CSS QPS   S  PSP  S   SP SS   +   
Sbjct  67   DGTTYRKGCKP-PLSELAGASTNISACSSIQPSPQSSSFPSPVPSYHASPSSSLCPSPTR  125

Query  500  NDTDPNS-LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             D +P++ L+P+L N+        + +P++L     S SAPVTPPLS
Sbjct  126  FDANPSTYLLPFLRNI--------AAIPNNLPPLRISNSAPVTPPLS  164



>ref|XP_009394366.1| PREDICTED: protein BZR1 homolog 1-like [Musa acuminata subsp. 
malaccensis]
Length=299

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  134  GTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIV  313
            G R PTWKERENNKRRERRRRAIA++IF+GLR  GNYKLPKHCDNNEVLKALC EAGWIV
Sbjct  5    GGRQPTWKERENNKRRERRRRAIASQIFSGLRAMGNYKLPKHCDNNEVLKALCHEAGWIV  64

Query  314  EEDGTTYRKGCK  349
            EEDGTTYRKGCK
Sbjct  65   EEDGTTYRKGCK  76



>ref|XP_011025717.1| PREDICTED: LOW QUALITY PROTEIN: BES1/BZR1 homolog protein 2 [Populus 
euphratica]
Length=336

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYTGLRTQGNYKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>ref|XP_007156899.1| hypothetical protein PHAVU_002G0267001g, partial [Phaseolus vulgaris]
 gb|ESW28893.1| hypothetical protein PHAVU_002G0267001g, partial [Phaseolus vulgaris]
Length=94

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWIVEE
Sbjct  9    RMPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCAEAGWIVEE  68

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCK     +I G
Sbjct  69   DGTTYRKGCKRPTGSEIGG  87



>ref|XP_010558116.1| PREDICTED: BES1/BZR1 homolog protein 1 [Tarenaya hassleriana]
Length=273

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNKRRERRRRA+AAKIFAGLR  GN+KLPKHCDNNEVLKALC EAGWIVE+
Sbjct  13   RTPTWKERENNKRRERRRRAVAAKIFAGLRAQGNFKLPKHCDNNEVLKALCSEAGWIVED  72

Query  320  DGTTYRKGCKPTE  358
            DGTTYRKGC+P +
Sbjct  73   DGTTYRKGCRPKQ  85



>gb|KDP38469.1| hypothetical protein JCGZ_04394 [Jatropha curcas]
Length=312

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = +2

Query  107  NGRRREMTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKA  286
            +G      +  R P+W+ERENN+RRERRRRAIAAKIFAGLR  GNY LPKHCDNNEVLKA
Sbjct  4    DGATSTSAAPRRKPSWRERENNRRRERRRRAIAAKIFAGLRAQGNYNLPKHCDNNEVLKA  63

Query  287  LCKEAGWIVEEDGTTYRKGCKPTERMDIMG  376
            LC EAGW+VE+DGTTYRKGCKP   +DI+G
Sbjct  64   LCSEAGWVVEDDGTTYRKGCKPPP-IDIVG  92



>ref|XP_003537545.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Glycine max]
Length=310

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            RLPTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWIVEE
Sbjct  9    RLPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCAEAGWIVEE  68

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCK     +I G
Sbjct  69   DGTTYRKGCKRPSASEIGG  87



>ref|XP_004958130.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Setaria italica]
Length=326

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC+EAGW+VE+
Sbjct  18   RTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKALCREAGWVVED  77

Query  320  DGTTYRKGCKP  352
            DGTTYRKGCKP
Sbjct  78   DGTTYRKGCKP  88



>emb|CDY62653.1| BnaAnng18240D [Brassica napus]
Length=309

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 118/168 (70%), Gaps = 10/168 (6%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNKRRERRRRAI AKI++GLR  GNYKLPKHCDNNEVLKALC EAGWIVE+
Sbjct  15   RTPTWKERENNKRRERRRRAITAKIYSGLRGQGNYKLPKHCDNNEVLKALCLEAGWIVED  74

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKG KP    D++G+  + S  SS Q S   S  PSPA S   SPVSS + + + 
Sbjct  75   DGTTYRKGSKPIAS-DMLGTPTTFSTNSSIQASPQSSAFPSPAPSYHGSPVSSSFPSPSR  133

Query  500  NDTDPNS--LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             D +P+S  L+P+L N+       +S +P +L     S SAPVTPPLS
Sbjct  134  YDGNPSSYLLLPFLHNI-------ASSIPANLPPLRTSNSAPVTPPLS  174



>ref|XP_002310201.1| hypothetical protein POPTR_0007s12370g [Populus trichocarpa]
 gb|ABK92480.1| unknown [Populus trichocarpa]
 gb|EEE90651.1| hypothetical protein POPTR_0007s12370g [Populus trichocarpa]
Length=317

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI+ GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYTGLRTQGNFKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>ref|XP_010943157.1| PREDICTED: protein BZR1 homolog 1-like [Elaeis guineensis]
Length=309

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 71/76 (93%), Gaps = 1/76 (1%)
 Frame = +2

