BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF047P16

Length=604
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP10414.1|  unnamed protein product                                311   2e-97   Coffea canephora [robusta coffee]
ref|XP_009613360.1|  PREDICTED: phospholipase D alpha 1-like            310   9e-97   Nicotiana tomentosiformis
ref|XP_009760786.1|  PREDICTED: phospholipase D alpha 1-like            308   4e-96   Nicotiana sylvestris
ref|XP_011078373.1|  PREDICTED: phospholipase D alpha 1-like            304   2e-94   Sesamum indicum [beniseed]
ref|XP_006367508.1|  PREDICTED: phospholipase D alpha 1-like isof...    303   5e-94   Solanum tuberosum [potatoes]
ref|NP_001289824.1|  uncharacterized protein LOC101257989               303   6e-94   
ref|XP_010325100.1|  PREDICTED: phospholipase D alpha 1-like isof...    302   7e-94   Solanum lycopersicum
ref|XP_006367510.1|  PREDICTED: phospholipase D alpha 1-like            294   8e-91   Solanum tuberosum [potatoes]
ref|NP_001234863.1|  phospholipase PLDa2                                294   9e-91   
dbj|BAE79735.1|  phospholipase D alpha 2                                288   1e-88   Arachis hypogaea [goober]
gb|EYU23016.1|  hypothetical protein MIMGU_mgv1a001487mg                284   5e-87   Erythranthe guttata [common monkey flower]
sp|Q41142.1|PLDA1_RICCO  RecName: Full=Phospholipase D alpha 1; S...    278   1e-84   Ricinus communis
gb|AAB37305.1|  phospholipase D                                         278   1e-84   Ricinus communis
ref|XP_002517625.1|  phopholipase d alpha, putative                     278   1e-84   
ref|XP_011073436.1|  PREDICTED: phospholipase D alpha 1                 277   2e-84   Sesamum indicum [beniseed]
ref|XP_007150746.1|  hypothetical protein PHAVU_005G177300g             277   2e-84   Phaseolus vulgaris [French bean]
ref|XP_010097235.1|  Phospholipase D alpha 1                            277   3e-84   Morus notabilis
ref|XP_008454241.1|  PREDICTED: phospholipase D alpha 1                 275   2e-83   Cucumis melo [Oriental melon]
ref|XP_003543677.1|  PREDICTED: phospholipase D alpha 1-like isof...    274   3e-83   Glycine max [soybeans]
emb|CAB43063.1|  phospholipase D1                                       274   3e-83   Craterostigma plantagineum
ref|XP_006385316.1|  phospholipase D family protein                     274   4e-83   
ref|XP_010254401.1|  PREDICTED: phospholipase D alpha 1-like            274   4e-83   Nelumbo nucifera [Indian lotus]
gb|EPS65578.1|  hypothetical protein M569_09194                         273   6e-83   Genlisea aurea
tpg|DAA53241.1|  TPA: phospholipase D family protein                    256   8e-83   
ref|XP_004486668.1|  PREDICTED: phospholipase D alpha 1-like isof...    273   8e-83   
ref|XP_003604419.1|  Phospholipase D alpha                              270   9e-83   
emb|CDY20148.1|  BnaA01g28540D                                          263   1e-82   Brassica napus [oilseed rape]
ref|XP_004506968.1|  PREDICTED: phospholipase D alpha 1-like            271   5e-82   
ref|XP_004156800.1|  PREDICTED: phospholipase D alpha 1-like            271   7e-82   
ref|XP_004152203.1|  PREDICTED: phospholipase D alpha 1-like            270   7e-82   Cucumis sativus [cucumbers]
emb|CAB43062.1|  phospholipase D2                                       270   9e-82   Craterostigma plantagineum
tpg|DAA53242.1|  TPA: phospholipase D family protein                    256   1e-81   
gb|AES86616.2|  phospholipase D alpha 1                                 270   1e-81   Medicago truncatula
tpg|DAA53243.1|  TPA: phospholipase D family protein                    256   1e-81   
gb|ADA72022.1|  phospholipase D                                         270   2e-81   Jatropha curcas
ref|XP_003528334.1|  PREDICTED: phospholipase D alpha 1-like isof...    269   3e-81   
ref|XP_011008452.1|  PREDICTED: phospholipase D alpha 1-like            268   5e-81   Populus euphratica
gb|KDO48582.1|  hypothetical protein CISIN_1g004579mg                   265   8e-81   Citrus sinensis [apfelsine]
ref|XP_009619857.1|  PREDICTED: phospholipase D alpha 1                 266   3e-80   
ref|XP_003531710.1|  PREDICTED: phospholipase D alpha 1-like isof...    266   3e-80   
ref|XP_009146200.1|  PREDICTED: phospholipase D alpha 1                 266   4e-80   Brassica rapa
gb|KHN47766.1|  Phospholipase D alpha 1                                 266   4e-80   Glycine soja [wild soybean]
gb|KHN01336.1|  Phospholipase D alpha 1                                 266   4e-80   Glycine soja [wild soybean]
ref|XP_006465340.1|  PREDICTED: phospholipase D alpha 1                 265   5e-80   Citrus sinensis [apfelsine]
ref|XP_006427267.1|  hypothetical protein CICLE_v10024917mg             265   6e-80   Citrus clementina [clementine]
sp|Q70EW5.2|PLDA1_CYNCA  RecName: Full=Phospholipase D alpha 1; S...    265   8e-80   Cynara cardunculus [cardoon]
emb|CDY21865.1|  BnaC01g35830D                                          265   9e-80   Brassica napus [oilseed rape]
gb|AIE90138.1|  phospholipase D1                                        265   1e-79   Brassica napus [oilseed rape]
sp|O82549.1|PLDA1_BRAOC  RecName: Full=Phospholipase D alpha 1; S...    265   1e-79   Brassica oleracea var. capitata
ref|NP_001275827.1|  phospholipase D alpha                              265   1e-79   Citrus sinensis [apfelsine]
ref|XP_009799916.1|  PREDICTED: phospholipase D alpha 1                 265   1e-79   Nicotiana sylvestris
ref|XP_009625689.1|  PREDICTED: phospholipase D alpha 1                 264   2e-79   Nicotiana tomentosiformis
gb|KCW70692.1|  hypothetical protein EUGRSUZ_F03862                     261   2e-79   Eucalyptus grandis [rose gum]
sp|P93400.2|PLDA1_TOBAC  RecName: Full=Phospholipase D alpha 1; S...    264   2e-79   Nicotiana tabacum [American tobacco]
gb|AGN71005.1|  phospholipase D1                                        264   2e-79   Brassica napus [oilseed rape]
ref|XP_006364210.1|  PREDICTED: phospholipase D alpha 1-like isof...    263   3e-79   Solanum tuberosum [potatoes]
gb|AGN71006.1|  phospholipase D2                                        263   5e-79   Brassica napus [oilseed rape]
sp|P55939.2|PLDA2_BRAOC  RecName: Full=Phospholipase D alpha 2; S...    263   7e-79   Brassica oleracea var. capitata
gb|AAG50297.1|  phospholipase PLDa3                                     260   7e-79   Solanum lycopersicum
emb|CDX97705.1|  BnaA05g23740D                                          263   7e-79   
ref|XP_008805616.1|  PREDICTED: phospholipase D alpha 1-like            262   9e-79   Phoenix dactylifera
ref|XP_009115281.1|  PREDICTED: phospholipase D alpha 2                 262   1e-78   Brassica rapa
gb|AGV22364.1|  phospholipase D4                                        262   1e-78   Brassica napus [oilseed rape]
ref|XP_010063458.1|  PREDICTED: phospholipase D alpha 1                 262   1e-78   Eucalyptus grandis [rose gum]
ref|XP_011012164.1|  PREDICTED: phospholipase D alpha 1                 261   2e-78   Populus euphratica
ref|XP_003597894.1|  Phospholipase D alpha                              261   3e-78   Medicago truncatula
ref|XP_011081358.1|  PREDICTED: phospholipase D alpha 1                 261   4e-78   Sesamum indicum [beniseed]
ref|XP_004235964.1|  PREDICTED: phospholipase D alpha 1                 261   4e-78   Solanum lycopersicum
sp|P86387.1|PLDA1_CARPA  RecName: Full=Phospholipase D alpha 1; S...    261   4e-78   Carica papaya [mamon]
ref|XP_008792036.1|  PREDICTED: phospholipase D alpha 1                 260   7e-78   Phoenix dactylifera
gb|ABU54776.1|  phospholipase D alpha 1 precursor                       260   8e-78   Helianthus annuus
gb|AGV22363.1|  phospholipase D3                                        259   9e-78   Brassica napus [oilseed rape]
ref|XP_008461111.1|  PREDICTED: phospholipase D alpha 1                 260   9e-78   
ref|XP_010907269.1|  PREDICTED: phospholipase D alpha 1                 259   1e-77   Elaeis guineensis
gb|EYU21635.1|  hypothetical protein MIMGU_mgv1a001489mg                259   1e-77   Erythranthe guttata [common monkey flower]
emb|CDO98145.1|  unnamed protein product                                259   1e-77   Coffea canephora [robusta coffee]
ref|XP_004171103.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    253   2e-77   
ref|XP_007135745.1|  hypothetical protein PHAVU_010G155000g             258   3e-77   Phaseolus vulgaris [French bean]
gb|ABB82551.1|  phospholipase D-alpha                                   258   3e-77   Cucumis melo var. inodorus [casaba melon]
ref|XP_002882959.1|  PLDALPHA1                                          258   3e-77   Arabidopsis lyrata subsp. lyrata
ref|XP_006356207.1|  PREDICTED: phospholipase D alpha 1-like isof...    257   8e-77   Solanum tuberosum [potatoes]
ref|XP_002299756.1|  phospholipase D family protein                     257   9e-77   Populus trichocarpa [western balsam poplar]
gb|AHN53202.1|  phospholipase D alpha 1-like protein                    256   1e-76   Cocos nucifera
sp|O04865.1|PLDA1_VIGUN  RecName: Full=Phospholipase D alpha 1; S...    256   1e-76   Vigna unguiculata
ref|XP_009381115.1|  PREDICTED: phospholipase D alpha 1                 256   1e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010250112.1|  PREDICTED: phospholipase D alpha 1                 256   1e-76   
gb|KHG06123.1|  Phospholipase D alpha 1                                 256   2e-76   Gossypium arboreum [tree cotton]
ref|XP_008673445.1|  PREDICTED: phospholipase D alpha 1 isoform X1      256   2e-76   Zea mays [maize]
ref|NP_188194.1|  phospholipase D alpha 1                               256   2e-76   Arabidopsis thaliana [mouse-ear cress]
gb|ACR35730.1|  unknown                                                 256   2e-76   Zea mays [maize]
ref|XP_007150745.1|  hypothetical protein PHAVU_005G177200g             256   2e-76   Phaseolus vulgaris [French bean]
ref|XP_006297003.1|  hypothetical protein CARUB_v10012996mg             256   3e-76   Capsella rubella
gb|ACL53693.1|  unknown                                                 255   3e-76   Zea mays [maize]
ref|NP_001267897.1|  phospholipase D alpha                              255   4e-76   Vitis vinifera
ref|XP_006842069.1|  hypothetical protein AMTR_s00078p00051300          255   4e-76   Amborella trichopoda
gb|KJB70611.1|  hypothetical protein B456_011G083000                    253   4e-76   Gossypium raimondii
ref|XP_006643814.1|  PREDICTED: phospholipase D alpha 1-like            255   5e-76   Oryza brachyantha
ref|XP_008654846.1|  PREDICTED: phospholipase D family protein is...    254   6e-76   Zea mays [maize]
ref|NP_001234102.1|  phospholipase PLDa1                                254   8e-76   
gb|EEC70024.1|  hypothetical protein OsI_00588                          254   1e-75   Oryza sativa Indica Group [Indian rice]
ref|NP_001042153.1|  Os01g0172400                                       254   1e-75   
ref|XP_003569355.1|  PREDICTED: phospholipase D alpha 1                 254   1e-75   Brachypodium distachyon [annual false brome]
gb|ACG63794.1|  phospholipase D alpha                                   254   1e-75   Gossypium arboreum [tree cotton]
ref|XP_006364211.1|  PREDICTED: phospholipase D alpha 1-like isof...    253   1e-75   
gb|AGW22212.1|  phospholipase D alpha                                   254   1e-75   Chorispora bungeana
ref|XP_009408983.1|  PREDICTED: phospholipase D alpha 1-like            253   2e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004135845.1|  PREDICTED: phospholipase D alpha 1-like            253   2e-75   
emb|CDY63527.1|  BnaAnng18990D                                          241   2e-75   Brassica napus [oilseed rape]
gb|ABN13537.2|  phospholipase D                                         253   2e-75   Cucumis sativus [cucumbers]
ref|XP_010465563.1|  PREDICTED: phospholipase D alpha 1-like            253   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010487412.1|  PREDICTED: phospholipase D alpha 1 isoform X2      253   3e-75   Camelina sativa [gold-of-pleasure]
ref|NP_001105686.1|  phospholipase D alpha 1                            253   3e-75   Zea mays [maize]
gb|ACG63795.1|  phospholipase D alpha                                   253   3e-75   Gossypium raimondii
ref|XP_010322318.1|  PREDICTED: phospholipase PLDa1 isoform X1          253   4e-75   Solanum lycopersicum
gb|ADP23922.1|  phospholipase D alpha                                   252   5e-75   Litchi chinensis [litchi]
ref|XP_007023176.1|  Phospholipase D alpha 2 isoform 3                  249   1e-74   
ref|XP_010503392.1|  PREDICTED: phospholipase D alpha 1-like            251   1e-74   Camelina sativa [gold-of-pleasure]
gb|ACV70146.1|  phospholipase D                                         251   2e-74   Gossypium arboreum [tree cotton]
dbj|BAA11136.1|  phospholipase D                                        251   2e-74   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010691149.1|  PREDICTED: phospholipase D alpha 1-like            251   2e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006406922.1|  hypothetical protein EUTSA_v10020083mg             250   2e-74   
ref|XP_009348321.1|  PREDICTED: phospholipase D alpha 1                 250   4e-74   Pyrus x bretschneideri [bai li]
gb|ABX83202.2|  phospholipase D                                         249   6e-74   Lolium temulentum
ref|XP_007023174.1|  Phospholipase D alpha 2 isoform 1                  249   7e-74   
ref|XP_010687988.1|  PREDICTED: phospholipase D alpha 1-like            248   1e-73   
ref|XP_010462102.1|  PREDICTED: phospholipase D alpha 2                 248   2e-73   Camelina sativa [gold-of-pleasure]
emb|CDX87920.1|  BnaC06g09820D                                          237   2e-73   
ref|XP_008373955.1|  PREDICTED: phospholipase D alpha 1                 248   2e-73   
ref|XP_006392903.1|  hypothetical protein EUTSA_v10011246mg             247   4e-73   Eutrema salsugineum [saltwater cress]
gb|ADY75750.1|  phospholipase D alpha                                   247   4e-73   Dimocarpus longan [longan]
ref|XP_008360327.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    247   5e-73   Malus domestica [apple tree]
gb|EMT03624.1|  Phospholipase D alpha 1                                 246   6e-73   
ref|XP_002894388.1|  predicted protein                                  246   7e-73   Arabidopsis lyrata subsp. lyrata
ref|XP_010500864.1|  PREDICTED: phospholipase D alpha 2-like isof...    246   8e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010500868.1|  PREDICTED: phospholipase D alpha 2-like isof...    246   8e-73   Camelina sativa [gold-of-pleasure]
ref|XP_008243731.1|  PREDICTED: phospholipase D alpha 1                 245   2e-72   Prunus mume [ume]
ref|XP_007217042.1|  hypothetical protein PRUPE_ppa001519mg             245   2e-72   Prunus persica
gb|ACG80607.1|  phospholipase D alpha                                   245   2e-72   Prunus persica
ref|XP_010925209.1|  PREDICTED: phospholipase D alpha 1-like            245   2e-72   Elaeis guineensis
ref|XP_009365415.1|  PREDICTED: phospholipase D alpha 1-like            245   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_006306783.1|  hypothetical protein CARUB_v10008323mg             245   3e-72   
gb|EYU24646.1|  hypothetical protein MIMGU_mgv1a001477mg                244   3e-72   Erythranthe guttata [common monkey flower]
ref|NP_001267764.1|  phospholipase D alpha 1-like                       244   5e-72   Setaria italica
gb|EPS60466.1|  hypothetical protein M569_14336                         243   6e-72   Genlisea aurea
tpg|DAA53245.1|  TPA: phospholipase D family protein                    232   1e-71   
emb|CDM81985.1|  unnamed protein product                                243   1e-71   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010479770.1|  PREDICTED: phospholipase D alpha 2-like            243   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_004303313.1|  PREDICTED: phospholipase D alpha 1                 243   2e-71   Fragaria vesca subsp. vesca
gb|AAW83125.1|  phospholipase D alpha                                   243   2e-71   Fragaria x ananassa
ref|NP_175666.1|  phospholipase D alpha 2                               242   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123823.1|  PREDICTED: phospholipase D alpha 2-like            241   6e-71   Brassica rapa
emb|CDY47540.1|  BnaC03g69220D                                          241   6e-71   Brassica napus [oilseed rape]
gb|AAL48261.2|AF451979_1  phospholipase D1                              241   7e-71   Papaver somniferum
ref|XP_002443625.1|  hypothetical protein SORBIDRAFT_08g022520          239   3e-70   Sorghum bicolor [broomcorn]
gb|AAL48262.2|AF451980_1  phospholipase D2                              239   4e-70   Papaver somniferum
ref|XP_010545768.1|  PREDICTED: phospholipase D alpha 1                 238   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_007204652.1|  hypothetical protein PRUPE_ppa001528mg             237   1e-69   Prunus persica
ref|XP_008242775.1|  PREDICTED: phospholipase D alpha 1-like            237   2e-69   Prunus mume [ume]
emb|CDY60551.1|  BnaA05g35700D                                          237   3e-69   Brassica napus [oilseed rape]
ref|XP_009144830.1|  PREDICTED: phospholipase D alpha 2                 236   3e-69   Brassica rapa
tpg|DAA53246.1|  TPA: phospholipase D family protein                    234   4e-69   
ref|XP_009787005.1|  PREDICTED: phospholipase D alpha 1-like isof...    235   8e-69   Nicotiana sylvestris
sp|O04883.1|PLDA1_PIMBR  RecName: Full=Phospholipase D alpha 1; S...    234   3e-68   Spuriopimpinella brachycarpa
ref|XP_006654096.1|  PREDICTED: phospholipase D alpha 1-like            234   3e-68   Oryza brachyantha
ref|NP_001054773.2|  Os05g0171000                                       231   5e-68   
ref|XP_002440692.1|  hypothetical protein SORBIDRAFT_09g005220          231   7e-68   
ref|XP_010656428.1|  PREDICTED: phospholipase D alpha 1-like            233   8e-68   Vitis vinifera
gb|AFW76092.1|  phospholipase D family protein                          228   8e-68   
ref|XP_008673447.1|  PREDICTED: phospholipase D alpha 1 isoform X2      232   1e-67   
ref|XP_002524502.1|  phopholipase d alpha, putative                     230   2e-67   
gb|AAU44332.1|  hypothetical protein                                    231   3e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002282187.3|  PREDICTED: phospholipase D alpha 1-like            230   9e-67   Vitis vinifera
ref|XP_008650412.1|  PREDICTED: phospholipase D alpha 1-like            229   1e-66   
ref|XP_002325225.2|  hypothetical protein POPTR_0018s13110g             229   1e-66   Populus trichocarpa [western balsam poplar]
ref|XP_008649399.1|  PREDICTED: phospholipase D alpha 1-like            229   3e-66   Zea mays [maize]
ref|XP_011017763.1|  PREDICTED: phospholipase D alpha 1-like            228   4e-66   Populus euphratica
gb|AFW77332.1|  phospholipase D family protein                          228   5e-66   
gb|KCW70693.1|  hypothetical protein EUGRSUZ_F03862                     227   8e-66   Eucalyptus grandis [rose gum]
ref|XP_006656220.1|  PREDICTED: phospholipase D alpha 2-like            227   1e-65   Oryza brachyantha
ref|XP_003568837.1|  PREDICTED: phospholipase D alpha 1-like            226   3e-65   
ref|NP_001058017.1|  Os06g0604400                                       225   6e-65   
ref|XP_011070230.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    224   7e-65   Sesamum indicum [beniseed]
ref|XP_004965943.1|  PREDICTED: phospholipase D alpha 2-like            224   9e-65   Setaria italica
emb|CAN76339.1|  hypothetical protein VITISV_014670                     223   2e-64   Vitis vinifera
gb|KJB68102.1|  hypothetical protein B456_010G225600                    223   3e-64   Gossypium raimondii
gb|KJB70612.1|  hypothetical protein B456_011G083000                    221   8e-64   Gossypium raimondii
dbj|BAA19466.1|  phospholipase D                                        221   2e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009787006.1|  PREDICTED: phospholipase D alpha 1-like isof...    220   2e-63   Nicotiana sylvestris
gb|EYU32345.1|  hypothetical protein MIMGU_mgv1a001383mg                218   1e-62   Erythranthe guttata [common monkey flower]
gb|EMT24153.1|  Phospholipase D alpha 1                                 218   2e-62   
emb|CBI36314.3|  unnamed protein product                                208   3e-62   Vitis vinifera
gb|KDP32412.1|  hypothetical protein JCGZ_13337                         217   4e-62   Jatropha curcas
ref|XP_004287315.1|  PREDICTED: phospholipase D alpha 1-like            217   4e-62   Fragaria vesca subsp. vesca
ref|XP_003563661.1|  PREDICTED: phospholipase D alpha 2-like            216   7e-62   Brachypodium distachyon [annual false brome]
emb|CBI28204.3|  unnamed protein product                                214   1e-61   Vitis vinifera
dbj|BAJ93878.1|  predicted protein                                      215   1e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI28205.3|  unnamed protein product                                213   2e-61   Vitis vinifera
ref|XP_010090252.1|  Phospholipase D alpha 1                            214   3e-61   
ref|NP_001146242.1|  uncharacterized protein LOC100279815               214   3e-61   Zea mays [maize]
ref|XP_008385550.1|  PREDICTED: phospholipase D alpha 1-like            214   6e-61   
ref|XP_009364028.1|  PREDICTED: phospholipase D alpha 1-like            213   8e-61   Pyrus x bretschneideri [bai li]
ref|XP_009368855.1|  PREDICTED: phospholipase D alpha 1-like            213   1e-60   Pyrus x bretschneideri [bai li]
gb|AAC49274.1|  phospholipase D                                         213   1e-60   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ85695.1|  predicted protein                                      211   4e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94103.1|  predicted protein                                      211   4e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT32202.1|  Phospholipase D alpha 2                                 211   5e-60   
ref|XP_007013459.1|  Phospholipase D alpha 1                            209   2e-59   
gb|KDO48581.1|  hypothetical protein CISIN_1g004579mg                   206   3e-59   Citrus sinensis [apfelsine]
ref|XP_002515518.1|  phopholipase d alpha, putative                     208   7e-59   Ricinus communis
gb|KDO48580.1|  hypothetical protein CISIN_1g004579mg                   207   1e-58   Citrus sinensis [apfelsine]
ref|XP_009407292.1|  PREDICTED: phospholipase D alpha 1-like            206   5e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN07080.1|  Phospholipase D alpha 1                                 202   5e-57   Glycine soja [wild soybean]
ref|XP_011039694.1|  PREDICTED: phospholipase D alpha 1-like            202   8e-57   Populus euphratica
emb|CAN81667.1|  hypothetical protein VITISV_017804                     199   3e-56   Vitis vinifera
ref|XP_011459180.1|  PREDICTED: phospholipase D alpha 1-like            200   4e-56   Fragaria vesca subsp. vesca
ref|XP_008219493.1|  PREDICTED: phospholipase D alpha 1-like            199   1e-55   Prunus mume [ume]
ref|XP_006581357.1|  PREDICTED: phospholipase D alpha 1-like            197   3e-55   Glycine max [soybeans]
ref|XP_009614730.1|  PREDICTED: phospholipase D alpha 1 {ECO:0000...    197   5e-55   Nicotiana tomentosiformis
ref|XP_010923204.1|  PREDICTED: phospholipase D alpha 1-like            197   5e-55   Elaeis guineensis
ref|XP_008777837.1|  PREDICTED: phospholipase D alpha 1-like            197   7e-55   Phoenix dactylifera
emb|CDP13510.1|  unnamed protein product                                196   7e-55   Coffea canephora [robusta coffee]
gb|EMS46811.1|  Phospholipase D alpha 2                                 195   1e-54   Triticum urartu
emb|CDP13512.1|  unnamed protein product                                196   1e-54   Coffea canephora [robusta coffee]
ref|XP_006350007.1|  PREDICTED: phospholipase D alpha 1-like            195   3e-54   Solanum tuberosum [potatoes]
ref|XP_009758055.1|  PREDICTED: phospholipase D alpha 1-like            194   4e-54   Nicotiana sylvestris
gb|KDP33596.1|  hypothetical protein JCGZ_07167                         194   6e-54   Jatropha curcas
ref|XP_002963233.1|  hypothetical protein SELMODRAFT_165923             194   6e-54   Selaginella moellendorffii
ref|XP_004251821.1|  PREDICTED: phospholipase D alpha 1-like            194   6e-54   Solanum lycopersicum
ref|XP_002974536.1|  hypothetical protein SELMODRAFT_267774             194   7e-54   Selaginella moellendorffii
ref|XP_002437251.1|  hypothetical protein SORBIDRAFT_10g023630          194   7e-54   Sorghum bicolor [broomcorn]
gb|EPS71739.1|  hypothetical protein M569_03019                         193   1e-53   Genlisea aurea
ref|XP_007011867.1|  Phospholipase D alpha 1                            193   1e-53   
ref|XP_010228542.1|  PREDICTED: phospholipase D alpha 1-like isof...    191   7e-53   Brachypodium distachyon [annual false brome]
ref|XP_010648662.1|  PREDICTED: phospholipase D alpha 1-like            191   7e-53   Vitis vinifera
ref|NP_001146559.1|  phospholipase D family protein                     190   8e-53   Zea mays [maize]
gb|ACL53520.1|  unknown                                                 190   1e-52   Zea mays [maize]
ref|XP_008394091.1|  PREDICTED: phospholipase D alpha 1-like isof...    189   1e-52   
ref|XP_007137028.1|  hypothetical protein PHAVU_009G093500g             189   2e-52   Phaseolus vulgaris [French bean]
ref|XP_008394090.1|  PREDICTED: phospholipase D alpha 1-like isof...    189   3e-52   
ref|XP_008673230.1|  PREDICTED: phospholipase D family protein is...    189   5e-52   
tpg|DAA45660.1|  TPA: phospholipase D family protein                    188   5e-52   
ref|XP_004138856.1|  PREDICTED: phospholipase D alpha 2-like            188   6e-52   
ref|XP_008673211.1|  PREDICTED: phospholipase D family protein is...    188   7e-52   Zea mays [maize]
dbj|BAK02630.1|  predicted protein                                      188   7e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010050012.1|  PREDICTED: phospholipase D alpha 1-like            188   8e-52   
tpg|DAA53239.1|  TPA: phospholipase D family protein                    177   1e-51   
ref|XP_004160794.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    187   1e-51   
gb|KCW82853.1|  hypothetical protein EUGRSUZ_C04222                     187   1e-51   Eucalyptus grandis [rose gum]
gb|KJB07619.1|  hypothetical protein B456_001G0333002                   187   2e-51   Gossypium raimondii
ref|XP_002308663.2|  hypothetical protein POPTR_0006s27000g             187   2e-51   
tpg|DAA53240.1|  TPA: phospholipase D family protein                    177   2e-51   
ref|XP_010228543.1|  PREDICTED: phospholipase D alpha 1-like isof...    186   4e-51   
gb|KGN62948.1|  hypothetical protein Csa_2G381740                       184   2e-50   Cucumis sativus [cucumbers]
ref|XP_007225238.1|  hypothetical protein PRUPE_ppa001818mg             184   2e-50   
ref|XP_002964421.1|  hypothetical protein SELMODRAFT_82084              184   2e-50   Selaginella moellendorffii
ref|XP_004979743.1|  PREDICTED: phospholipase D alpha 2-like            183   6e-50   Setaria italica
gb|EEE65981.1|  hypothetical protein OsJ_21905                          182   7e-50   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058015.1|  Os06g0604200                                       182   2e-49   
ref|XP_009355736.1|  PREDICTED: phospholipase D alpha 1-like            181   4e-49   
gb|AAF78754.1|AF271356_1  phospholipase D                               180   6e-49   Oryza sativa Indica Group [Indian rice]
tpg|DAA45665.1|  TPA: phospholipase D family protein                    180   6e-49   
ref|XP_002967619.1|  hypothetical protein SELMODRAFT_231070             179   2e-48   Selaginella moellendorffii
ref|XP_004501331.1|  PREDICTED: phospholipase D alpha 1-like isof...    179   2e-48   Cicer arietinum [garbanzo]
ref|XP_008445210.1|  PREDICTED: phospholipase D alpha 1-like            179   2e-48   Cucumis melo [Oriental melon]
ref|XP_004501330.1|  PREDICTED: phospholipase D alpha 1-like isof...    178   4e-48   Cicer arietinum [garbanzo]
ref|XP_006650158.1|  PREDICTED: phospholipase D alpha 1-like            177   5e-48   Oryza brachyantha
ref|XP_010048204.1|  PREDICTED: phospholipase D alpha 1-like            177   6e-48   Eucalyptus grandis [rose gum]
gb|EEC80931.1|  hypothetical protein OsI_23625                          177   6e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_006394788.1|  hypothetical protein EUTSA_v10003659mg             176   1e-47   Eutrema salsugineum [saltwater cress]
ref|XP_008660012.1|  PREDICTED: phospholipase D alpha 1-like            176   2e-47   
ref|XP_003603407.1|  Phospholipase D alpha                              175   5e-47   Medicago truncatula
ref|XP_006287080.1|  hypothetical protein CARUB_v10000238mg             174   6e-47   Capsella rubella
gb|AAR87276.1|  putative phospholipase D                                175   7e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004501328.1|  PREDICTED: phospholipase D alpha 1-like isof...    174   8e-47   Cicer arietinum [garbanzo]
gb|EYU23014.1|  hypothetical protein MIMGU_mgv1a0192722mg               171   8e-47   Erythranthe guttata [common monkey flower]
ref|XP_003603403.1|  Phospholipase D alpha                              174   8e-47   Medicago truncatula
ref|XP_009151064.1|  PREDICTED: phospholipase D zeta                    173   2e-46   Brassica rapa
ref|XP_006394787.1|  hypothetical protein EUTSA_v10003665mg             172   4e-46   
ref|XP_010454864.1|  PREDICTED: phospholipase D zeta-like               172   6e-46   Camelina sativa [gold-of-pleasure]
ref|NP_197919.1|  phospholipase D alpha 3                               171   8e-46   
ref|XP_010424312.1|  PREDICTED: phospholipase D zeta-like               171   8e-46   
emb|CDY05490.1|  BnaA02g32010D                                          171   9e-46   
ref|XP_009129965.1|  PREDICTED: phospholipase D zeta-like               171   9e-46   
emb|CDY05351.1|  BnaC02g40590D                                          171   1e-45   
ref|XP_010493792.1|  PREDICTED: phospholipase D zeta                    171   2e-45   
ref|XP_010325101.1|  PREDICTED: phospholipase D alpha 1-like isof...    169   3e-45   
ref|XP_006656219.1|  PREDICTED: phospholipase D alpha 2-like            170   3e-45   
ref|XP_002874254.1|  predicted protein                                  169   4e-45   
gb|AAF78755.1|AF271357_1  phospholipase D                               170   4e-45   
ref|NP_001058016.1|  Os06g0604300                                       170   4e-45   
gb|EAY90307.1|  hypothetical protein OsI_11882                          169   1e-44   
ref|XP_006581358.1|  PREDICTED: phospholipase D alpha 1-like            167   3e-44   
ref|XP_007137027.1|  hypothetical protein PHAVU_009G093400g             167   4e-44   
ref|XP_002451299.1|  hypothetical protein SORBIDRAFT_05g027210          166   8e-44   
ref|XP_010541603.1|  PREDICTED: phospholipase D zeta                    165   2e-43   
ref|XP_004984143.1|  PREDICTED: phospholipase D alpha 1-like isof...    165   2e-43   
ref|XP_004984141.1|  PREDICTED: phospholipase D alpha 1-like isof...    164   4e-43   
ref|XP_006859166.1|  hypothetical protein AMTR_s00070p00140920          152   4e-43   
ref|XP_009401714.1|  PREDICTED: phospholipase D alpha 1-like isof...    164   5e-43   
ref|XP_004984142.1|  PREDICTED: phospholipase D alpha 1-like isof...    164   5e-43   
gb|KJB55001.1|  hypothetical protein B456_009G057800                    164   6e-43   
ref|XP_004984144.1|  PREDICTED: phospholipase D alpha 1-like isof...    164   6e-43   
gb|KDO61728.1|  hypothetical protein CISIN_1g003523mg                   163   9e-43   
ref|XP_007011868.1|  Phospholipase D alpha 2 isoform 1                  163   9e-43   
ref|XP_006450437.1|  hypothetical protein CICLE_v10010712mg             163   1e-42   
ref|XP_009401723.1|  PREDICTED: phospholipase D alpha 1-like isof...    162   1e-42   
ref|XP_002972515.1|  hypothetical protein SELMODRAFT_441825             160   1e-41   
ref|XP_002992572.1|  hypothetical protein SELMODRAFT_186850             160   1e-41   
ref|XP_006483709.1|  PREDICTED: phospholipase D alpha 1-like            160   1e-41   
ref|XP_007011869.1|  Phospholipase D alpha 2 isoform 2                  159   2e-41   
ref|XP_010696306.1|  PREDICTED: phospholipase D alpha 1-like            159   2e-41   
ref|XP_010101275.1|  Phospholipase D alpha 1                            159   2e-41   