Query  125  MTSGT-RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEA  301
            MTSG  RLPTW+ERENNKRRERRRRAIAAKIF+GLR  GNYKLPKHCDNNEVLKALC EA
Sbjct  1    MTSGGGRLPTWRERENNKRRERRRRAIAAKIFSGLRTLGNYKLPKHCDNNEVLKALCGEA  60

Query  302  GWIVEEDGTTYRKGCK  349
            GW+VE+DGTTYRKGCK
Sbjct  61   GWVVEDDGTTYRKGCK  76



>gb|KDP31804.1| hypothetical protein JCGZ_12265 [Jatropha curcas]
Length=318

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 123/175 (70%), Gaps = 13/175 (7%)
 Frame = +2

Query  125  MTSGT---RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCK  295
            MT+G    RLPTWKERENNKRRERRRRAIAAKI++GLR  GNYKLPKHCDNNEVLKALC 
Sbjct  1    MTAGGCSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGNYKLPKHCDNNEVLKALCA  60

Query  296  EAGWIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvs  475
            EAGWIVEEDGTTYRKG KP   ++I G+  ++S CSS QPS   S  PSP  S   SP S
Sbjct  61   EAGWIVEEDGTTYRKGSKPPP-LEIAGTPTNISACSSIQPSPQSSNFPSPVPSYHVSPTS  119

Query  476  sRYITNNNNDTDPNS-LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            S + +    D +P++ L+P+L N+        + +P +L     S SAPVTPPLS
Sbjct  120  SSFPSPTRFDANPSTYLLPFLRNI--------ASIPANLPQLRISNSAPVTPPLS  166



>sp|Q7XI96.1|BZR1_ORYSJ RecName: Full=Protein BZR1 homolog 1; Short=OsBZR1; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 1 [Oryza sativa 
Japonica Group]
 sp|B8B7S5.1|BZR1_ORYSI RecName: Full=Protein BZR1 homolog 1; Short=OsBZR1; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 1 [Oryza sativa 
Indica Group]
 dbj|BAC79822.1| putative mature anther-specific protein LAT61 [Oryza sativa Japonica 
Group]
 gb|EAZ40428.1| hypothetical protein OsJ_24880 [Oryza sativa Japonica Group]
 dbj|BAG97818.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82329.1| hypothetical protein OsI_26618 [Oryza sativa Indica Group]
Length=298

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 70/80 (88%), Gaps = 4/80 (5%)
 Frame = +2

Query  125  MTSGT----RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALC  292
            MTSG     R PTWKERENNKRRERRRRAIAAKIF GLR  GNY LPKHCDNNEVLKALC
Sbjct  1    MTSGAAAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALC  60

Query  293  KEAGWIVEEDGTTYRKGCKP  352
            +EAGW+VE+DGTTYRKGCKP
Sbjct  61   REAGWVVEDDGTTYRKGCKP  80



>ref|NP_001060100.2| Os07g0580500 [Oryza sativa Japonica Group]
 dbj|BAF22014.2| Os07g0580500, partial [Oryza sativa Japonica Group]
Length=304

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 70/80 (88%), Gaps = 4/80 (5%)
 Frame = +2

Query  125  MTSGT----RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALC  292
            MTSG     R PTWKERENNKRRERRRRAIAAKIF GLR  GNY LPKHCDNNEVLKALC
Sbjct  7    MTSGAAAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALC  66

Query  293  KEAGWIVEEDGTTYRKGCKP  352
            +EAGW+VE+DGTTYRKGCKP
Sbjct  67   REAGWVVEDDGTTYRKGCKP  86



>ref|XP_002463083.1| hypothetical protein SORBIDRAFT_02g037500 [Sorghum bicolor]
 gb|EER99604.1| hypothetical protein SORBIDRAFT_02g037500 [Sorghum bicolor]
Length=336

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC+EAGW+VE+
Sbjct  17   RTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKALCREAGWVVED  76

Query  320  DGTTYRKGCKP  352
            DGTTYRKGCKP
Sbjct  77   DGTTYRKGCKP  87



>ref|XP_007156901.1| hypothetical protein PHAVU_002G0268001g, partial [Phaseolus vulgaris]
 gb|ESW28895.1| hypothetical protein PHAVU_002G0268001g, partial [Phaseolus vulgaris]
Length=94

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNKRRERRRRAIAAKI+ GLR  GN+KLPKHCDNNEVLKALC EAGWIVEE
Sbjct  9    RMPTWKERENNKRRERRRRAIAAKIYTGLRAQGNFKLPKHCDNNEVLKALCAEAGWIVEE  68

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCK     +I G
Sbjct  69   DGTTYRKGCKRPTGSEIGG  87



>emb|CDX90690.1| BnaA03g40910D [Brassica napus]
Length=285

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNK+RERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC EAGWIV E
Sbjct  19   RMPTWKERENNKKRERRRRAIAAKIFTGLRSQGNYKLPKHCDNNEVLKALCVEAGWIVHE  78

Query  320  DGTTYRKGCKPTE  358
            DGTTYRKG +PTE
Sbjct  79   DGTTYRKGSRPTE  91



>ref|XP_009136556.1| PREDICTED: BES1/BZR1 homolog protein 1 [Brassica rapa]
Length=285

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNK+RERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC EAGWIV E
Sbjct  19   RMPTWKERENNKKRERRRRAIAAKIFTGLRSQGNYKLPKHCDNNEVLKALCVEAGWIVHE  78

Query  320  DGTTYRKGCKPTE  358
            DGTTYRKG +PTE
Sbjct  79   DGTTYRKGSRPTE  91



>ref|XP_008653282.1| PREDICTED: protein BZR1 homolog 1-like [Zea mays]
 tpg|DAA63315.1| TPA: BES1/BZR1 protein [Zea mays]
Length=317

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC+EAGW+VE+
Sbjct  13   RTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKALCREAGWVVED  72

Query  320  DGTTYRKGCKP  352
            DGTTYRKGC+P
Sbjct  73   DGTTYRKGCRP  83



>emb|CAN83287.1| hypothetical protein VITISV_033232 [Vitis vinifera]
Length=307

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  215  FAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCKPTERMDIMG  376
            +AGLR  GNY+LPKHCDNNEVLKALC EAGW VE+DGTTYRKGCKP    +I G
Sbjct  35   YAGLRAQGNYRLPKHCDNNEVLKALCSEAGWTVEDDGTTYRKGCKPPPSTEIAG  88



>ref|XP_002283352.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1 [Vitis vinifera]
Length=307

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  215  FAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCKPTERMDIMG  376
            +AGLR  GNY+LPKHCDNNEVLKALC EAGW VE+DGTTYRKGCKP    +I G
Sbjct  35   YAGLRAQGNYRLPKHCDNNEVLKALCSEAGWTVEDDGTTYRKGCKPPPSTEIAG  88



>ref|NP_190644.1| BES1/BZR1 1 [Arabidopsis thaliana]
 sp|Q9S7F3.1|BEH1_ARATH RecName: Full=BES1/BZR1 homolog protein 1 [Arabidopsis thaliana]
 emb|CAB42904.1| putative protein [Arabidopsis thaliana]
 emb|CAB62444.1| putative protein [Arabidopsis thaliana]
 gb|AAO00812.1| putative protein [Arabidopsis thaliana]
 gb|AAP13418.1| At3g50750 [Arabidopsis thaliana]
 gb|AEE78704.1| BES1/BZR1 1 [Arabidopsis thaliana]
Length=276

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNK+RERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC EAGWIV E
Sbjct  14   RMPTWKERENNKKRERRRRAIAAKIFTGLRSQGNYKLPKHCDNNEVLKALCLEAGWIVHE  73

Query  320  DGTTYRKGCKPTE  358
            DGTTYRKG +PTE
Sbjct  74   DGTTYRKGSRPTE  86



>ref|XP_004300602.1| PREDICTED: BES1/BZR1 homolog protein 2 [Fragaria vesca subsp. 
vesca]
Length=322

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  G+YKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWV  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>emb|CBI19651.3| unnamed protein product [Vitis vinifera]
Length=286

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  215  FAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCKPTERMDIMG  376
            +AGLR  GNY+LPKHCDNNEVLKALC EAGW VE+DGTTYRKGCKP    +I G
Sbjct  35   YAGLRAQGNYRLPKHCDNNEVLKALCSEAGWTVEDDGTTYRKGCKPPPSTEIAG  88



>ref|XP_003517250.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Glycine max]
Length=308

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/70 (93%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            RLPTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWIVEE
Sbjct  9    RLPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCAEAGWIVEE  68

Query  320  DGTTYRKGCK  349
            DGTTYRKGCK
Sbjct  69   DGTTYRKGCK  78



>ref|XP_002877766.1| hypothetical protein ARALYDRAFT_485421 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54025.1| hypothetical protein ARALYDRAFT_485421 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 106/177 (60%), Gaps = 10/177 (6%)
 Frame = +2

Query  110  GRRREMTSGT-RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKA  286
            G   E T+ T R+PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKA
Sbjct  6    GGEGESTAATGRMPTWKERENNKRRERRRRAIAAKIFTGLRSQGNYKLPKHCDNNEVLKA  65

Query  287  LCKEAGWIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfps  466
            LC EAGWIV EDG+TYRKG +PTE   +  S       S++Q           +SS    
Sbjct  66   LCLEAGWIVHEDGSTYRKGSRPTEATPLCSSIQLSPQSSAFQSPIPSYQASPSSSSYPSP  125

Query  467  pvssRYITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
                      + +     LIP+L NL+S  + +  ++         S SAPVTPP+S
Sbjct  126  TRFDHIPNRFDPNQSSTYLIPYLQNLASSGNLAPLRI---------SNSAPVTPPIS  173



>ref|NP_001151195.1| BES1/BZR1 protein [Zea mays]
 gb|ACG41944.1| BES1/BZR1 protein [Zea mays]
Length=313

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC+EAGW+VE+
Sbjct  14   RTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKALCREAGWVVED  73