ref|XP_001753756.1|  predicted protein                                  158   4e-41   
ref|XP_001762942.1|  predicted protein                                  157   8e-41   
ref|XP_010942074.1|  PREDICTED: phospholipase D alpha 1-like            157   8e-41   
gb|ACI96319.1|  putative phospholipase D alpha 1 precursor              155   1e-40   
gb|ACI96318.1|  putative phospholipase D alpha 1 precursor              154   2e-40   
gb|ACI96316.1|  putative phospholipase D alpha 1 precursor              154   3e-40   
gb|ACI96317.1|  putative phospholipase D alpha 1 precursor              154   3e-40   
ref|XP_008810306.1|  PREDICTED: phospholipase D alpha 1-like            154   1e-39   
gb|KHN22449.1|  Phospholipase D alpha 1                                 147   2e-39   
emb|CBI21040.3|  unnamed protein product                                153   2e-39   
ref|XP_006657112.1|  PREDICTED: phospholipase D alpha 2-like            152   8e-39   
ref|XP_001753255.1|  predicted protein                                  152   1e-38   
ref|XP_001767482.1|  predicted protein                                  150   3e-38   
ref|XP_006657113.1|  PREDICTED: phospholipase D alpha 2-like            149   6e-38   
gb|EMT15739.1|  Phospholipase D alpha 2                                 143   8e-36   
gb|ACN85289.1|  unknown                                                 139   4e-35   
emb|CDX80505.1|  BnaC07g29390D                                          141   6e-35   
dbj|BAE79734.1|  phospholipase D alpha 1                                138   6e-34   
gb|AAP50498.1|  phospholipase D                                         138   7e-34   
gb|EEC83543.1|  hypothetical protein OsI_29158                          134   2e-32   
ref|NP_001061758.2|  Os08g0401800                                       134   2e-32   
dbj|BAC98682.1|  putative phospholipase D alpha 1                       134   2e-32   
gb|EEE68649.1|  hypothetical protein OsJ_27225                          134   3e-32   
ref|XP_003576533.1|  PREDICTED: phospholipase D alpha 1-like            132   7e-32   
ref|XP_007137026.1|  hypothetical protein PHAVU_009G093400g             129   1e-30   
gb|EEE59186.1|  hypothetical protein OsJ_11122                          128   2e-30   
ref|XP_004956847.1|  PREDICTED: phospholipase D alpha 1-like            128   3e-30   
gb|AFW87187.1|  phospholipase D family protein                          126   8e-30   
gb|EMT21985.1|  Phospholipase D beta 1                                  126   9e-30   
emb|CDX88175.1|  BnaA06g27660D                                          126   1e-29   
ref|NP_001063203.1|  Os09g0421300                                       125   2e-29   
gb|EMS46791.1|  Phospholipase D beta 1                                  125   3e-29   
ref|NP_001234108.1|  phospholipase PLDb2                                125   3e-29   
gb|EAZ09131.1|  hypothetical protein OsI_31401                          124   4e-29   
ref|XP_002462392.1|  hypothetical protein SORBIDRAFT_02g024910          124   5e-29   
ref|XP_010323957.1|  PREDICTED: phospholipase PLDb2 isoform X1          125   5e-29   
gb|EMS68436.1|  Phospholipase D alpha 2                                 124   7e-29   
ref|XP_006339497.1|  PREDICTED: phospholipase D beta 1-like             124   1e-28   
ref|XP_009381793.1|  PREDICTED: phospholipase D alpha 1-like            123   2e-28   
dbj|BAK05371.1|  predicted protein                                      122   3e-28   
gb|KEH18998.1|  phospholipase D alpha 1                                 122   3e-28   
ref|XP_002320087.2|  hypothetical protein POPTR_0014s07070g             122   3e-28   
gb|KEH18997.1|  phospholipase D alpha 1                                 122   4e-28   
gb|KDO43384.1|  hypothetical protein CISIN_1g0011262mg                  119   5e-28   
ref|XP_003611170.1|  Phospholipase D                                    120   1e-27   
ref|XP_009762579.1|  PREDICTED: phospholipase D beta 1-like             119   3e-27   
emb|CDP08909.1|  unnamed protein product                                119   4e-27   
gb|EMS68435.1|  Phospholipase D alpha 2                                 119   4e-27   
gb|EMT22155.1|  Phospholipase D alpha 2                                 118   5e-27   
ref|XP_006341817.1|  PREDICTED: phospholipase D delta-like isofor...    119   5e-27   
ref|XP_006341816.1|  PREDICTED: phospholipase D delta-like isofor...    119   5e-27   
ref|XP_006441123.1|  hypothetical protein CICLE_v10018583mg             119   7e-27   
ref|XP_002301317.2|  PHOSPHOLIPASE D BETA 1 family protein              119   7e-27   
ref|XP_011023457.1|  PREDICTED: phospholipase D beta 2-like isofo...    118   8e-27   
ref|XP_011023456.1|  PREDICTED: phospholipase D beta 2-like isofo...    118   8e-27   
ref|XP_011463800.1|  PREDICTED: uncharacterized protein LOC101313411    119   9e-27   
gb|AES94127.2|  phospholipase D alpha 1                                 118   1e-26   
gb|EMS45543.1|  Phospholipase D beta 1                                  118   1e-26   
ref|XP_008670197.1|  PREDICTED: phospholipase D alpha 1-like isof...    117   1e-26   
ref|XP_003611169.1|  Phospholipase D                                    117   1e-26   
ref|XP_001755745.1|  predicted protein                                  117   2e-26   
ref|XP_006341798.1|  PREDICTED: phospholipase D beta 1-like             117   2e-26   
ref|XP_006491998.1|  PREDICTED: phospholipase D beta 1-like isofo...    117   2e-26   
gb|AEW07932.1|  hypothetical protein 0_14784_01                         109   2e-26   
gb|KDO43378.1|  hypothetical protein CISIN_1g0011262mg                  115   5e-26   
ref|XP_009604374.1|  PREDICTED: phospholipase D beta 1-like             115   5e-26   
ref|XP_004248573.2|  PREDICTED: phospholipase D gamma 1-like            116   5e-26   
ref|XP_009766427.1|  PREDICTED: phospholipase D beta 1-like             115   5e-26   
ref|XP_002299568.2|  hypothetical protein POPTR_0001s08560g             114   7e-26   
ref|XP_009593225.1|  PREDICTED: phospholipase D beta 1-like             115   7e-26   
ref|XP_011463799.1|  PREDICTED: phospholipase D gamma 1-like            114   2e-25   
ref|XP_006396843.1|  hypothetical protein EUTSA_v10028422mg             114   2e-25   
gb|KCW72878.1|  hypothetical protein EUGRSUZ_E01326                     114   2e-25   
emb|CDY13284.1|  BnaC09g23720D                                          112   2e-25   
ref|XP_010272593.1|  PREDICTED: phospholipase D beta 1-like isofo...    114   2e-25   
ref|XP_011029151.1|  PREDICTED: phospholipase D beta 1-like             114   2e-25   
ref|XP_006858490.1|  hypothetical protein AMTR_s00071p00126030          114   2e-25   
ref|XP_010272589.1|  PREDICTED: phospholipase D beta 1-like isofo...    114   2e-25   
gb|EMT00669.1|  Phospholipase D beta 1                                  114   2e-25   
ref|XP_010540447.1|  PREDICTED: phospholipase D gamma 1-like            114   2e-25   
ref|XP_010058437.1|  PREDICTED: phospholipase D gamma 1                 114   3e-25   
ref|XP_010272591.1|  PREDICTED: phospholipase D beta 1-like isofo...    114   3e-25   
ref|XP_002509685.1|  phospholipase d beta, putative                     114   3e-25   
ref|XP_010272594.1|  PREDICTED: phospholipase D beta 1-like             114   3e-25   
ref|XP_009796632.1|  PREDICTED: phospholipase D delta-like              113   3e-25   
ref|XP_001773645.1|  predicted protein                                  113   3e-25   
ref|XP_003562179.1|  PREDICTED: phospholipase D beta 1-like             113   3e-25   
ref|XP_004983867.1|  PREDICTED: phospholipase D beta 1-like             113   4e-25   
gb|KJB25734.1|  hypothetical protein B456_004G206700                    112   4e-25   
gb|EMT16220.1|  Phospholipase D beta 1                                  113   5e-25   
ref|XP_010234931.1|  PREDICTED: phospholipase D beta 1-like             113   5e-25   
ref|XP_004248600.1|  PREDICTED: phospholipase D delta-like              113   5e-25   
ref|XP_009600603.1|  PREDICTED: phospholipase D delta-like              113   5e-25   
ref|XP_004510892.1|  PREDICTED: phospholipase D beta 1-like             113   6e-25   
ref|NP_192921.1|  phospholipase D gamma 3                               112   6e-25   
gb|KFK31940.1|  hypothetical protein AALP_AA6G179600                    112   7e-25   
gb|KJB25733.1|  hypothetical protein B456_004G206700                    112   7e-25   
gb|KJB25732.1|  hypothetical protein B456_004G206700                    112   7e-25   
ref|XP_006287264.1|  hypothetical protein CARUB_v10000454mg             111   9e-25   
ref|XP_003551823.1|  PREDICTED: phospholipase D beta 1-like isofo...    112   9e-25   
gb|KHN13886.1|  Phospholipase D beta 2                                  112   1e-24   
ref|XP_011035015.1|  PREDICTED: phospholipase D beta 2-like             112   1e-24   
ref|XP_004298731.1|  PREDICTED: phospholipase D beta 1-like             112   1e-24   
ref|NP_192922.1|  phospholipase D gamma 1                               112   1e-24   
ref|XP_010325304.1|  PREDICTED: phospholipase PLDb1 isoform X2          112   1e-24   
ref|XP_010325303.1|  PREDICTED: phospholipase PLDb1 isoform X1          112   1e-24   
tpg|DAA39787.1|  TPA: phospholipase D family protein                    108   2e-24   
gb|ACB98704.1|  phospholipase D gamma 1                                 111   2e-24   
ref|NP_001234509.1|  phospholipase PLDb1                                111   2e-24   
ref|XP_010255578.1|  PREDICTED: phospholipase D beta 2-like isofo...    111   2e-24   
ref|XP_010255577.1|  PREDICTED: phospholipase D beta 2-like isofo...    111   2e-24   
gb|EPS67301.1|  hypothetical protein M569_07474                         111   2e-24   
gb|KHG08188.1|  Phospholipase D beta 1 -like protein                    111   2e-24   
ref|XP_009402071.1|  PREDICTED: phospholipase D gamma 1-like            111   3e-24   
emb|CDX86742.1|  BnaA09g21320D                                          110   3e-24   
ref|XP_009102711.1|  PREDICTED: phospholipase D gamma 1                 110   3e-24   
ref|XP_009772650.1|  PREDICTED: phospholipase D beta 2-like             111   3e-24   
gb|KDP43704.1|  hypothetical protein JCGZ_22331                         110   3e-24   
ref|XP_010053353.1|  PREDICTED: phospholipase D beta 1-like             110   3e-24   
emb|CAD11899.1|  phospholipase D                                        110   3e-24   
gb|EMT19808.1|  Phospholipase D alpha 2                                 110   3e-24   
dbj|BAJ91145.1|  predicted protein                                      110   3e-24   
gb|EEE51295.1|  hypothetical protein OsJ_32215                          110   3e-24   
ref|XP_004172078.1|  PREDICTED: phospholipase D beta 1-like             110   4e-24   
ref|NP_001065108.1|  Os10g0524400                                       110   4e-24   
gb|EAY79266.1|  hypothetical protein OsI_34382                          110   4e-24   
gb|KCW77623.1|  hypothetical protein EUGRSUZ_D01933                     110   4e-24   
ref|XP_007051965.1|  Phospholipase D beta 1 isoform 1                   110   5e-24   
ref|XP_006828836.1|  hypothetical protein AMTR_s00001p00146970          110   5e-24   
ref|XP_010455598.1|  PREDICTED: phospholipase D gamma 1-like            110   5e-24   
ref|XP_003520025.1|  PREDICTED: phospholipase D beta 1-like             110   5e-24   
ref|XP_010422137.1|  PREDICTED: phospholipase D gamma 1-like            110   5e-24   
ref|XP_004145051.1|  PREDICTED: phospholipase D beta 1-like             110   5e-24   
ref|XP_011091260.1|  PREDICTED: phospholipase D gamma 1-like            110   5e-24   
ref|XP_008670198.1|  PREDICTED: phospholipase D alpha 1-like isof...    110   5e-24   
ref|XP_010434095.1|  PREDICTED: phospholipase D gamma 1                 110   6e-24   
ref|XP_006590738.1|  PREDICTED: phospholipase D delta-like              110   6e-24   
ref|XP_002272857.1|  PREDICTED: phospholipase D beta 2                  110   6e-24   
ref|XP_003623811.1|  Phospholipase D                                    110   7e-24   
ref|XP_002874728.1|  PLDGAMMA1                                          109   8e-24   
gb|AAB87672.1|  phospholipase D-gamma                                   109   8e-24   
ref|XP_007158450.1|  hypothetical protein PHAVU_002G153400g             109   8e-24   
ref|XP_010315479.1|  PREDICTED: phospholipase D delta-like              109   8e-24   
ref|XP_009410696.1|  PREDICTED: phospholipase D delta-like              109   9e-24   
ref|XP_007134946.1|  hypothetical protein PHAVU_010G088900g             109   9e-24   
ref|XP_010244834.1|  PREDICTED: phospholipase D delta-like isofor...    109   1e-23   
ref|XP_010244833.1|  PREDICTED: phospholipase D delta-like isofor...    109   1e-23   
ref|XP_010244830.1|  PREDICTED: phospholipase D delta-like isofor...    109   1e-23   
ref|XP_010244835.1|  PREDICTED: phospholipase D delta-like isofor...    109   1e-23   
ref|XP_008460150.1|  PREDICTED: phospholipase D beta 2-like             109   1e-23   
emb|CDX90066.1|  BnaA10g00160D                                          109   1e-23   
gb|KHN04601.1|  Phospholipase D beta 1                                  109   1e-23   
ref|XP_003529972.1|  PREDICTED: phospholipase D beta 1-like             109   1e-23   
ref|XP_007051966.1|  Phospholipase D beta 1 isoform 2                   109   1e-23   
emb|CDY15144.1|  BnaC05g00230D                                          109   1e-23   
ref|XP_009119747.1|  PREDICTED: phospholipase D beta 1                  109   1e-23   
gb|KJB41190.1|  hypothetical protein B456_007G094100                    109   1e-23   
ref|XP_010529524.1|  PREDICTED: phospholipase D gamma 1                 109   1e-23   
tpg|DAA46011.1|  TPA: phospholipase D family protein                    109   1e-23   
gb|KDO63615.1|  hypothetical protein CISIN_1g003057mg                   107   1e-23   
gb|EYU32034.1|  hypothetical protein MIMGU_mgv1a000642mg                109   1e-23   
ref|XP_004492672.1|  PREDICTED: phospholipase D beta 1-like isofo...    108   1e-23   
ref|XP_011074721.1|  PREDICTED: phospholipase D delta-like              108   1e-23   
gb|KJB41189.1|  hypothetical protein B456_007G094100                    109   1e-23   
ref|XP_006440506.1|  hypothetical protein CICLE_v10018726mg             108   1e-23   
gb|EYU36813.1|  hypothetical protein MIMGU_mgv1a001300mg                108   1e-23   
ref|XP_008803289.1|  PREDICTED: phospholipase D beta 1-like             106   1e-23   
gb|KDO63614.1|  hypothetical protein CISIN_1g003057mg                   107   2e-23   
ref|XP_009627346.1|  PREDICTED: phospholipase D gamma 1-like            108   2e-23   
ref|XP_002874727.1|  PLDGAMMA1                                          108   2e-23   
ref|XP_006440507.1|  hypothetical protein CICLE_v10018726mg             108   2e-23   
gb|KJB41192.1|  hypothetical protein B456_007G094300                    108   2e-23   
gb|KHG24517.1|  Phospholipase D beta 1                                  108   2e-23   
gb|KJB41196.1|  hypothetical protein B456_007G094300                    108   2e-23   
gb|KDP28706.1|  hypothetical protein JCGZ_14477                         108   2e-23   
gb|KHG24518.1|  Phospholipase D beta 1                                  108   2e-23   
ref|XP_006349430.1|  PREDICTED: phospholipase D delta-like              108   2e-23   
ref|XP_004492671.1|  PREDICTED: phospholipase D beta 1-like isofo...    108   2e-23   
ref|XP_007139245.1|  hypothetical protein PHAVU_008G013400g             108   2e-23   
gb|AAN05430.1|  phospholipase D beta 1 isoform 1a                       108   3e-23   
gb|KHG24516.1|  Phospholipase D beta 1                                  108   3e-23   
gb|AAD43343.1|AF159139_1  phospholipase D                               108   3e-23   
ref|XP_003517450.1|  PREDICTED: phospholipase D beta 1-like isofo...    108   3e-23   
ref|XP_008670092.1|  PREDICTED: phospholipase D delta-like isofor...    107   3e-23   
gb|AER41581.1|  phospholipase+D                                         108   3e-23   
gb|AER41636.1|  phospholipase+D                                         107   3e-23   
ref|XP_006657599.1|  PREDICTED: phospholipase D delta-like              107   3e-23   
ref|XP_010272588.1|  PREDICTED: phospholipase D gamma 1-like            108   3e-23   