Query  320  DGTTYRKGCKP  352
            DGTTYRKGC+P
Sbjct  74   DGTTYRKGCRP  84



>ref|XP_008440681.1| PREDICTED: BES1/BZR1 homolog protein 2 [Cucumis melo]
Length=319

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  R PTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRTPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCNEAGWV  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>ref|XP_004143497.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Cucumis sativus]
 ref|XP_004160145.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Cucumis sativus]
 gb|KGN48804.1| hypothetical protein Csa_6G501930 [Cucumis sativus]
Length=319

 Score = 95.5 bits (236),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  R PTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRTPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCNEAGWV  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>ref|XP_008806188.1| PREDICTED: protein BZR1 homolog 1-like [Phoenix dactylifera]
Length=308

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = +2

Query  125  MTSGT-RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEA  301
            MTSG  RLPTWKERENNKRRERRRRAIAAKIF+GLR  G YKLPKHCDNNEVLKALC EA
Sbjct  1    MTSGGGRLPTWKERENNKRRERRRRAIAAKIFSGLRTLGKYKLPKHCDNNEVLKALCAEA  60

Query  302  GWIVEEDGTTYRKGCK  349
            GW+VEEDGTTYR+GCK
Sbjct  61   GWVVEEDGTTYRRGCK  76



>ref|XP_006404006.1| hypothetical protein EUTSA_v10010593mg [Eutrema salsugineum]
 gb|ESQ45459.1| hypothetical protein EUTSA_v10010593mg [Eutrema salsugineum]
Length=290

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC EAGWIV E
Sbjct  20   RMPTWKERENNKRRERRRRAIAAKIFTGLRSQGNYKLPKHCDNNEVLKALCLEAGWIVHE  79

Query  320  DGTTYRKGCKPTE  358
            DGTTYRKG +PTE
Sbjct  80   DGTTYRKGSRPTE  92



>ref|XP_002510347.1| BRASSINAZOLE-RESISTANT 1 protein, putative [Ricinus communis]
 gb|EEF52534.1| BRASSINAZOLE-RESISTANT 1 protein, putative [Ricinus communis]
Length=321

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRAIAAKIF+GLR  GNY LPKHCDNNEVLKALC EAGW+VE+
Sbjct  18   RKPSWRERENNRRRERRRRAIAAKIFSGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVED  77

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGC+P   +DI+G
Sbjct  78   DGTTYRKGCRPPP-IDIVG  95



>gb|KDO79470.1| hypothetical protein CISIN_1g020929mg [Citrus sinensis]
Length=319

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKIF+GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIFSGLRAEGNFKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKG +P
Sbjct  66   VEEDGTTYRKGSRP  79



>ref|XP_006291638.1| hypothetical protein CARUB_v10017793mg [Capsella rubella]
 ref|XP_006291639.1| hypothetical protein CARUB_v10017793mg [Capsella rubella]
 gb|EOA24536.1| hypothetical protein CARUB_v10017793mg [Capsella rubella]
 gb|EOA24537.1| hypothetical protein CARUB_v10017793mg [Capsella rubella]
Length=280

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 107/170 (63%), Gaps = 17/170 (10%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC EAGWIV E
Sbjct  19   RMPTWKERENNKRRERRRRAIAAKIFTGLRSQGNYKLPKHCDNNEVLKALCLEAGWIVHE  78

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKG +P   MD      S+         Q P  +   + +S   P  +R+  +  
Sbjct  79   DGTTYRKGSRP---MDTAPPCSSIQVSPQSSAFQSPIPSYQASPASSSYPSPTRF-DHIP  134

Query  500  NDTDPNS----LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            N  DPN     LIP+L NL+S  + +  ++         S SAPVTPPLS
Sbjct  135  NRFDPNQSSTYLIPYLQNLASSGNLAPLRI---------SNSAPVTPPLS  175



>ref|XP_006425734.1| hypothetical protein CICLE_v10026102mg [Citrus clementina]
 gb|ESR38974.1| hypothetical protein CICLE_v10026102mg [Citrus clementina]
Length=319

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKIF+GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIFSGLRAEGNFKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKG +P
Sbjct  66   VEEDGTTYRKGSRP  79



>ref|XP_006466728.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Citrus sinensis]
Length=319

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKIF+GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIFSGLRAEGNFKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKG +P
Sbjct  66   VEEDGTTYRKGSRP  79



>emb|CDP07559.1| unnamed protein product [Coffea canephora]
Length=333

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            + +G R P+W+ERENN+RRERRRRAIAAKI+AGLR  GNY LPKHCDNNEVLKALC EAG
Sbjct  34   VVNGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCAEAG  93

Query  305  WIVEEDGTTYRKGCKP  352
            WIVE DGTTYRKGC+P
Sbjct  94   WIVESDGTTYRKGCRP  109



>gb|KJB59824.1| hypothetical protein B456_009G274000 [Gossypium raimondii]
Length=314

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +2

Query  215  FAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCKPTER-MDIMG  376
            + GLR  GNY LPKHCDNNEVLKALC EAGW+VEEDGTTYRKGCKP     DI+G
Sbjct  40   YTGLRALGNYNLPKHCDNNEVLKALCAEAGWVVEEDGTTYRKGCKPPRAPTDILG  94



>ref|XP_007047018.1| Brassinosteroid signaling positive regulator family protein isoform 
2, partial [Theobroma cacao]
 gb|EOX91175.1| Brassinosteroid signaling positive regulator family protein isoform 
2, partial [Theobroma cacao]
Length=302

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 95/142 (67%), Gaps = 10/142 (7%)
 Frame = +2

Query  215  FAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCKPTERMDIMGssvsvs  394
            + GLR  GNYKLPKHCDNNEVLKALC EAGWIVEEDGTTYRKGCKP    ++ G+S ++S
Sbjct  14   YTGLRAQGNYKLPKHCDNNEVLKALCAEAGWIVEEDGTTYRKGCKP-PLSELAGASTNIS  72

Query  395  pcssyqpsqGpsynpspasssfpspvssRYITNNNNDTDPNS-LIPWLXNLssgsspsss  571
             CSS QPS   S  PSP  S   SP SS   +    D +P++ L+P+L N+++       
Sbjct  73   ACSSIQPSPQSSSFPSPVPSYHASPSSSLCPSPTRFDANPSTYLLPFLRNIAA-------  125

Query  572  KLPHHLYIPGGSISAPVTPPLS  637
             +P++L     S SAPVTPPLS
Sbjct  126  -IPNNLPPLRISNSAPVTPPLS  146



>ref|XP_006342599.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like [Solanum tuberosum]
Length=330

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 70/81 (86%), Gaps = 1/81 (1%)
 Frame = +2

Query  134  GTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIV  313
            G R P+W+ERENN+RRERRRRA+AAKI+ GLR  GNY LPKHCDNNEVLKALC EAGWIV
Sbjct  35   GRRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGNYNLPKHCDNNEVLKALCTEAGWIV  94

Query  314  EEDGTTYRKGCKPTERMDIMG  376
            E DGTTYRKGCKPT  M+I G
Sbjct  95   EPDGTTYRKGCKPTP-MEIGG  114



>gb|KHN36916.1| Protein BRASSINAZOLE-RESISTANT 2 [Glycine soja]
Length=95

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTS  R PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSVARQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRK  340
            W VE DGTTYRK
Sbjct  61   WTVEADGTTYRK  72



>emb|CBI20161.3| unnamed protein product [Vitis vinifera]
Length=264

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENN RRERRRRAIAAKIF+ LRMYGNYKLPKHCDNNEVLKALC +AG
Sbjct  91   MTSGTRLPTWKERENNNRRERRRRAIAAKIFSRLRMYGNYKLPKHCDNNEVLKALCNKAG  150

Query  305  WIVEEDGTTYRK  340
            W VE DGTTYRK
Sbjct  151  WTVELDGTTYRK  162



>ref|XP_007017466.1| Brassinosteroid signaling positive regulator family protein [Theobroma 
cacao]
 gb|EOY14691.1| Brassinosteroid signaling positive regulator family protein [Theobroma 
cacao]
Length=311

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRAIAAKI+ GLR  GNY LPKHCDNNEVLKALC EAGW+VEE
Sbjct  14   RKPSWRERENNRRRERRRRAIAAKIYTGLRAQGNYNLPKHCDNNEVLKALCAEAGWVVEE  73

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCKP   +DI G
Sbjct  74   DGTTYRKGCKPPP-IDIPG  91



>emb|CDY64371.1| BnaC07g50000D [Brassica napus]
Length=285

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNK+RERRRRAIAAKIF GLR  GNY LPKHCDNNEVLKALC EAGWIV E
Sbjct  19   RMPTWKERENNKKRERRRRAIAAKIFTGLRSQGNYNLPKHCDNNEVLKALCVEAGWIVHE  78

Query  320  DGTTYRKGCKPTE  358
            DGTTYRKG +PTE
Sbjct  79   DGTTYRKGSRPTE  91



>ref|XP_010471609.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like [Camelina sativa]
Length=317

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  107  NGRRREMTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKA  286
            +G      +  R P+W+ERENN+RRERRRRA+AAKI+ GLR  G+Y LPKHCDNNEVLKA
Sbjct  4    DGATSTSAAARRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGDYNLPKHCDNNEVLKA  63

Query  287  LCKEAGWIVEEDGTTYRKGCKP  352
            LC EAGW+VEEDGTTYRKGCKP
Sbjct  64   LCSEAGWVVEEDGTTYRKGCKP  85



>gb|KJB58324.1| hypothetical protein B456_009G204600 [Gossypium raimondii]
 gb|KJB58325.1| hypothetical protein B456_009G204600 [Gossypium raimondii]
Length=313

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 113/167 (68%), Gaps = 12/167 (7%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRAIAAKI+ GLR  GNY LPKHCDNNEVLKALC EAGW+VE+
Sbjct  16   RKPSWRERENNRRRERRRRAIAAKIYTGLRAQGNYNLPKHCDNNEVLKALCVEAGWVVED  75

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKGCKP   +DI GSS  ++P SS  PS   S  PSP  S   SP SS + +   
Sbjct  76   DGTTYRKGCKPPP-IDIAGSSAKITPYSSQNPSPLSSAFPSPIPSCQVSPSSSSFPSPTR  134