>emb|CDP10414.1| unnamed protein product [Coffea canephora]
Length=807

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YE+DK+K     NL HKIVEG ERVVGFN TASRLYAT+DLEKARV
Sbjct  1    MAQILLHGTLHATIYEIDKLKGGFGQNLLHKIVEGIERVVGFNNTASRLYATVDLEKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLL+   NPRWYESFHIYCAHMASNV+F+VKVDNPIGAELIGRAY+P + LLG EE+
Sbjct  61   GRTRLLEGDSNPRWYESFHIYCAHMASNVIFTVKVDNPIGAELIGRAYLPVQELLGEEEI  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  576
            D WLP+L +D  PIH HSKIHVK+Q+ DV RER W RG+K+ARFPGVPYTFF Q  GCKV
Sbjct  121  DRWLPILGDDHKPIHGHSKIHVKVQYFDVTRERNWSRGIKSARFPGVPYTFFSQHNGCKV  180

Query  577  TLYQDAHVP  603
            TLYQDAH+P
Sbjct  181  TLYQDAHIP  189



>ref|XP_009613360.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana tomentosiformis]
Length=807

 Score =   310 bits (794),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  ++EVDKI T+    LF+K+V G E  +GFNKTASRLYATIDL+KARV
Sbjct  1    MAQILLHGTLHATIFEVDKIHTNFGKELFNKVVHGIEGAIGFNKTASRLYATIDLQKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLLDEHKNPRWYESFHIYCAHMA++V+F+VKVDNPIGAELIGRAY+P + LL GEEV
Sbjct  61   GRTRLLDEHKNPRWYESFHIYCAHMAADVIFTVKVDNPIGAELIGRAYLPVQELLDGEEV  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  576
            D+WL +LD +R P+H HSKIHVKLQF DV RE  W RG+K  RFPGVPYTFF QR+GCKV
Sbjct  121  DKWLEILDTERKPVHGHSKIHVKLQFFDVTREYNWNRGIKVTRFPGVPYTFFSQRQGCKV  180

Query  577  TLYQDAHVP  603
            TLYQD+HVP
Sbjct  181  TLYQDSHVP  189



>ref|XP_009760786.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
Length=807

 Score =   308 bits (790),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  ++EVDKI T+    LF+K+V G E  +GF+KTASRLYATIDL+KARV
Sbjct  1    MAQILLHGTLHATIFEVDKIHTNFGKELFNKVVHGIEGAIGFSKTASRLYATIDLQKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLL+EHKNPRWYESFHIYCAHMA++V+F+VK+DNPIGAELIGRAY+P R LL GEEV
Sbjct  61   GRTRLLNEHKNPRWYESFHIYCAHMAADVIFTVKIDNPIGAELIGRAYLPVRELLDGEEV  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  576
            D+WL +LD +R P+H HSKIHVKLQF DV RE  W RG+K  RFPGVPYTFF QR+GCKV
Sbjct  121  DKWLEILDTERKPVHGHSKIHVKLQFFDVTREYNWNRGIKVTRFPGVPYTFFSQRQGCKV  180

Query  577  TLYQDAHVP  603
            TLYQDAHVP
Sbjct  181  TLYQDAHVP  189



>ref|XP_011078373.1| PREDICTED: phospholipase D alpha 1-like [Sesamum indicum]
Length=808

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG LH  +YE+DK+ T  L   FHK+VEG E V+GF  TAS+LYATIDL KARV
Sbjct  1    MAQILLHGDLHATIYEIDKLHTGTLTKFFHKVVEGIEEVLGFGDTASKLYATIDLGKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRLL  +H NPRWYESFHIYCAHMAS VVF+VKVDNPIGAELIGRAY+P   LL GEE
Sbjct  61   GRTRLLAHQHSNPRWYESFHIYCAHMASQVVFTVKVDNPIGAELIGRAYLPVEELLAGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD WL +L++D  PIH HSKIHVKLQF DV RERCW RG+K+ +FPGVP+TFFPQR+GC+
Sbjct  121  VDRWLEILNDDHKPIHGHSKIHVKLQFYDVTRERCWARGLKSPKFPGVPFTFFPQRKGCR  180

Query  574  VTLYQDAHVP  603
            VTLYQDAHVP
Sbjct  181  VTLYQDAHVP  190



>ref|XP_006367508.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006367509.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
Length=807

 Score =   303 bits (775),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV ++EVDK++T+   ++F+K+V+G E  +GFNKTAS LYATIDL KARV
Sbjct  1    MAQILLHGTLHVTIFEVDKLRTNFGRDIFNKVVQGIEGAIGFNKTASTLYATIDLGKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLLDEHKNPRWYESFHIYCAHMAS+V+F+VK DNPIGAELIGRAY+P  RL+ GE V
Sbjct  61   GRTRLLDEHKNPRWYESFHIYCAHMASDVIFTVKADNPIGAELIGRAYLPVERLIDGEVV  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  576
            DEWL +LD +R P+  HSKIHVKLQ+ DV RE  W RG++  RFPGVPYTFF QR+GCKV
Sbjct  121  DEWLEILDTERKPVQGHSKIHVKLQYFDVTREYNWNRGIRVTRFPGVPYTFFSQRQGCKV  180

Query  577  TLYQDAHVP  603
            TLYQD+HVP
Sbjct  181  TLYQDSHVP  189



>ref|NP_001289824.1| uncharacterized protein LOC101257989 [Solanum lycopersicum]
 gb|AAG48162.1|AF154425_1 phospholipase D [Solanum lycopersicum]
Length=807

 Score =   303 bits (775),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV ++EVDK++T+    +F+K+V+G E  +GFNKTAS LYATIDL KARV
Sbjct  1    MAQILLHGTLHVTIFEVDKLRTNFGREIFNKVVQGIEGAIGFNKTASTLYATIDLGKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLLDEHKNPRWYESFHIYCAHMAS+VVF+VK DNPIGAELIGRAY+P  +L+ GE V
Sbjct  61   GRTRLLDEHKNPRWYESFHIYCAHMASDVVFTVKADNPIGAELIGRAYLPVEQLIVGEVV  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  576
            DEWL +LD +R P+H HSKIHVKLQ+ DV RE  W RG++  RFPGVPYTFF QR+GCK+
Sbjct  121  DEWLEILDTERKPVHGHSKIHVKLQYFDVTREYNWNRGIRVTRFPGVPYTFFSQRQGCKI  180

Query  577  TLYQDAHVP  603
            TLYQD+HVP
Sbjct  181  TLYQDSHVP  189



>ref|XP_010325100.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum lycopersicum]
Length=807

 Score =   302 bits (774),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV ++EVDK++T+    +F+K+V+G E  +GFNKTAS LYATIDL KARV
Sbjct  1    MAQILLHGTLHVTIFEVDKLRTNFGREIFNKVVQGIEGAIGFNKTASTLYATIDLGKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLLDEHKNPRWYESFHIYCAHMAS+VVF+VK DNPIGAELIGRAY+P  +L+ GE V
Sbjct  61   GRTRLLDEHKNPRWYESFHIYCAHMASDVVFTVKADNPIGAELIGRAYLPVEQLIVGEVV  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  576
            DEWL +LD +R P+H HSKIHVKLQ+ DV RE  W RG++  RFPGVPYTFF QR+GCK+
Sbjct  121  DEWLEILDTERKPVHGHSKIHVKLQYFDVTREYNWNRGIRVTRFPGVPYTFFSQRQGCKI  180

Query  577  TLYQDAHVP  603
            TLYQD+HVP
Sbjct  181  TLYQDSHVP  189



>ref|XP_006367510.1| PREDICTED: phospholipase D alpha 1-like [Solanum tuberosum]
Length=807

 Score =   294 bits (753),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ LLHG+LHV ++EVD++ T+   + F+K+V+G E  +GFNK ASRLYATIDL KARV
Sbjct  1    MAQFLLHGTLHVTIFEVDRLHTNFGRDFFNKVVQGIEGAIGFNKAASRLYATIDLGKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLLD+HKNPRWYESFHIYCAHMA+NV+ +VK DNPIGAE+IGRAY P ++LL GEEV
Sbjct  61   GRTRLLDDHKNPRWYESFHIYCAHMAANVIITVKFDNPIGAEVIGRAYFPVQQLLDGEEV  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  576
            DEWL +L+ ++ P+H HSKIHVKLQ+ DV RE  W RG+K  RFPGVPYTFF QR+GC+V
Sbjct  121  DEWLEILNTEQKPVHGHSKIHVKLQYFDVTREYNWNRGIKVTRFPGVPYTFFRQRQGCRV  180

Query  577  TLYQDAHVP  603
            TLYQD HVP
Sbjct  181  TLYQDCHVP  189



>ref|NP_001234863.1| phospholipase PLDa2 [Solanum lycopersicum]
 gb|AAG45486.1| phospholipase PLDa2 [Solanum lycopersicum]
Length=806

 Score =   294 bits (753),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ LLHG+LHV ++EVD++ T+   + F+K+V+G E  +GFNK ASRLYATIDL KARV
Sbjct  1    MAQFLLHGTLHVTIFEVDRLHTNFGRDFFNKVVQGIEGAIGFNKAASRLYATIDLGKARV  60

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRLLD+HKNPRWYESFHIYCAHMA+NV+ +VK DNPIGAE+IGRAY P ++LL GEEV
Sbjct  61   GRTRLLDDHKNPRWYESFHIYCAHMAANVIITVKFDNPIGAEVIGRAYFPVQQLLDGEEV  120

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  576
            DEWL +L+ +R P+H HSKIHVKLQ+ DV R+  W RG+K  RFPGVPYTFF QR+GC+V
Sbjct  121  DEWLEILNTERKPLHGHSKIHVKLQYFDVTRDYNWNRGIKVTRFPGVPYTFFRQRQGCRV  180

Query  577  TLYQDAHVP  603
            TLYQD HVP
Sbjct  181  TLYQDCHVP  189



>dbj|BAE79735.1| phospholipase D alpha 2 [Arachis hypogaea]
 dbj|BAE79737.1| phospholipase D alpha 2 [Arachis hypogaea]
Length=807

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 161/190 (85%), Gaps = 2/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVDK+KT G  N+F K+V+  E  VGF K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDKLKTSG-GNVFTKLVQNIEETVGFGKGVTKLYATIDLEKARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ +H NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  60   GRTRIIEKDHSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEDVLDGEE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W+ +LD D+NPIH +SKIHVKLQ+ DV +++ W RGV++A+FPGVPYTFF QRRGCK
Sbjct  120  VDRWVEILDEDKNPIHGNSKIHVKLQYFDVTKDKNWARGVRSAKFPGVPYTFFSQRRGCK  179

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  180  VSLYQDAHVP  189



>gb|EYU23016.1| hypothetical protein MIMGU_mgv1a001487mg [Erythranthe guttata]
Length=810

 Score =   284 bits (727),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG LH  +YE+DK+       LFHK+VEG E V+GF +TAS+LYATIDL +ARV
Sbjct  1    MAHILLHGDLHATIYEIDKLHIGAASKLFHKVVEGVEEVLGFKETASKLYATIDLGQARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRLL  EH NPRWYESFHIYCAH AS V+F++KVDNPIGAELIGRA++P   L+ G+E
Sbjct  61   GRTRLLKHEHTNPRWYESFHIYCAHTASQVIFTIKVDNPIGAELIGRAHIPVSDLMSGDE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D WLP+L  +  P+H H KIHVKL F DV RERCW RG+K+ +FPGVP+TFF QR+GC+
Sbjct  121  IDTWLPILHTNNKPVHGHPKIHVKLHFFDVARERCWSRGLKSPKFPGVPFTFFQQRKGCR  180

Query  574  VTLYQDAHVP  603
            VTLYQDAHVP
Sbjct  181  VTLYQDAHVP  190



>sp|Q41142.1|PLDA1_RICCO RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Ricinus communis]
 gb|AAB04095.1| phospholipase D [Ricinus communis]
Length=808

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+ LHG+LHV +YEVDK+ + G  + F K+VE  E  VGF K  S+LYATIDLEKARV
Sbjct  1    MAQISLHGTLHVTIYEVDKLHSGGGPHFFRKLVENIEETVGFGKGVSKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRWYESFH+YCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRILENEQSNPRWYESFHVYCAHQASNVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD D+NP+HS SKIHVKLQ+ +V ++R WG+G++++++PGVPYT+F QR+GCK
Sbjct  121  IDRWVEILDEDKNPVHSGSKIHVKLQYFEVTKDRNWGQGIRSSKYPGVPYTYFSQRQGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  181  VSLYQDAHIP  190



>gb|AAB37305.1| phospholipase D [Ricinus communis]
Length=808

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+ LHG+LHV +YEVDK+ + G  + F K+VE  E  VGF K  S+LYATIDLEKARV
Sbjct  1    MAQISLHGTLHVTIYEVDKLHSGGGPHFFRKLVENIEETVGFGKGVSKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRWYESFH+YCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRILENEQSNPRWYESFHVYCAHQASNVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD D+NP+HS SKIHVKLQ+ +V ++R WG+G++++++PGVPYT+F QR+GCK
Sbjct  121  IDRWVEILDEDKNPVHSGSKIHVKLQYFEVTKDRNWGQGIRSSKYPGVPYTYFSQRQGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  181  VSLYQDAHIP  190



>ref|XP_002517625.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF44789.1| phopholipase d alpha, putative [Ricinus communis]
Length=808

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+ LHG+LHV +YEVDK+ + G  + F K+VE  E  VGF K  S+LYATIDLEKARV
Sbjct  1    MAQISLHGTLHVTIYEVDKLHSGGGPHFFRKLVENIEETVGFGKGVSKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRWYESFH+YCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRILENEQSNPRWYESFHVYCAHQASNVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD D+NP+HS SKIHVKLQ+ +V ++R WG+G++++++PGVPYT+F QR+GCK
Sbjct  121  IDRWVEILDEDKNPVHSGSKIHVKLQYFEVTKDRNWGQGIRSSKYPGVPYTYFSQRQGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  181  VSLYQDAHIP  190



>ref|XP_011073436.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
 ref|XP_011073437.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
Length=808

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 152/190 (80%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD++   G  N   K +E  E  +GF K   ++YATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDRLHAGGGGNFLSKFMENVEEKIGFGKGTPKIYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRIIEKEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVHELLDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W+ +LD D+NPIH  SKIHV+LQF DV R+R W RG+K+A++PGVPYTF+PQR GC+
Sbjct  121  VDRWVEILDEDKNPIHEGSKIHVRLQFFDVPRDRNWARGIKSAKYPGVPYTFYPQRTGCR  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>ref|XP_007150746.1| hypothetical protein PHAVU_005G177300g [Phaseolus vulgaris]
 gb|ESW22740.1| hypothetical protein PHAVU_005G177300g [Phaseolus vulgaris]
Length=807

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 154/190 (81%), Gaps = 2/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVDK+K  G  N   KIV   E  VGF K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDKLKIGG-GNFLSKIVHNIEETVGFGKGVTKLYATIDLEKARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  60   GRTRIIEKEHSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEILHGEE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD D+NPIH +SKIHVKLQ+ D+ ++R W  G+++ +FPGVPYTFF QRRGCK
Sbjct  120  IDRWIEILDVDKNPIHGNSKIHVKLQYFDISKDRNWALGIRSPKFPGVPYTFFSQRRGCK  179

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  180  VSLYQDAHVP  189



>ref|XP_010097235.1| Phospholipase D alpha 1 [Morus notabilis]
 gb|EXB67302.1| Phospholipase D alpha 1 [Morus notabilis]
Length=808

 Score =   277 bits (708),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHGSLH  +YEVDK++  G  N F K+V+  +  VG     ++LYATIDLEKARV
Sbjct  1    MAHILLHGSLHATIYEVDKLRGKGGGNFFSKLVDNIQETVGLGDGVTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NPRW+ESFHIYCAH+ASNVVF+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRIIEKEHSNPRWFESFHIYCAHLASNVVFTVKDDNPIGATLIGRAYVPVADILDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W+ +LD D+NPIH +SKIHVKLQF DV ++R WG G+++ +FPGVPYTFF QR+GCK
Sbjct  121  VDRWVEILDEDKNPIHGNSKIHVKLQFFDVTKDRNWGLGIRSLKFPGVPYTFFSQRQGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>ref|XP_008454241.1| PREDICTED: phospholipase D alpha 1 [Cucumis melo]
 gb|ABS86615.1| phospholipase D alpha [Cucumis melo var. inodorus]
Length=807

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 154/190 (81%), Gaps = 2/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG+LHV +YEVDK+ + G  N   ++VE  E  VGF +  +RLYATIDLEKARV
Sbjct  1    MAHILLHGTLHVTIYEVDKLHSGG-RNFLKQLVENVEEAVGFGRGITRLYATIDLEKARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR L+ EH NP+WYE+FHIYCAHMASN++F+VK DNPIGA LIGRAY+P R ++ G+E
Sbjct  60   GRTRRLEREHSNPKWYETFHIYCAHMASNIIFTVKDDNPIGATLIGRAYLPVREIIRGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+P+LD  + PI    KIHVKLQF DV +++ WGRG+K+ +FPGVPYT+F QRRGCK
Sbjct  120  VDKWVPILDEQKKPIRGEPKIHVKLQFFDVTKDQNWGRGIKSPKFPGVPYTYFSQRRGCK  179

Query  574  VTLYQDAHVP  603
            VTLYQDAHVP
Sbjct  180  VTLYQDAHVP  189



>ref|XP_003543677.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006595164.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
 gb|KHN44174.1| Phospholipase D alpha 1 [Glycine soja]
Length=807

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 154/190 (81%), Gaps = 2/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVDK+K  G  N   KIV+  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDKLKIGG-GNFLTKIVQNIEETVGIGKGVTKLYATIDLEKARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E KNPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P + +L GEE
Sbjct  60   GRTRIIEKEIKNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVQEILHGEE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD  +NPIH HSKIHVKLQ+ DV ++R W  G+++ +FPGVPYTFF QRRGCK
Sbjct  120  IDRWVEILDEHKNPIHGHSKIHVKLQYFDVSKDRNWALGIRSPKFPGVPYTFFSQRRGCK  179

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  180  VSLYQDAHVP  189



>emb|CAB43063.1| phospholipase D1 [Craterostigma plantagineum]
Length=807

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 152/190 (80%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD++ + G  N F K+    E  VGF K   ++YA+IDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLHSGGGGNFFTKLKANIEETVGFGKGTPKIYASIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P + +L GEE
Sbjct  61   GRTRMIEHEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYIPVQEILDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LDND+NPI   SKIHVKLQ+ DV R+  W RG+K+ ++PGVPYTFF QR GCK
Sbjct  121  IDRWVEILDNDKNPISGESKIHVKLQYFDVTRDLNWNRGIKSVKYPGVPYTFFAQRTGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>ref|XP_006385316.1| phospholipase D family protein [Populus trichocarpa]
 gb|ERP63113.1| phospholipase D family protein [Populus trichocarpa]
Length=808

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV ++EVDK+   G H   HK+VE     VG     S+LYATIDLE+ARV
Sbjct  1    MAQVLLHGTLHVTIFEVDKLGDGGGHGFLHKLVENIGEKVGIGDGISKLYATIDLERARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRW ESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P + ++ GEE
Sbjct  61   GRTRILEKEATNPRWNESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYIPVQEIVDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD D+NPI S SKIHVKLQ+ DV ++R WG G+++A++PGVPYTF+PQR+GCK
Sbjct  121  IDRWVEMLDEDKNPIQSSSKIHVKLQYFDVTKDRNWGGGIRSAKYPGVPYTFYPQRQGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>ref|XP_010254401.1| PREDICTED: phospholipase D alpha 1-like [Nelumbo nucifera]
 ref|XP_010254402.1| PREDICTED: phospholipase D alpha 1-like [Nelumbo nucifera]
Length=802

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 151/189 (80%), Gaps = 5/189 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHGSLHV +YEVDK+ +      FH+IVE     +G  K   +LYAT+DLEKARV
Sbjct  1    MAQILLHGSLHVTIYEVDKLSSRH-GGFFHQIVEN----IGIGKGTPQLYATVDLEKARV  55

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTR+L E+ NP+W ESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   +L GEEV
Sbjct  56   GRTRMLKENANPQWNESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYIPVEEILNGEEV  115

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  576
            D W+ +LD DRNPIH HSKIHV+LQF DV  +R W  G+K++RFPGVPYTFF QR+GCKV
Sbjct  116  DRWVEILDEDRNPIHGHSKIHVRLQFFDVTHDRNWSMGIKSSRFPGVPYTFFTQRQGCKV  175

Query  577  TLYQDAHVP  603
            TLYQDAHVP
Sbjct  176  TLYQDAHVP  184



>gb|EPS65578.1| hypothetical protein M569_09194 [Genlisea aurea]
Length=808

 Score =   273 bits (699),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD++   G  N F K+ E  E  VG  K  S++YATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDRLHVGGGRNFFSKLKENFEEAVGIGKGTSKIYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E +NPRWYESFHIYCAH+AS+V+F+VK +NPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRMIENEPENPRWYESFHIYCAHLASDVIFTVKDNNPIGATLIGRAYVPVSELLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD D+NPIH  SKIHVKLQ+ DV R+R W RG+K+A++PGVPYTFF QR GC+
Sbjct  121  IDRWVEILDEDKNPIHGESKIHVKLQYFDVSRDRNWARGIKSAKYPGVPYTFFSQRTGCR  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>tpg|DAA53241.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=202

 Score =   256 bits (654),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 152/195 (78%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  180  RQGCKVTLYQDAHVP  194



>ref|XP_004486668.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Cicer arietinum]
 ref|XP_004486669.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Cicer arietinum]
 ref|XP_004486670.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Cicer arietinum]
Length=809

 Score =   273 bits (698),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG LH  +YEVDKIK  G  N+F KI +  E  +GF    ++LYATIDLEKARV
Sbjct  1    MAQILLHGFLHATIYEVDKIKNIGGRNIFSKIKQNFEETIGFGDGVTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  61   GRTRIIEKEHTNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D+W+ +LD  +NPIH  SKIHVKLQF DV  +R W  G+++ +FPGVPYTFF QR+GCK
Sbjct  121  IDKWVEILDEHKNPIHGDSKIHVKLQFFDVTHDRNWALGIRSPKFPGVPYTFFTQRQGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQD+H+P
Sbjct  181  VSLYQDSHIP  190



>ref|XP_003604419.1| Phospholipase D alpha [Medicago truncatula]
Length=665

 Score =   270 bits (690),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+ LHG+LH  +YEVDK+   G  N    I +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQIHLHGTLHATIYEVDKLNAGGGGNFLSMIKQNIEETVGLGKGVTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+WYESFHIYCAHMAS+++F+VK DNP+GA LIGRAY+PA  +L GEE
Sbjct  61   GRTRIIENEHTNPKWYESFHIYCAHMASDIIFTVKDDNPVGATLIGRAYVPAEEVLNGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W RG+++A+FPGVPYTFF QR+GCK
Sbjct  121  IDRWVEILDTEKNPIQEGSKIHVKLQYFDVTKDRSWARGIQSAKFPGVPYTFFSQRKGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQD+HVP
Sbjct  181  VSLYQDSHVP  190



>emb|CDY20148.1| BnaA01g28540D [Brassica napus]
Length=399

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL + F  KI    E  +GF K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEEAIGFGKGETQLYATIDLQKAR  60

Query  214  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W  GVK+A+FPGVPYTFF QR+GC
Sbjct  121  EVEKWVEILDNDRNPIHGESKIHVKLQYFGVETDRNWNMGVKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            +V+LYQ AHVP
Sbjct  181  RVSLYQGAHVP  191



>ref|XP_004506968.1| PREDICTED: phospholipase D alpha 1-like [Cicer arietinum]
Length=793

 Score =   271 bits (692),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 152/190 (80%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVDK++  G  N+F  I +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDKLQAGGGGNIFSMIRQNIEETVGIGKGVTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+WYESFHIYC H+ASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRIIENEHTNPKWYESFHIYCGHLASNIIFTVKDDNPIGATLIGRAYVPVDEILDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W RG+++A+FPGVPYTFF QR+GC 
Sbjct  121  IDRWVEILDEEKNPIPEGSKIHVKLQYFDVTKDRSWARGIQSAKFPGVPYTFFSQRQGCN  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>ref|XP_004156800.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
Length=807

 Score =   271 bits (692),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 153/190 (81%), Gaps = 2/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +L+HG+LHV +YEVDK+ + G  N   ++VE  E  VGF +  +RLYATIDLEKARV
Sbjct  1    MAHILIHGTLHVTIYEVDKLHSGG-RNFLKQLVENVEEAVGFGRGITRLYATIDLEKARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR L+ EH NP+WYE+FHIYCAHMASN++F+VK DNPIGA LIGRAY+P R ++ G+E
Sbjct  60   GRTRRLEREHSNPKWYETFHIYCAHMASNIIFTVKDDNPIGATLIGRAYLPVREIIRGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+P+LD  + PI    KIHVKLQF DV +++ WG G+K+ +FPGVPYT+F QRRGCK
Sbjct  120  VDKWVPILDESKKPIRGAPKIHVKLQFFDVTKDQNWGHGIKSPKFPGVPYTYFSQRRGCK  179

Query  574  VTLYQDAHVP  603
            VTLYQDAHVP
Sbjct  180  VTLYQDAHVP  189



>ref|XP_004152203.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
 gb|KGN52888.1| hypothetical protein Csa_4G004970 [Cucumis sativus]
Length=807

 Score =   270 bits (691),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 153/190 (81%), Gaps = 2/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +L+HG+LHV +YEVDK+ + G  N   ++VE  E  VGF +  +RLYATIDLEKARV
Sbjct  1    MAHILIHGTLHVTIYEVDKLHSGG-RNFLKQLVENVEEAVGFGRGITRLYATIDLEKARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR L+ EH NP+WYE+FHIYCAHMASN++F+VK DNPIGA LIGRAY+P R ++ G+E
Sbjct  60   GRTRRLEREHSNPKWYETFHIYCAHMASNIIFTVKDDNPIGATLIGRAYLPVREIIRGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+P+LD  + PI    KIHVKLQF DV +++ WG G+K+ +FPGVPYT+F QRRGCK
Sbjct  120  VDKWVPILDESKKPIRGAPKIHVKLQFFDVTKDQNWGHGIKSPKFPGVPYTYFSQRRGCK  179

Query  574  VTLYQDAHVP  603
            VTLYQDAHVP
Sbjct  180  VTLYQDAHVP  189



>emb|CAB43062.1| phospholipase D2 [Craterostigma plantagineum]
Length=807

 Score =   270 bits (691),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA++LLHG+LHV VYEVD++   G  N+F K+    E  VGF K   ++YA+IDLEKARV
Sbjct  1    MARILLHGTLHVTVYEVDRLHAGGGGNIFSKLRANIEEKVGFGKGTPKIYASIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAH+ASN++F+VK DNPIGA LIGRAY+P R +L GEE
Sbjct  61   GRTRMIEHEPTNPRWYESFHIYCAHLASNIIFTVKDDNPIGATLIGRAYVPVRDVLDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ LLDN++NPI   SKIHVKLQF DV R+  W RG+K+ ++PGVPYTFF QR+GCK
Sbjct  121  LDRWVELLDNNKNPIRGESKIHVKLQFFDVARDLNWNRGIKSIKYPGVPYTFFAQRKGCK  180

Query  574  VTLYQDAHVP  603
            VTLYQDAH+P
Sbjct  181  VTLYQDAHIP  190



>tpg|DAA53242.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=281

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 152/195 (78%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  180  RQGCKVTLYQDAHVP  194



>gb|AES86616.2| phospholipase D alpha 1 [Medicago truncatula]
Length=808

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+ LHG+LH  +YEVDK+   G  N    I +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQIHLHGTLHATIYEVDKLNAGGGGNFLSMIKQNIEETVGLGKGVTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+WYESFHIYCAHMAS+++F+VK DNP+GA LIGRAY+PA  +L GEE
Sbjct  61   GRTRIIENEHTNPKWYESFHIYCAHMASDIIFTVKDDNPVGATLIGRAYVPAEEVLNGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W RG+++A+FPGVPYTFF QR+GCK
Sbjct  121  IDRWVEILDTEKNPIQEGSKIHVKLQYFDVTKDRSWARGIQSAKFPGVPYTFFSQRKGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQD+HVP
Sbjct  181  VSLYQDSHVP  190



>tpg|DAA53243.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=284

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 152/195 (78%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  180  RQGCKVTLYQDAHVP  194



>gb|ADA72022.1| phospholipase D [Jatropha curcas]
 gb|KDP37092.1| hypothetical protein JCGZ_06148 [Jatropha curcas]
Length=808

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVDK+ + G  + F K++E  E  VGF K  ++LYATIDL KARV
Sbjct  1    MAQILLHGTLHATIYEVDKLHSGGGPHFFRKLMENIEETVGFGKGVTKLYATIDLGKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ EH NPRWYESFHIYCAH AS+V+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRILENEHSNPRWYESFHIYCAHQASDVIFTVKDDNPIGATLIGRAYVPVEELLDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD ++NP+   SKIHVKLQ+ D+ ++R WGRG+++ ++PGVPYTF+ QR+GC+
Sbjct  121  IDRWVEILDEEKNPVSGGSKIHVKLQYFDISKDRNWGRGIRSPKYPGVPYTFYSQRQGCR  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>ref|XP_003528334.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006583126.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
Length=809

 Score =   269 bits (687),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 153/191 (80%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ+LLHG+LH  ++EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1    MAQILLHGTLHATIFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ EH NPRWYESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61   VGRTRIIENEHTNPRWYESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            E+D W+ +LD ++NPIH  SKIHVKLQ+ DV ++R W RG+++ +FPGVPYTFF QR+GC
Sbjct  121  EIDRWVEILDEEKNPIHEGSKIHVKLQYFDVTKDRNWARGIRSPKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAHVP
Sbjct  181  KVSLYQDAHVP  191



>ref|XP_011008452.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011008453.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=808

 Score =   268 bits (686),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 152/190 (80%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV ++EVDK+   G H    K+VE     VG     S+LYATIDLE+ARV
Sbjct  1    MAQILLHGTLHVTIFEVDKLGDGGGHGFLRKLVENIGEKVGIGDGISKLYATIDLERARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRW ESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P + ++ GEE
Sbjct  61   GRTRILEKEATNPRWNESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYIPVQEIVDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD D+NPI S SKIHVKLQ+ DV ++R WG G+++ ++PGVPYTF+PQR+GCK
Sbjct  121  IDRWVEMLDEDKNPIDSGSKIHVKLQYFDVTKDRNWGGGIRSPKYPGVPYTFYPQRQGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>gb|KDO48582.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
 gb|KDO48583.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
Length=662

 Score =   265 bits (677),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 154/190 (81%), Gaps = 7/190 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  55   GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  114

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++R W RG+++A++PGVP+TF+PQR+GCK
Sbjct  115  VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKDRSWARGIRSAKYPGVPFTFYPQRKGCK  174

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  175  VSLYQDAHVP  184



>ref|XP_009619857.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
Length=810

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG+LHV V+EVD+++  G  N F KI E  E  VG  K AS++YAT+DLEKARV
Sbjct  1    MAPILLHGTLHVTVHEVDRLREKGGGNFFSKIKETVEETVGVGKGASKIYATVDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRW ESFHIYCAHMASNVVF+VK +N IGA LIGRAY+P   LL GEE
Sbjct  61   GRTRVIENEPSNPRWNESFHIYCAHMASNVVFTVKDNNSIGATLIGRAYLPVNELLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VDEW+ +LD D+NPI   SKIHV+LQF D+ R+R WG G+   ++PGVPYTFFPQR GC+
Sbjct  121  VDEWIEILDEDKNPIKEGSKIHVRLQFFDISRDRNWGHGIGNPKYPGVPYTFFPQRSGCR  180

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  181  VSLYQDAHIP  190



>ref|XP_003531710.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Glycine max]
 ref|XP_006585630.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Glycine max]
Length=809

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ+LLHG+LH  V+EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1    MAQILLHGTLHATVFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ EH NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61   VGRTRIIENEHTNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            E+D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W RG+++ +FPGVPYTFF QR+GC
Sbjct  121  EIDRWVEILDEEKNPIQEGSKIHVKLQYFDVTKDRNWARGIRSPKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAHVP
Sbjct  181  KVSLYQDAHVP  191



>ref|XP_009146200.1| PREDICTED: phospholipase D alpha 1 [Brassica rapa]
Length=810

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  ++L GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121  EVDQWVEILDNDRNPIHGGSKIHVKLQYFGVEADRNWNQGIKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>gb|KHN47766.1| Phospholipase D alpha 1 [Glycine soja]
Length=809

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ+LLHG+LH  V+EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1    MAQILLHGTLHATVFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ EH NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61   VGRTRIIENEHTNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            E+D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W RG+++ +FPGVPYTFF QR+GC
Sbjct  121  EIDRWVEILDEEKNPIQEGSKIHVKLQYFDVTKDRNWARGIRSPKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAHVP
Sbjct  181  KVSLYQDAHVP  191