Query  500  NDT-DPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             D  +P+SL+P+L +           +P  L     S SAPVTPPLS
Sbjct  135  TDANNPSSLLPFLRS----------AIPSSLPPLRISNSAPVTPPLS  171



>gb|AFK40796.1| unknown [Lotus japonicus]
Length=240

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            RLPTWKERENNKRRERRRRAIAAKIF GLR  GN+KLPKHCDNNEVLKALC EAGWIVEE
Sbjct  10   RLPTWKERENNKRRERRRRAIAAKIFTGLRAQGNFKLPKHCDNNEVLKALCAEAGWIVEE  69

Query  320  DGTTYRKGCK  349
            DGTTYRKGC+
Sbjct  70   DGTTYRKGCR  79



>ref|XP_006411962.1| hypothetical protein EUTSA_v10025775mg [Eutrema salsugineum]
 gb|ESQ53415.1| hypothetical protein EUTSA_v10025775mg [Eutrema salsugineum]
Length=313

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 122/172 (71%), Gaps = 10/172 (6%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            +S  R PTWKERENNK+RERRRRAI AKI++GLR  GNYKLPKHCDNNEVLKALC EAGW
Sbjct  7    SSSGRTPTWKERENNKKRERRRRAITAKIYSGLRAQGNYKLPKHCDNNEVLKALCLEAGW  66

Query  308  IVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYI  487
            IVE+DGTTYRKG KP    +I G+  ++S  SS QPS   S  PSPA S   SPVSS + 
Sbjct  67   IVEDDGTTYRKGFKPPAS-EISGTPTNLSTNSSIQPSPQSSAFPSPAPSYHGSPVSSSFP  125

Query  488  TNNNNDTDPNS--LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            + + +D +P+S  L+P+L N+       +S +P +L     S SAPVTPPLS
Sbjct  126  SPSRHDGNPSSYLLLPFLQNI-------ASSIPANLPPLRISNSAPVTPPLS  170



>ref|NP_001172869.1| Os02g0233200 [Oryza sativa Japonica Group]
 dbj|BAD27718.1| putative mature anther-specific protein LAT61 [Oryza sativa Japonica 
Group]
 dbj|BAH91598.1| Os02g0233200 [Oryza sativa Japonica Group]
Length=376

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 115/198 (58%), Gaps = 38/198 (19%)
 Frame = +2

Query  134  GTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIV  313
            G R+PTW+ERENN+RRERRRRAIAAKI+AGLR YGNY LPKHCDNNEVLKALC EAGW V
Sbjct  7    GGRVPTWRERENNRRRERRRRAIAAKIYAGLRAYGNYTLPKHCDNNEVLKALCNEAGWTV  66

Query  314  EEDGTTYR-------------------------KGCKP--TERMDIMGssvsvspcssyq  412
            E DGTTYR                         KGCKP  +E  D +G S S SPCSS  
Sbjct  67   EPDGTTYRKYWSLDRIEAAHVKKGLVKEAIMETKGCKPPASELADQLGRSPSASPCSS--  124

Query  413  psqGpsynpspasssfpspvssRYITNNNNDTDPNSLIPWLXNL----ssgsspsssKLP  580
                   +P   SS   S  SS+         + +SLIPWL  L          SSSK P
Sbjct  125  ----YQPSPRGTSSFPSSGSSSQITLGGGGGGEGSSLIPWLKTLSSAGVGIGGGSSSKFP  180

Query  581  -HHLYIPGGSISAPVTPP  631
             H+ Y  GGSISAPVTPP
Sbjct  181  AHYSYFGGGSISAPVTPP  198



>gb|EAY85121.1| hypothetical protein OsI_06471 [Oryza sativa Indica Group]
Length=377

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 115/198 (58%), Gaps = 38/198 (19%)
 Frame = +2

Query  134  GTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIV  313
            G R+PTW+ERENN+RRERRRRAIAAKI+AGLR YGNY LPKHCDNNEVLKALC EAGW V
Sbjct  7    GGRVPTWRERENNRRRERRRRAIAAKIYAGLRAYGNYTLPKHCDNNEVLKALCNEAGWTV  66

Query  314  EEDGTTYR-------------------------KGCKP--TERMDIMGssvsvspcssyq  412
            E DGTTYR                         KGCKP  +E  D +G S S SPCSS  
Sbjct  67   EPDGTTYRKYWSLDRIEAAHVKKGLVKEAIMETKGCKPPASELADQLGRSPSASPCSS--  124

Query  413  psqGpsynpspasssfpspvssRYITNNNNDTDPNSLIPWLXNL----ssgsspsssKLP  580
                   +P   SS   S  SS+         + +SLIPWL  L          SSSK P
Sbjct  125  ----YQPSPRGTSSFPSSGSSSQITLGGGGGGEGSSLIPWLKTLSSAGVGIGGGSSSKFP  180