>gb|KHN01336.1| Phospholipase D alpha 1 [Glycine soja]
Length=809

 Score =   266 bits (679),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ+LLHG+LH  ++EVD++   G   N F K+ +  E  VG  K  ++LYATIDLEKAR
Sbjct  1    MAQILLHGTLHATIFEVDRLNAGGGGGNFFSKLKQNFEETVGIGKGVTKLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ EH NPRWYESFHIYCAHMASN+VF+VK DNPIGA LIGRAY+P   +L GE
Sbjct  61   VGRTRIIENEHTNPRWYESFHIYCAHMASNIVFTVKDDNPIGATLIGRAYVPVSEVLDGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            E+D W+ +LD ++NPI   SKIHVKLQ+ DV ++R W RG+++ +FPGVPYTFF QR+GC
Sbjct  121  EIDRWVEILDEEKNPIREGSKIHVKLQYFDVTKDRNWARGIRSPKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAHVP
Sbjct  181  KVSLYQDAHVP  191



>ref|XP_006465340.1| PREDICTED: phospholipase D alpha 1 [Citrus sinensis]
Length=802

 Score =   265 bits (678),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 154/190 (81%), Gaps = 7/190 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  55   GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  114

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++R W RG+++A++PGVP+TF+PQR+GCK
Sbjct  115  VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKDRSWARGIRSAKYPGVPFTFYPQRKGCK  174

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  175  VSLYQDAHVP  184



>ref|XP_006427267.1| hypothetical protein CICLE_v10024917mg [Citrus clementina]
 gb|ESR40507.1| hypothetical protein CICLE_v10024917mg [Citrus clementina]
Length=802

 Score =   265 bits (678),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 154/190 (81%), Gaps = 7/190 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  55   GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEE  114

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++R W RG+++A++PGVP+TF+PQR+GCK
Sbjct  115  VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKDRSWARGIRSAKYPGVPFTFYPQRKGCK  174

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  175  VSLYQDAHVP  184



>sp|Q70EW5.2|PLDA1_CYNCA RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Cynara cardunculus]
 emb|CAE47482.2| phospholipase D alpha [Cynara cardunculus]
Length=808

 Score =   265 bits (677),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M+++LLHG+LHV VYEVDK++  G  N+F K++   +  VGF +   ++YATIDLEK+RV
Sbjct  1    MSKVLLHGTLHVTVYEVDKLREGGGPNVFGKLMANIQETVGFGEGTPKIYATIDLEKSRV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E +NPRWYESFHIYCAH ASN++F+VK DNPIGA L+GRAYMP R LL G+E
Sbjct  61   GRTRMIENEPQNPRWYESFHIYCAHHASNIIFTVKDDNPIGATLLGRAYMPVRELLDGDE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+ ++D D NP  + SKIHVKLQ+ DV ++R W RG+K  ++PGVPYTFF QR+GC+
Sbjct  121  VDKWIEIMDEDNNPTPAGSKIHVKLQYFDVTQDRNWDRGIKTGKYPGVPYTFFAQRQGCR  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>emb|CDY21865.1| BnaC01g35830D [Brassica napus]
Length=812

 Score =   265 bits (677),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 151/192 (79%), Gaps = 3/192 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN--LFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            MAQ LLHG+LH  +YEVD + T GL +     KI+   E  VGF K  ++LYATIDL+KA
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLRSAGFLGKIISNVEETVGFGKGETQLYATIDLQKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ G
Sbjct  61   RVGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVING  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            EEV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W  GVK+A+FPGVPYTFF QR+G
Sbjct  121  EEVEKWVEILDNDRNPIHGESKIHVKLQYFGVEADRNWNMGVKSAKFPGVPYTFFSQRQG  180

Query  568  CKVTLYQDAHVP  603
            CKV+LYQ AHVP
Sbjct  181  CKVSLYQGAHVP  192



>gb|AIE90138.1| phospholipase D1, partial [Brassica napus]
Length=810

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121  EVDQWVEILDNDRNPIHGGSKIHVKLQYFGVEADRNWNQGIKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>sp|O82549.1|PLDA1_BRAOC RecName: Full=Phospholipase D alpha 1; Short=PLD 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Brassica 
oleracea var. capitata]
 gb|AAC78487.1| phospholipase D1 [Brassica oleracea var. capitata]
 gb|AAD17208.1| phospholipase D1 [Brassica oleracea var. capitata]
 emb|CDY30108.1| BnaC05g37540D [Brassica napus]
Length=810

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121  EVDQWVEILDNDRNPIHGGSKIHVKLQYFGVEADRNWNQGIKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|NP_001275827.1| phospholipase D alpha [Citrus sinensis]
 gb|ACA49723.1| phospholipase D alpha [Citrus sinensis]
Length=802

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 153/190 (81%), Gaps = 7/190 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD++++ G  N F       + + G  K  S LYATIDLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDQLESGGGGNFF------TKLLGGLGKGGSELYATIDLEKARV  54

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P    LGGEE
Sbjct  55   GRTRMLKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEALGGEE  114

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+ +LD DRNPI S SKIHVKLQ+ DV ++R W RG+++A++PGVP+TF+PQR+GCK
Sbjct  115  VDKWVEILDEDRNPISSGSKIHVKLQYFDVTKDRSWARGIRSAKYPGVPFTFYPQRKGCK  174

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  175  VSLYQDAHVP  184



>ref|XP_009799916.1| PREDICTED: phospholipase D alpha 1 [Nicotiana sylvestris]
 ref|XP_009799917.1| PREDICTED: phospholipase D alpha 1 [Nicotiana sylvestris]
Length=808

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 149/190 (78%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD ++ +G  + F KI E  E  +G  K    +YAT+DLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDNLQKEGGGHFFSKIKEHVEETIGLGKGTPEIYATVDLEKARV  60

Query  217  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR + +E KNPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRKIKNEPKNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D+W+ +LD + NPI   SKIHVKLQF DV R+  W RG++++++PGVPYTFF QR GC+
Sbjct  121  IDKWVEILDREMNPIAEGSKIHVKLQFFDVSRDPNWARGIRSSKYPGVPYTFFAQRTGCR  180

Query  574  VTLYQDAHVP  603
            V LYQDAHVP
Sbjct  181  VNLYQDAHVP  190



>ref|XP_009625689.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625690.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625691.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
 ref|XP_009625692.1| PREDICTED: phospholipase D alpha 1 [Nicotiana tomentosiformis]
Length=808

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD ++ +G  + F KI E  E  +GF K    +YAT+DLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDNLQKEGGGHFFSKIKEHVEETIGFGKGTPAIYATVDLEKARV  60

Query  217  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR + +E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRKIKNEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D+W+ +LD + NPI   SKIHVKLQF DV R+  W RG++++++PGVPYTFF QR GC+
Sbjct  121  IDKWVEILDREMNPIAEGSKIHVKLQFFDVSRDPNWERGIRSSKYPGVPYTFFAQRTGCR  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>gb|KCW70692.1| hypothetical protein EUGRSUZ_F03862 [Eucalyptus grandis]
Length=673

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 151/190 (79%), Gaps = 3/190 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD++   G    F KI+   E  VG  K  S+LYATIDL KARV
Sbjct  1    MAQILLHGTLHATIYEVDQLHHGGAPKFFRKIMANIEETVGLGKGVSKLYATIDLGKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRLL+ E  NPRWYESFHIYCAHMAS+V+F++K DNPIGA LIGRAY+P   LLGGEE
Sbjct  61   GRTRLLEKEPSNPRWYESFHIYCAHMASDVIFTIKDDNPIGATLIGRAYVPVDELLGGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD +RNPI   SKIHVKL + DV ++R +GRG+++A+FPGVPYTFF QR+GCK
Sbjct  121  LDRWVEILDKERNPI--GSKIHVKLHYFDVSKDRIYGRGIRSAKFPGVPYTFFSQRQGCK  178

Query  574  VTLYQDAHVP  603
            V+LYQD+H+P
Sbjct  179  VSLYQDSHIP  188



>sp|P93400.2|PLDA1_TOBAC RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Nicotiana tabacum]
 emb|CAB06620.1| phospholipase D [Nicotiana tabacum]
Length=808

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVD ++ +G  + F KI E  E  +GF K    +YAT+DLEKARV
Sbjct  1    MAQILLHGTLHVTIYEVDNLQKEGGGHFFSKIKEHVEETIGFGKGTPAIYATVDLEKARV  60

Query  217  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR + +E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRKIKNEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D+W+ +LD + NPI   SKIHVKLQF DV R+  W RG++++++PGVPYTFF QR GC+
Sbjct  121  IDKWVEILDREMNPIAEGSKIHVKLQFFDVSRDPNWERGIRSSKYPGVPYTFFAQRTGCR  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>gb|AGN71005.1| phospholipase D1 [Brassica napus]
Length=810

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 153/191 (80%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD+W+  LDNDRNPIH  SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121  EVDQWVETLDNDRNPIHGGSKIHVKLQYFGVEADRNWNQGIKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|XP_006364210.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
Length=811

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG+LHV ++EVD++      N F KI +  E  VG  K ASR+YAT+DLEKARV
Sbjct  1    MAPILLHGTLHVTIHEVDRLHGKHGRNFFSKIKDSVEETVGMGKGASRIYATVDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAHMA NV+F+VK +N IGA LIGRAY+P   LL GEE
Sbjct  61   GRTRVIENEPNNPRWYESFHIYCAHMAKNVIFTVKDNNSIGATLIGRAYLPVNDLLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VDEW+ +LD D NPI + SKIHV LQ+ ++ R+R WGRG+ ++++PGVPYTFFPQR GC+
Sbjct  121  VDEWIEILDEDENPIEAGSKIHVTLQYFEISRDRNWGRGIGSSKYPGVPYTFFPQRTGCR  180

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  181  VSLYQDAHIP  190



>gb|AGN71006.1| phospholipase D2 [Brassica napus]
Length=812

 Score =   263 bits (672),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL + F  KI    E+ +GF K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEKAIGFGKGETQLYATIDLQKAR  60

Query  214  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W  GVK+A+FPGVPYTFF QR+GC
Sbjct  121  EVEKWVEILDNDRNPIHGESKIHVKLQYFGVETDRNWNMGVKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            +V+LYQ AHVP
Sbjct  181  RVSLYQGAHVP  191



>sp|P55939.2|PLDA2_BRAOC RecName: Full=Phospholipase D alpha 2; Short=PLD 2; AltName: 
Full=Choline phosphatase 2; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 2; Flags: Precursor [Brassica 
oleracea var. capitata]
 gb|AAC78486.1| phospholipase D2 [Brassica oleracea var. capitata]
 gb|AAC79125.1| phospholipase D [Brassica oleracea var. capitata]
 gb|AAD17209.1| phospholipase D2 [Brassica oleracea var. capitata]
Length=812

 Score =   263 bits (671),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 151/192 (79%), Gaps = 3/192 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN--LFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            MAQ LLHG+LH  +YEVD + T GL +     KI+   E  +GF K  ++LYATIDL+KA
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLRSAGFLGKIISNVEETIGFGKGETQLYATIDLQKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ G
Sbjct  61   RVGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVING  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            EEV++W+ +LD+DRNPIH  SKIHVKLQ+  V  +R W  GVK+A+FPGVPYTFF QR+G
Sbjct  121  EEVEKWVEILDDDRNPIHGESKIHVKLQYFAVEADRNWNMGVKSAKFPGVPYTFFSQRQG  180

Query  568  CKVTLYQDAHVP  603
            CKV+LYQ AHVP
Sbjct  181  CKVSLYQGAHVP  192



>gb|AAG50297.1| phospholipase PLDa3 [Solanum lycopersicum]
Length=678

 Score =   260 bits (664),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 135/157 (86%), Gaps = 3/157 (2%)
 Frame = +1

Query  133  VEGAERVVGFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFS  312
            +EGA   +GFNKTAS LYATIDL KARVGRTRLLDEHKNPRWYESFHIYCAHMAS+VVF+
Sbjct  3    IEGA---IGFNKTASTLYATIDLGKARVGRTRLLDEHKNPRWYESFHIYCAHMASDVVFT  59

Query  313  VKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  492
            VK DNPIGAELIGRAY+P  +L+ GE VDEWL +LD +R P+H HSKIHVKLQ+ DV RE
Sbjct  60   VKADNPIGAELIGRAYLPVEQLIVGEVVDEWLEILDTERKPVHGHSKIHVKLQYFDVTRE  119

Query  493  RCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
              W RG++  RFPGVPYTFF QR+GCK+TLYQD+HVP
Sbjct  120  YNWNRGIRVTRFPGVPYTFFSQRQGCKITLYQDSHVP  156



>emb|CDX97705.1| BnaA05g23740D [Brassica napus]
Length=810

 Score =   263 bits (671),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 153/191 (80%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYATIDL++AR
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  ++L GE
Sbjct  61   VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD+W+ +LDNDRNPI   SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121  EVDQWVEILDNDRNPIPGGSKIHVKLQYFGVEADRNWNQGIKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|XP_008805616.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
 ref|XP_008805617.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
Length=810

 Score =   262 bits (670),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 149/192 (78%), Gaps = 3/192 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK--TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            MA +LLHG+LHV ++E D +   + G      ++V G E  +G  K +S+LYATIDLEKA
Sbjct  1    MAHILLHGTLHVTIFEADSLSRASAGAPKFIRQLVGGIEDAIGLGKGSSKLYATIDLEKA  60

Query  211  RVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTRL+ DE  NPRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRLITDEPVNPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVAEILDG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            EE D WL + D DRNP+   +KIHVK+Q+ D+ ++R W RG+++A++PGVPYTFF QRRG
Sbjct  121  EEADRWLEICDEDRNPLDGGAKIHVKVQYFDISKDRNWARGIRSAKYPGVPYTFFSQRRG  180

Query  568  CKVTLYQDAHVP  603
            CKVTLYQDAHVP
Sbjct  181  CKVTLYQDAHVP  192



>ref|XP_009115281.1| PREDICTED: phospholipase D alpha 2 [Brassica rapa]
Length=812

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL + F  KI    E  +GF K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEEAIGFGKGETQLYATIDLQKAR  60

Query  214  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W  GVK+A+FPGVPYTFF QR+GC
Sbjct  121  EVEKWVEILDNDRNPIHGESKIHVKLQYFGVETDRNWNMGVKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            +V+LYQ AHVP
Sbjct  181  RVSLYQGAHVP  191



>gb|AGV22364.1| phospholipase D4 [Brassica napus]
Length=812

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL + F  KI    E  +GF K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEEAIGFGKGETQLYATIDLQKAR  60

Query  214  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE KNP+WYESFHIYCAHMAS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EV++W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W  GVK+A+FPGVPYTFF QR+GC
Sbjct  121  EVEKWVEILDNDRNPIHGESKIHVKLQYFGVETDRNWNMGVKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            +V+LYQ AHVP
Sbjct  181  RVSLYQGAHVP  191



>ref|XP_010063458.1| PREDICTED: phospholipase D alpha 1 [Eucalyptus grandis]
Length=805

 Score =   262 bits (669),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 151/190 (79%), Gaps = 3/190 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD++   G    F KI+   E  VG  K  S+LYATIDL KARV
Sbjct  1    MAQILLHGTLHATIYEVDQLHHGGAPKFFRKIMANIEETVGLGKGVSKLYATIDLGKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRLL+ E  NPRWYESFHIYCAHMAS+V+F++K DNPIGA LIGRAY+P   LLGGEE
Sbjct  61   GRTRLLEKEPSNPRWYESFHIYCAHMASDVIFTIKDDNPIGATLIGRAYVPVDELLGGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD +RNPI   SKIHVKL + DV ++R +GRG+++A+FPGVPYTFF QR+GCK
Sbjct  121  LDRWVEILDKERNPI--GSKIHVKLHYFDVSKDRIYGRGIRSAKFPGVPYTFFSQRQGCK  178

Query  574  VTLYQDAHVP  603
            V+LYQD+H+P
Sbjct  179  VSLYQDSHIP  188



>ref|XP_011012164.1| PREDICTED: phospholipase D alpha 1 [Populus euphratica]
Length=808

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 152/190 (80%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVDKI   G H  FHK+V      VG     SRLYATIDLEKARV
Sbjct  1    MAQILLHGNLHVTIYEVDKIGDGGGHGFFHKLVGSIGEKVGVGNGISRLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRWYESFHIYCAHMASNV+F+VK  NPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRILENEATNPRWYESFHIYCAHMASNVIFTVKDVNPIGATLIGRAYIPVEEILDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD D+NPIH+ SKIHVKLQ+ D+ ++  WGRG++ +++PGVPYTFF QR+GC+
Sbjct  121  IDRWVEILDGDKNPIHAGSKIHVKLQYFDISKDHNWGRGIRGSKYPGVPYTFFSQRQGCR  180

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  181  VSLYQDAHIP  190



>ref|XP_003597894.1| Phospholipase D alpha [Medicago truncatula]
 gb|ABD28731.1| C2; Peptidase, cysteine peptidase active site [Medicago truncatula]
 gb|AES68145.1| phospholipase D alpha 1 [Medicago truncatula]
Length=809

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 152/189 (80%), Gaps = 1/189 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  ++EVDK+K  G  N+  KI +  E  VGF K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIFEVDKLKNIGGGNILSKIRQNFEETVGFGKGTTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+W ESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  61   GRTRIIEKEHVNPQWNESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVEEVLGGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W+ +LD ++ PIH +SKIHVKLQF DV ++R W  G+++ +FPGVPY F+ QR+GCK
Sbjct  121  VDRWVEILDVNKEPIHGNSKIHVKLQFFDVSKDRNWALGIRSPKFPGVPYAFYTQRQGCK  180

Query  574  VTLYQDAHV  600
            V+LYQD+H+
Sbjct  181  VSLYQDSHI  189



>ref|XP_011081358.1| PREDICTED: phospholipase D alpha 1 [Sesamum indicum]
Length=807

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M+Q+LLHG+LH  ++EVD +K  G   +F K++E  E  VG  K  S+LYATIDLEK+RV
Sbjct  1    MSQILLHGTLHATIFEVDNLKGGG-GGIFSKLMENIEETVGIGKGVSQLYATIDLEKSRV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRL++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL G+E
Sbjct  60   GRTRLIENEPSNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVHDLLEGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W  +LD D+NPI   SKIHVKLQF D+ R+R W  G+++++ PGVPYTFF QR GC+
Sbjct  120  VDRWAEILDEDKNPITEGSKIHVKLQFFDITRDRNWAHGIQSSKNPGVPYTFFAQRTGCQ  179

Query  574  VTLYQDAHVP  603
            V+L+QDAHVP
Sbjct  180  VSLFQDAHVP  189



>ref|XP_004235964.1| PREDICTED: phospholipase D alpha 1 [Solanum lycopersicum]
Length=811

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG+LHV ++EVDK+      N F KI +  E  VG  K ASR+YAT+DLEKARV
Sbjct  1    MAPILLHGTLHVTIHEVDKLHGKQGRNFFSKIKDSVEEKVGMGKGASRIYATVDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAHMA NV+F+VK +N IGA LIGRAY+P   LL GEE
Sbjct  61   GRTRVIENEPNNPRWYESFHIYCAHMAKNVIFTVKDNNSIGATLIGRAYLPVNDLLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VDEW+ +LD D NP+ + SKIHV LQ+ ++ R+R WGRG+  +++PGVPYTFFPQR GC+
Sbjct  121  VDEWIEILDEDENPVEAGSKIHVTLQYFEISRDRNWGRGIGTSKYPGVPYTFFPQRTGCR  180

Query  574  VTLYQDAHVP  603
            V+LY DAH+P
Sbjct  181  VSLYHDAHIP  190



>sp|P86387.1|PLDA1_CARPA RecName: Full=Phospholipase D alpha 1; Short=CpPLD1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Carica papaya]
Length=808

 Score =   261 bits (666),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 147/190 (77%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA  L+HG+LH  VYEVDK+ + G+   F KI+   E  +G  K  ++LYATIDLE+ARV
Sbjct  1    MAHYLMHGTLHATVYEVDKLHSGGISGFFGKILANVEGTIGIGKGVTQLYATIDLERARV  60

Query  217  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR++ DE  NP+WYESFHIYCAHMASNVVF+VK DNPIGA LIGRAY+P   L+ G++
Sbjct  61   GRTRIIKDEPNNPKWYESFHIYCAHMASNVVFTVKDDNPIGATLIGRAYVPVEELIRGDQ  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W+ +LD D+NPI   SKIHVKLQF DV ++  W  G+K AR+ GVPYTF+ QRRGC+
Sbjct  121  VDRWVEILDEDKNPIEGDSKIHVKLQFFDVKKDSNWNMGIKGARYLGVPYTFYSQRRGCR  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>ref|XP_008792036.1| PREDICTED: phospholipase D alpha 1 [Phoenix dactylifera]
 ref|XP_008792037.1| PREDICTED: phospholipase D alpha 1 [Phoenix dactylifera]
Length=813

 Score =   260 bits (664),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 151/195 (77%), Gaps = 6/195 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E D +      + G    F ++VEG E  +G  K +S+LYATIDL
Sbjct  1    MAQILLHGTLHATIFEADSLSNPNRSSGGAPKFFRQLVEGIEDTIGLGKGSSKLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             KARVGRTRL+  E  NPRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61   GKARVGRTRLITKEPVNPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVTEI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            L G+EVD+W+ + D DRNP+   +KIHVK+Q+ D+ ++R W RG+++A++PGVPYTFF Q
Sbjct  121  LYGQEVDKWIEICDEDRNPLDGGAKIHVKVQYFDISKDRNWARGIRSAKYPGVPYTFFSQ  180

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  181  RQGCKVTLYQDAHVP  195



>gb|ABU54776.1| phospholipase D alpha 1 precursor [Helianthus annuus]
Length=810

 Score =   260 bits (664),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLL-LHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ   LHG+LHV +YEVDKI   G  N+F KIV   E  +GF K   ++YAT+DLEKAR
Sbjct  1    MAQKTHLHGTLHVTIYEVDKIHVAGGGNIFSKIVANIEETIGFGKGTPKMYATVDLEKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR++ DE + P+W ESFHIYCAH ASNV+F+VK DNP+GA LIGRAY+P   +L GE
Sbjct  61   VGRTRMITDEPETPKWNESFHIYCAHSASNVIFTVKDDNPVGATLIGRAYIPVEEILDGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            E+D W+ +LD D+NPI + SKIHVK+Q+ DV ++R W RG+K+A++PGVPYTFF QR GC
Sbjct  121  ELDRWVEILDEDKNPISAGSKIHVKVQYFDVTQDRNWDRGIKSAKYPGVPYTFFGQRNGC  180

Query  571  KVTLYQDAHVP  603
            +V+LYQDAHVP
Sbjct  181  RVSLYQDAHVP  191



>gb|AGV22363.1| phospholipase D3 [Brassica napus]
Length=810

 Score =   259 bits (663),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN-LFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD + T GL +  F KI+   E  +G  K  ++LYAT DL++ R
Sbjct  1    MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATTDLQRVR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + DE +NP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKDEAENPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQVIHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD+W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121  EVDQWVEILDNDRNPIHGGSKIHVKLQYFGVEADRNWNQGIKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|XP_008461111.1| PREDICTED: phospholipase D alpha 1 [Cucumis melo]
Length=833

 Score =   260 bits (664),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  26   MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  85

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRWYESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  86   GRTRILESEPSNPRWYESFHIYCAHKASNVIFTVKDDNPIGATLIGRAYVPVEDIVDGEE  145

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W+P+LD ++NPI   SKIHVKLQ+  V ++R WGRG+K+ +FPGVPYT++ QR+GCK
Sbjct  146  VDRWVPILDENQNPIEGESKIHVKLQYFSVTKDRNWGRGIKSRKFPGVPYTYYSQRQGCK  205

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  206  VSLYQDAHVP  215



>ref|XP_010907269.1| PREDICTED: phospholipase D alpha 1 [Elaeis guineensis]
 ref|XP_010907270.1| PREDICTED: phospholipase D alpha 1 [Elaeis guineensis]
Length=813

 Score =   259 bits (663),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 151/195 (77%), Gaps = 6/195 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LHV ++E + +      + G      ++VEG E  +G  K +S+LYATIDL
Sbjct  1    MAQILLHGTLHVTIFEANSLSNPNRASGGAPKFIRQLVEGIEDTIGLGKGSSKLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTRL+  E  NPRWYESFHIYCAHM++NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61   EKARVGRTRLITKEPVNPRWYESFHIYCAHMSANVIFTVKFDNPIGASLIGRAYLPVTEI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            L GEEVD W+ + D DRNP+   ++IHVK+Q+ D+ ++R W RG+++A++PGVPYTFF Q
Sbjct  121  LNGEEVDRWIEICDEDRNPLDGGARIHVKVQYFDISKDRNWARGIRSAKYPGVPYTFFSQ  180

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  181  RQGCKVTLYQDAHVP  195



>gb|EYU21635.1| hypothetical protein MIMGU_mgv1a001489mg [Erythranthe guttata]
 gb|EYU21636.1| hypothetical protein MIMGU_mgv1a001489mg [Erythranthe guttata]
Length=809

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD +      N F K++E  E  VGF K  +++YA+IDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDTLHAGKGGNFFGKLMENIEETVGFGKGTAKIYASIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRIIEKEPNNPRWYESFHIYCAHMASNVIFTVKDDNPIGATLIGRAYVPVEELLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+ +LD D NP+   SKIHVKLQF DV R+R W RG+K+A++PGVPYTFF QR GC+
Sbjct  121  VDKWVEILDTDMNPVSEGSKIHVKLQFFDVTRDRNWARGIKSAKYPGVPYTFFSQRTGCR  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>emb|CDO98145.1| unnamed protein product [Coffea canephora]
Length=809

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M  +LLHG+LHV ++EVDK+  +G   ++F K++   E  VGF K   ++YATIDLEKAR
Sbjct  1    MDPVLLHGTLHVTIFEVDKLHGEGGGPSVFRKLMANIEETVGFGKGTPKIYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ E  NPRWYESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   LL GE
Sbjct  61   VGRTRMIENEPNNPRWYESFHIYCAHEASNVIFTVKDDNPIGATLIGRAYVPVHELLEGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            E+D W+ +LD D+NPI   SKIHVKLQ+ DV R+R W RG+++++FPGVPYTF+ QR GC
Sbjct  121  EIDRWVEILDEDKNPIKEESKIHVKLQYFDVTRDRNWARGIRSSKFPGVPYTFYSQRTGC  180

Query  571  KVTLYQDAHVP  603
            +V+LYQDAH+P
Sbjct  181  RVSLYQDAHIP  191



>ref|XP_004171103.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like, 
partial [Cucumis sativus]
Length=534

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ +  NP+W ESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61   GRTRILESDPSNPKWNESFHIYCAHKASNVIFTVKDDNPIGATLIGRAYVPVEDIVDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+P+LD ++NPI   SKIHVKLQ+  V ++R WGRG+++ +FPGVPYT++ QR+GCK
Sbjct  121  VDKWVPILDENQNPIEEESKIHVKLQYFSVTKDRNWGRGIRSRKFPGVPYTYYSQRQGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>ref|XP_007135745.1| hypothetical protein PHAVU_010G155000g [Phaseolus vulgaris]
 gb|ESW07739.1| hypothetical protein PHAVU_010G155000g [Phaseolus vulgaris]
Length=809

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVDK+   G  N F K+ +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDKLHAGGGGNFFTKLKQNIEETVGIGKGVTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+W ESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +L G E
Sbjct  61   GRTRIIENEHTNPKWEESFHIYCAHVASDIIFTVKDDNPIGATLIGRAYVPVSEVLDGHE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD ++ PI   SKIHVKLQ+ DV ++R W RG+++ ++PGVPYTFF QR+GCK
Sbjct  121  IDRWVEILDTEKKPIQEGSKIHVKLQYFDVSKDRNWARGIRSPKYPGVPYTFFSQRQGCK  180

Query  574  VTLYQDAHVP  603
            V LYQDAHVP
Sbjct  181  VFLYQDAHVP  190



>gb|ABB82551.1| phospholipase D-alpha [Cucumis melo var. inodorus]
Length=808

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 147/190 (77%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRWYESFHIYCAH ASNV+F+VK DNPIGA LIGR Y+P   ++ GEE
Sbjct  61   GRTRILESEPSNPRWYESFHIYCAHKASNVIFTVKDDNPIGATLIGRTYVPVEDIVDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W+P+LD ++NPI   SKIHVKLQ+  V ++R WGRG+K+ +FPGVPYT++ QR+GCK
Sbjct  121  VDRWVPILDENQNPIEGESKIHVKLQYFSVTKDRNWGRGIKSRKFPGVPYTYYSQRQGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>ref|XP_002882959.1| PLDALPHA1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59218.1| PLDALPHA1 [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121  EVDRWVEILDNDRNPIHGGSKIHVKLQYFHVEEDRNWNKGIKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|XP_006356207.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006356208.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
 ref|XP_006356209.1| PREDICTED: phospholipase D alpha 1-like isoform X3 [Solanum tuberosum]
Length=809

 Score =   257 bits (656),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ+ LHG+LHV ++EVD ++  +G  + F KI +  E  VG  K   +LYATIDLEKAR
Sbjct  1    MAQIQLHGTLHVTIFEVDNLQGEEGGGHFFSKIKQHFEETVGVGKGTPKLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ E KNPRWYESFHIYCAHMASNV+F++K DNP GA LIGRAY+P   LL GE
Sbjct  61   VGRTRMIENEPKNPRWYESFHIYCAHMASNVIFTIKDDNPFGASLIGRAYVPVEELLEGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            E+D+W+ +LD + NPI   SKIHVKLQF DV R+  WGRG++++R+PGVPYTFF QR G 
Sbjct  121  EIDKWVEILDKEMNPIAEGSKIHVKLQFFDVSRDPNWGRGIRSSRYPGVPYTFFSQRAGS  180

Query  571  KVTLYQDAHVP  603
            +V+LYQDAHVP
Sbjct  181  RVSLYQDAHVP  191



>ref|XP_002299756.1| phospholipase D family protein [Populus trichocarpa]
 gb|EEE84561.1| phospholipase D family protein [Populus trichocarpa]
Length=808

 Score =   257 bits (656),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YEVDKI   G H  FHK+V      VG     SRLYATIDLEKARV
Sbjct  1    MAQILLHGNLHVTIYEVDKIGEGGGHGFFHKLVGKVGEKVGIGNGISRLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ E  NPRWYESFHIYCAHMASNV+F+VK  NPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRILENEATNPRWYESFHIYCAHMASNVIFTVKDVNPIGATLIGRAYIPVEEILDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD D+NPI + SKIHVKLQ+ D+  +  WGRG++ +++PGVPYTF+ QR+GC+
Sbjct  121  IDRWVEILDGDKNPIRAGSKIHVKLQYFDITNDHNWGRGIRGSKYPGVPYTFYSQRQGCR  180

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  181  VSLYQDAHIP  190



>gb|AHN53202.1| phospholipase D alpha 1-like protein [Cocos nucifera]
Length=813

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 149/195 (76%), Gaps = 6/195 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LHV ++E D +      + G      ++VEG E  +G  K +++LYATIDL
Sbjct  1    MAQILLHGTLHVTIFEADSLSNPNRASGGAPKFIRQLVEGIEDTIGLGKGSTKLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             KARVGRTRL+ +E  NPRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61   GKARVGRTRLITNEPVNPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVTEI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            L GEEVD W+ + D DRNP+   +KIHVK+Q+ D+ ++  W RG+++A++PGVPYTFF Q
Sbjct  121  LDGEEVDRWIEIWDEDRNPLDGGAKIHVKVQYFDISKDHNWARGIRSAKYPGVPYTFFSQ  180

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVT YQDAHVP
Sbjct  181  RQGCKVTFYQDAHVP  195



>sp|O04865.1|PLDA1_VIGUN RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Vigna unguiculata]
 gb|AAB51392.1| phospholipase D [Vigna unguiculata]
Length=809

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 149/190 (78%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD++   G  N F K+ +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDELHGGGGGNFFSKLKQNIEETVGIGKGVTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NP+W ESFHIYC H+ASN++F+VK DNPIGA LIGRAY+P   +L G E
Sbjct  61   GRTRIIENETTNPKWNESFHIYCGHLASNIIFTVKDDNPIGATLIGRAYVPVSEVLDGHE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D+W+ +LD ++NPI   SKIHV+LQ+ DV+++R W RG+++ ++PGVPYTFF QR+GCK
Sbjct  121  IDKWVEILDTEKNPIEGGSKIHVRLQYFDVLKDRNWARGIRSPKYPGVPYTFFSQRQGCK  180

Query  574  VTLYQDAHVP  603
            V LYQDAHVP
Sbjct  181  VFLYQDAHVP  190



>ref|XP_009381115.1| PREDICTED: phospholipase D alpha 1 [Musa acuminata subsp. malaccensis]
Length=812

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 151/195 (77%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      + G      K+VEG E  VG  K +S+LYATIDL
Sbjct  1    MAQILLHGTLHATIFEAESLTNPHRASGGAPKFLRKLVEGIEDTVGIGKGSSKLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  +PRWYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P   +
Sbjct  61   EKARVGRTRMITNEPVSPRWYESFHIYCAHMAANVIFTVKFDNPIGASLIGRAYLPVMEI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            L GEEVD WL + D DRNP+   +KIHVK+Q+ D+ ++R W RGV++A++PGVPYTFF Q
Sbjct  121  LDGEEVDRWLEICDADRNPV-GDAKIHVKVQYFDISKDRNWARGVRSAKYPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  180  RQGCKVTLYQDAHVP  194



>ref|XP_010250112.1| PREDICTED: phospholipase D alpha 1 [Nelumbo nucifera]
Length=815

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 149/194 (77%), Gaps = 5/194 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHN----LFHKIVEGAERVVGFNKTASRLYATIDLE  204
            M+ +LLHGSLHV +YEVD++ + G         H+IVE     VG  K   ++YAT+DLE
Sbjct  1    MSDILLHGSLHVTIYEVDRLSSGGGGGGPGGFLHQIVENIGEAVGIGKDTPKIYATVDLE  60

Query  205  KARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLL  381
            KARVGRTR+++ E  NPRWYESFHIYCAHMASNV+F+VK D+ IGA L GRAY+P   +L
Sbjct  61   KARVGRTRIIENERVNPRWYESFHIYCAHMASNVIFTVKDDDAIGATLYGRAYVPVEEIL  120