Query  581  -HHLYIPGGSISAPVTPP  631
             H+ Y  GGSISAPVTPP
Sbjct  181  AHYSYFGGGSISAPVTPP  198



>ref|XP_010521471.1| PREDICTED: BES1/BZR1 homolog protein 1-like [Tarenaya hassleriana]
Length=274

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  134  GTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIV  313
            G R PTWKERENNKRRERRRRA+AAKIFAGLR  GN++LPKHCDNNEVLKALC +AGWIV
Sbjct  7    GARTPTWKERENNKRRERRRRAVAAKIFAGLRAQGNFRLPKHCDNNEVLKALCADAGWIV  66

Query  314  EEDGTTYRKGCKP  352
            E+DGTTYRKG +P
Sbjct  67   EDDGTTYRKGSRP  79



>ref|XP_006583443.1| PREDICTED: protein argonaute 4-like [Glycine max]
Length=253

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 76/106 (72%), Gaps = 2/106 (2%)
 Frame = +2

Query  65   FG*EPRRPVSSEKRNGRRREMTSGT--RLPTWkerennkrrerrrraiaakiFAGLRMYG  238
            F  + RR V + K          G+  RLPTWKERENNKRRERR+RAIAAKI+ GLR  G
Sbjct  57   FAFDDRRGVETNKLRFAETMTGGGSTGRLPTWKERENNKRRERRQRAIAAKIYTGLRAQG  116

Query  239  NYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCKPTERMDIMG  376
            NYKL KHCDNNEV+KALC E GWIVEEDGTTYRKGCK     +I G
Sbjct  117  NYKLLKHCDNNEVVKALCAEVGWIVEEDGTTYRKGCKRPSASEIEG  162



>ref|NP_195396.4| BES1/BZR1-like protein 2 [Arabidopsis thaliana]
 gb|AEE86700.1| BES1/BZR1-like protein 2 [Arabidopsis thaliana]
Length=265

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 118/168 (70%), Gaps = 10/168 (6%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNK+RERRRRAI AKI++GLR  GNYKLPKHCDNNEVLKALC EAGWIVE+
Sbjct  16   RTPTWKERENNKKRERRRRAITAKIYSGLRAQGNYKLPKHCDNNEVLKALCLEAGWIVED  75

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKG KP    DI G+  + S  SS QPS   S  PSPA S   SPVSS + + + 
Sbjct  76   DGTTYRKGFKPPAS-DISGTPTNFSTNSSIQPSPQSSAFPSPAPSYHGSPVSSSFPSPSR  134

Query  500  NDTDPNS--LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             D +P+S  L+P+L N+       +S +P +L     S SAPVTPPLS
Sbjct  135  YDGNPSSYLLLPFLHNI-------ASSIPANLPPLRISNSAPVTPPLS  175



>ref|XP_006284125.1| hypothetical protein CARUB_v10005257mg [Capsella rubella]
 gb|EOA17023.1| hypothetical protein CARUB_v10005257mg [Capsella rubella]
Length=322

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 118/168 (70%), Gaps = 10/168 (6%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNK+RERRRRAI AKI++GLR  GNYKLPKHCDNNEVLKALC EAGWIVE+
Sbjct  23   RTPTWKERENNKKRERRRRAITAKIYSGLRAQGNYKLPKHCDNNEVLKALCLEAGWIVED  82

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKG KP    DI G+  + S  SS QPS   S  PSPA S   SPVSS + + + 
Sbjct  83   DGTTYRKGLKPPAS-DISGTPTNFSTNSSIQPSPQSSAFPSPAPSYHGSPVSSSFPSPSR  141

Query  500  NDTDPNS--LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             D +P+S  L+P+L N+       +S +P +L     S SAPVTPPLS
Sbjct  142  YDGNPSSYLLLPFLHNI-------ASSIPANLPPLRISNSAPVTPPLS  182



>ref|XP_002866992.1| hypothetical protein ARALYDRAFT_912686 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43251.1| hypothetical protein ARALYDRAFT_912686 [Arabidopsis lyrata subsp. 
lyrata]
Length=317

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 118/168 (70%), Gaps = 10/168 (6%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNK+RERRRRAI AKI++GLR  GNYKLPKHCDNNEVLKALC EAGWIVE+
Sbjct  15   RTPTWKERENNKKRERRRRAITAKIYSGLRAQGNYKLPKHCDNNEVLKALCLEAGWIVED  74

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKG KP    DI G+  + S  SS QPS   S  PSPA S   SPVSS + + + 
Sbjct  75   DGTTYRKGFKPPAS-DISGTPTNFSTNSSIQPSPQSSAFPSPAPSYHGSPVSSSFPSPSR  133

Query  500  NDTDPNS--LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             D +P+S  L+P+L N+       +S +P +L     S SAPVTPPLS
Sbjct  134  YDGNPSSYLLLPFLHNI-------ASSIPANLPPLRISNSAPVTPPLS  174



>ref|XP_010548357.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Tarenaya hassleriana]
Length=306

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            +S  R PTWKER+NNKRRERRRRAI AKI+AGLR  GN+KLPKHCDNNEVLKALC EAGW
Sbjct  6    SSTGRTPTWKERDNNKRRERRRRAITAKIYAGLRAQGNFKLPKHCDNNEVLKALCAEAGW  65

Query  308  IVEEDGTTYRKGC  346
            IVE+DGTTYRKGC
Sbjct  66   IVEDDGTTYRKGC  78



>sp|Q94A43.1|BEH2_ARATH RecName: Full=BES1/BZR1 homolog protein 2 [Arabidopsis thaliana]
 gb|AAK91411.1| AT4g36780/C7A10_580 [Arabidopsis thaliana]
 gb|AAM19873.1| AT4g36780/C7A10_580 [Arabidopsis thaliana]
Length=318

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 118/168 (70%), Gaps = 10/168 (6%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNK+RERRRRAI AKI++GLR  GNYKLPKHCDNNEVLKALC EAGWIVE+
Sbjct  16   RTPTWKERENNKKRERRRRAITAKIYSGLRAQGNYKLPKHCDNNEVLKALCLEAGWIVED  75

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKG KP    DI G+  + S  SS QPS   S  PSPA S   SPVSS + + + 
Sbjct  76   DGTTYRKGFKPPAS-DISGTPTNFSTNSSIQPSPQSSAFPSPAPSYHGSPVSSSFPSPSR  134

Query  500  NDTDPNS--LIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
             D +P+S  L+P+L N+       +S +P +L     S SAPVTPPLS
Sbjct  135  YDGNPSSYLLLPFLHNI-------ASSIPANLPPLRISNSAPVTPPLS  175



>gb|AFK43588.1| unknown [Medicago truncatula]
Length=323

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGNFKLPKHCDNNEVLKALCSEAGWI  65

Query  311  VEEDGTTYRKGCK  349
            VEEDGTTYRKG K
Sbjct  66   VEEDGTTYRKGSK  78



>ref|XP_010426615.1| PREDICTED: BES1/BZR1 homolog protein 1 [Camelina sativa]
Length=279

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC EAGWIV E
Sbjct  18   RMPTWKERENNKRRERRRRAIAAKIFTGLRSQGNYKLPKHCDNNEVLKALCLEAGWIVHE  77

Query  320  DGTTYRKGCKPTE  358
            DGTTYRKG +P E
Sbjct  78   DGTTYRKGSRPME  90



>gb|KJB29554.1| hypothetical protein B456_005G107000 [Gossypium raimondii]
Length=313

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 109/172 (63%), Gaps = 22/172 (13%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRAIAAKI+ GLR  GNY LPKHCDNNEVLKALC EAGW+VE+
Sbjct  14   RKPSWRERENNRRRERRRRAIAAKIYTGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVED  73

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcss------yqpsqGpsynpspasssfpspvssR  481
            DGTTYRKGCKP   +DI GSS  ++P SS            P  +   + SS   P  +R
Sbjct  74   DGTTYRKGCKPPP-IDIGGSSSKITPFSSQNPSPLSSAFPSPIPSCQVSPSSSSYPSPTR  132

Query  482  YITNNNNDTDPNSLIPWLXNLssgsspsssKLPHHLYIPGGSISAPVTPPLS  637
            +  NN     P++L+P+L N           +P  L     S SAPVTPPLS
Sbjct  133  FDANN-----PSTLLPFLRN----------AIPSSLPPLRISNSAPVTPPLS  169



>ref|NP_001234745.1| mature anther-specific protein LAT61 [Solanum lycopersicum]
 gb|AAK71662.1|AF395901_1 mature anther-specific protein LAT61 [Solanum lycopersicum]
Length=333

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRA+AAKI+ GLR  GNY LPKHCDNNEVLKALC EAGWIVE 
Sbjct  40   RKPSWRERENNRRRERRRRAVAAKIYTGLRAQGNYNLPKHCDNNEVLKALCTEAGWIVEP  99

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCKPT  M+I G
Sbjct  100  DGTTYRKGCKPTP-MEIGG  117



>gb|AFG30996.1| BES1S [Triticum aestivum]
Length=159

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLK LC+EAGW+VE+
Sbjct  20   RTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKELCREAGWVVED  79

Query  320  DGTTYRKGCKP  352
            DGTTYRKG KP
Sbjct  80   DGTTYRKGYKP  90



>ref|XP_003611934.1| BES1/BZR1-like protein [Medicago truncatula]
 gb|AES94892.1| brassinazole-resistant 1 protein [Medicago truncatula]
Length=323

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGNFKLPKHCDNNEVLKALCSEAGWI  65

Query  311  VEEDGTTYRKGCK  349
            VEEDGTTYRKG K
Sbjct  66   VEEDGTTYRKGSK  78



>gb|KFK30297.1| hypothetical protein AALP_AA7G243400 [Arabis alpina]
Length=314

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNK+RERRRRAI AKI++GLR  GNYKLPKHCDNNEVLKALC EAGWIVEE
Sbjct  16   RTPTWKERENNKKRERRRRAITAKIYSGLRAQGNYKLPKHCDNNEVLKALCIEAGWIVEE  75

Query  320  DGTTYRKGCKP  352
            DGTTYRKG KP
Sbjct  76   DGTTYRKGFKP  86



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125