Query  382  GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQR  561
             GEEVD WL +LD+DRNP+   SKIHV+LQF DV R+R W  G+++A+FPGVPYTFF QR
Sbjct  121  NGEEVDRWLEILDDDRNPVREGSKIHVRLQFFDVTRDRNWSMGIRSAKFPGVPYTFFSQR  180

Query  562  RGCKVTLYQDAHVP  603
            +GC+V+LYQDAH+P
Sbjct  181  KGCRVSLYQDAHIP  194



>gb|KHG06123.1| Phospholipase D alpha 1 [Gossypium arboreum]
Length=807

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 146/190 (77%), Gaps = 2/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR ++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWYESFHIYCAHNASNVVFTVKDDNPIGATLIGRAYVPVKDLTEGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W+ +LD D+NPI S  KIHVKLQ+ DV ++R W RG+   +FPGVPYTF+PQR+GCK
Sbjct  120  VDRWVVILDEDKNPIKSGGKIHVKLQYFDVTKDRNWARGIVNRKFPGVPYTFYPQRKGCK  179

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  180  VSLYQDAHIP  189



>ref|XP_008673445.1| PREDICTED: phospholipase D alpha 1 isoform X1 [Zea mays]
 ref|XP_008673446.1| PREDICTED: phospholipase D alpha 1 isoform X1 [Zea mays]
 gb|ACN25900.1| unknown [Zea mays]
 gb|ACN27927.1| unknown [Zea mays]
 gb|ACN28359.1| unknown [Zea mays]
 gb|ACN29073.1| unknown [Zea mays]
 tpg|DAA53244.1| TPA: phospholipase D family protein [Zea mays]
Length=812

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 152/195 (78%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  180  RQGCKVTLYQDAHVP  194



>ref|NP_188194.1| phospholipase D alpha 1 [Arabidopsis thaliana]
 sp|Q38882.2|PLDA1_ARATH RecName: Full=Phospholipase D alpha 1; Short=AtPLDalpha1; Short=PLD 
alpha 1; AltName: Full=Choline phosphatase 1; AltName: 
Full=PLDalpha; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Arabidopsis thaliana]
 dbj|BAB02304.1| phospholipase D [Arabidopsis thaliana]
 dbj|BAE98964.1| phospholipase D [Arabidopsis thaliana]
 gb|AEE75720.1| phospholipase D alpha 1 [Arabidopsis thaliana]
Length=810

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDQVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD+W+ +LDNDRNPI   SKIHVKLQ+  V  +R W  G+K+A+FPGVPYTFF QR+GC
Sbjct  121  EVDQWVEILDNDRNPIQGGSKIHVKLQYFHVEEDRNWNMGIKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>gb|ACR35730.1| unknown [Zea mays]
Length=812

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 152/195 (78%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  180  RQGCKVTLYQDAHVP  194



>ref|XP_007150745.1| hypothetical protein PHAVU_005G177200g [Phaseolus vulgaris]
 gb|ESW22739.1| hypothetical protein PHAVU_005G177200g [Phaseolus vulgaris]
Length=808

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ++LHG+LH  +YEVD +K     N+  K++   E  +G  K  ++LYATIDLEKARV
Sbjct  1    MAQVVLHGTLHATIYEVDNLKAGNGGNILTKLLHNMEETIGIGKGITKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ EH NP+WYESFHIYCAH ASN++F+VK DNPIGA LIGRAY+P   +L GEE
Sbjct  61   GRTRVIEKEHTNPKWYESFHIYCAHEASNIIFTVKDDNPIGATLIGRAYVPVEEILHGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            ++ W+ +LD  + PIH+ SKIHVKLQ+ DV ++  WG+G+K+ +FPGVPYT+F QR+GC+
Sbjct  121  IERWVEILDEHKKPIHTRSKIHVKLQYYDVSKDLNWGQGIKSPKFPGVPYTYFSQRQGCR  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>ref|XP_006297003.1| hypothetical protein CARUB_v10012996mg [Capsella rubella]
 gb|EOA29901.1| hypothetical protein CARUB_v10012996mg [Capsella rubella]
Length=810

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YEVD +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEVDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F++K DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTIKDDNPIGATLIGRAYIPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD W+ +LDNDRNPI   SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121  EVDRWVEILDNDRNPIQGGSKIHVKLQYFHVEEDRNWNKGIKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>gb|ACL53693.1| unknown [Zea mays]
Length=812

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 152/195 (78%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFTRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  180  RQGCKVTLYQDAHVP  194



>ref|NP_001267897.1| phospholipase D alpha [Vitis vinifera]
 gb|ABC59316.1| phospholipase D alpha [Vitis vinifera]
Length=809

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  ++ +D++ + G    F K+VE  E  VGF K  S+LYATID+ +ARV
Sbjct  1    MAQILLHGTLHATIFGIDRLHSGGAPKFFRKLVENIEETVGFGKGTSKLYATIDIGRARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAHMA +++F+VK DNPIGA LIGRA +P + +LGGEE
Sbjct  61   GRTRMIENEPSNPRWYESFHIYCAHMAGHIIFTVKDDNPIGATLIGRASVPIQEILGGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+ +++ +  PIH  SKIHVKLQ+ +V  +R WGRG+++ +FPGVP+TFF QR+GC 
Sbjct  121  VDKWVEIVNEELKPIHGGSKIHVKLQYFEVTADRSWGRGIRSLKFPGVPFTFFSQRKGCH  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>ref|XP_006842069.1| hypothetical protein AMTR_s00078p00051300 [Amborella trichopoda]
 gb|ERN03744.1| hypothetical protein AMTR_s00078p00051300 [Amborella trichopoda]
Length=815

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 149/195 (76%), Gaps = 6/195 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LHV +YE + +      T G      ++VEG E  +GF K A +LYATIDL
Sbjct  1    MAQILLHGTLHVTIYEAESLSNPHRATGGAPKFIRQLVEGIEETIGFGKGAGKLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR+L +E  NPRWYESFHIYCAHMAS+++F+VK DNPIGA LIGRA++P   +
Sbjct  61   EKARVGRTRILTNESVNPRWYESFHIYCAHMASDIIFTVKDDNPIGASLIGRAHVPVEEV  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            + G+EVD W  + D +R PI   +KIHVKLQ+ DV +++ W RG+++ +FPGVPYTFF Q
Sbjct  121  INGDEVDTWAEICDENRKPIGGGAKIHVKLQYFDVTKDQNWSRGIRSPKFPGVPYTFFSQ  180

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKV+LYQDAHVP
Sbjct  181  RQGCKVSLYQDAHVP  195



>gb|KJB70611.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=665

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 146/190 (77%), Gaps = 2/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR ++ E  NPRW+ESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWFESFHIYCAHNASNVVFTVKDDNPIGATLIGRAYVPVKDLTEGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W+ +LD D+NPI S  KIHVKLQ+  V ++R W RG+ + +FPGVPYTF+PQR+GCK
Sbjct  120  VDRWVEILDEDKNPIKSGGKIHVKLQYFGVTKDRNWDRGIVSRKFPGVPYTFYPQRKGCK  179

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  180  VSLYQDAHIP  189



>ref|XP_006643814.1| PREDICTED: phospholipase D alpha 1-like [Oryza brachyantha]
Length=812

 Score =   255 bits (651),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 147/195 (75%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  + E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1    MAQMLLHGTLHATILEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+PA+ L
Sbjct  61   EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPAQEL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            L GEE+D WL + DNDR P+   SKIHVKLQ+ DV ++R W RGV + ++PGVPYTFF Q
Sbjct  121  LSGEEIDRWLDICDNDRQPV-GESKIHVKLQYFDVAKDRNWARGVLSTKYPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  180  RQGCKVTLYQDAHVP  194



>ref|XP_008654846.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008654847.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 gb|AFW80165.1| phospholipase D family protein [Zea mays]
Length=812

 Score =   254 bits (650),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 150/195 (77%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K  +++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGIGKGTTKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++VVF+VK+DNPIGA LIGRAY+P   +
Sbjct  61   EKARVGRTRMVSNEPVNPRWYESFHIYCAHMAADVVFTVKIDNPIGASLIGRAYLPVEDI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            LGG+E+D+WL + D  R PI   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121  LGGDEIDKWLEICDEKREPI-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  180  RQGCKVTLYQDAHVP  194



>ref|NP_001234102.1| phospholipase PLDa1 [Solanum lycopersicum]
 gb|AAG45485.1| phospholipase PLDa1 [Solanum lycopersicum]
Length=809

 Score =   254 bits (649),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 150/192 (78%), Gaps = 4/192 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK--TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            MAQ+ LHG+LHV ++EVD ++   +G H  F KI +  E  VG  K   +LYATIDLEKA
Sbjct  1    MAQIQLHGTLHVTIFEVDNLQGEEEGGH-FFSKIKQHFEETVGIGKGTPKLYATIDLEKA  59

Query  211  RVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR+++ E KNPRWYESFHIYCAHMASNV+F++K DNP GA LIGRAY+P   LL G
Sbjct  60   RVGRTRIIENEPKNPRWYESFHIYCAHMASNVIFTIKDDNPFGASLIGRAYVPVEELLEG  119

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            EE+D+W+ ++D + NPI   SKIHVKLQF DV R+  WGRG++++R+PGVPYTFF QR G
Sbjct  120  EEIDKWVEIMDKEMNPIAEGSKIHVKLQFFDVSRDPNWGRGIRSSRYPGVPYTFFAQRPG  179

Query  568  CKVTLYQDAHVP  603
             +V+LYQDAHVP
Sbjct  180  SRVSLYQDAHVP  191



>gb|EEC70024.1| hypothetical protein OsI_00588 [Oryza sativa Indica Group]
Length=812

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 148/195 (76%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1    MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+P + L
Sbjct  61   EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPVQEL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            L GEE+D WL + DN+R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121  LNGEEIDRWLDICDNNREPV-GESKIHVKLQYFDVSKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  180  RQGCKVTLYQDAHVP  194



>ref|NP_001042153.1| Os01g0172400 [Oryza sativa Japonica Group]
 sp|Q43007.2|PLDA1_ORYSJ RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAF04067.1| Os01g0172400 [Oryza sativa Japonica Group]
 gb|EEE53959.1| hypothetical protein OsJ_00559 [Oryza sativa Japonica Group]
Length=812

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 148/195 (76%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1    MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+P + L
Sbjct  61   EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPVQEL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            L GEE+D WL + DN+R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121  LNGEEIDRWLDICDNNREPV-GESKIHVKLQYFDVSKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  180  RQGCKVTLYQDAHVP  194



>ref|XP_003569355.1| PREDICTED: phospholipase D alpha 1 [Brachypodium distachyon]
Length=811

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 150/194 (77%), Gaps = 6/194 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLE  204
            MAQ+LLHG+LHV ++E   +     + G      K VEG E  VG  K AS+LYATIDLE
Sbjct  1    MAQILLHGNLHVTIFEASSLSNPRASGGAPKFLRKFVEGIEDTVGVGKGASKLYATIDLE  60

Query  205  KARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLL  381
            KARVGRTR+L +E  NPRWYESFHIYCAH+A++V+F+VK DN IGA LIGRAY+P + LL
Sbjct  61   KARVGRTRMLSNEPVNPRWYESFHIYCAHLAADVIFTVKADNAIGATLIGRAYLPVQELL  120

Query  382  GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQR  561
             GEE+D WL + D++R P+   SKIHVKLQ+ D+ ++R W RGV+++++PGVPYTFF QR
Sbjct  121  DGEEIDRWLEVRDDNREPV-GESKIHVKLQYFDISKDRNWSRGVRSSKYPGVPYTFFSQR  179

Query  562  RGCKVTLYQDAHVP  603
            +GCKVTLYQDAHVP
Sbjct  180  QGCKVTLYQDAHVP  193



>gb|ACG63794.1| phospholipase D alpha [Gossypium arboreum]
 gb|ACG70840.1| phospholipase D alpha [Gossypium arboreum]
 gb|ADD83098.1| PLDalpha isoform 2 [Gossypium hirsutum]
 gb|ADD83099.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83100.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83104.1| PLDalpha isoform 1 [Gossypium hirsutum]
Length=807

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 145/190 (76%), Gaps = 2/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR ++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA  IGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWYESFHIYCAHNASNVVFTVKDDNPIGATQIGRAYVPVKDLTEGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W+ +LD D+NPI S  KIHVKLQ+ DV ++R W RG+   +FPGVPYTF+PQR+GCK
Sbjct  120  VDRWVVILDEDKNPIKSGGKIHVKLQYFDVTKDRNWARGIVNRKFPGVPYTFYPQRKGCK  179

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  180  VSLYQDAHIP  189



>ref|XP_006364211.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Solanum tuberosum]
Length=805

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 147/190 (77%), Gaps = 7/190 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG+LHV ++EVD++      N F K        VG  K ASR+YAT+DLEKARV
Sbjct  1    MAPILLHGTLHVTIHEVDRLHGKHGRNFFSK------ETVGMGKGASRIYATVDLEKARV  54

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAHMA NV+F+VK +N IGA LIGRAY+P   LL GEE
Sbjct  55   GRTRVIENEPNNPRWYESFHIYCAHMAKNVIFTVKDNNSIGATLIGRAYLPVNDLLEGEE  114

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VDEW+ +LD D NPI + SKIHV LQ+ ++ R+R WGRG+ ++++PGVPYTFFPQR GC+
Sbjct  115  VDEWIEILDEDENPIEAGSKIHVTLQYFEISRDRNWGRGIGSSKYPGVPYTFFPQRTGCR  174

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  175  VSLYQDAHIP  184



>gb|AGW22212.1| phospholipase D alpha [Chorispora bungeana]
Length=809

 Score =   254 bits (648),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 146/190 (77%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ LLHG+LH  +YEVD++          K++   E  +G  K  ++LY TIDL+KARV
Sbjct  1    MAQHLLHGTLHATIYEVDELHGGVRSGFLGKMLANVEEKIGVGKGETQLYTTIDLQKARV  60

Query  217  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR + +E KNP+WYESFHIYC HMAS+++F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61   GRTRKIKNEPKNPKWYESFHIYCGHMASDIIFTVKDDNPIGATLIGRAYVPVDDVINGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W+ +LDNDRNPIH  SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GCK
Sbjct  121  VDRWVEILDNDRNPIHGGSKIHVKLQYFHVEEDRNWNKGIKSAKFPGVPYTFFSQRQGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  181  VSLYQDAHIP  190



>ref|XP_009408983.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408984.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
Length=809

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 147/192 (77%), Gaps = 4/192 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTD--GLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            MAQ+LLHG+LH  +++ + +     G       +VEG E  +G  K  ++ YATIDLEKA
Sbjct  1    MAQILLHGTLHATIFDAESLTNPQRGSGGFLRMVVEGIEDTIGLGKGTTKHYATIDLEKA  60

Query  211  RVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR+L DE  NPRWYESFHIYCAHMA+NV+F++K DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRMLSDEPVNPRWYESFHIYCAHMAANVIFTIKFDNPIGATLIGRAYLPVMEILDG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            +EVD WL + D DRNP+   +KIHVKLQ+ DV+++R W RGV++ ++PGVPYTFF QR+G
Sbjct  121  DEVDRWLEICDEDRNPV-GDAKIHVKLQYFDVLKDRNWARGVRSTKYPGVPYTFFSQRQG  179

Query  568  CKVTLYQDAHVP  603
            CKVTLYQDAHVP
Sbjct  180  CKVTLYQDAHVP  191



>ref|XP_004135845.1| PREDICTED: phospholipase D alpha 1-like [Cucumis sativus]
 gb|KGN45278.1| hypothetical protein Csa_7G432600 [Cucumis sativus]
Length=808

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ +  NP+W ESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61   GRTRILESDPSNPKWNESFHIYCAHKASNVIFTVKDDNPIGATLIGRAYVPVEDIVDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+P+LD ++NPI   SKIHVKLQ+  V ++R WGRG+++ +FPGVPYT++ QR+GCK
Sbjct  121  VDKWVPILDENQNPIEEESKIHVKLQYFSVTKDRNWGRGIRSRKFPGVPYTYYSQRQGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>emb|CDY63527.1| BnaAnng18990D, partial [Brassica napus]
Length=334

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 140/192 (73%), Gaps = 3/192 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            M + LLHG LH  +YEVD +     G    F KI+   E  +G  K   +LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEVDSLHGSEGGRSGFFGKILANVEETIGVGKGEPQLYATIDLEKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + +E  NP+W+ESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRKITNEPNNPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYIPVEDILHG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            EEVD W+ +LD ++ P+   SKIHVKLQ+  V +++ W RG+K+ +FPGVPYTFF QRRG
Sbjct  121  EEVDRWVEILDTEKKPVEGGSKIHVKLQYFGVEKDKNWNRGIKSVKFPGVPYTFFSQRRG  180

Query  568  CKVTLYQDAHVP  603
            CKV+LYQDAH+P
Sbjct  181  CKVSLYQDAHIP  192



>gb|ABN13537.2| phospholipase D [Cucumis sativus]
Length=808

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M    LHG+LH  +YE+D++ T G  N+F  + +  E  VG  K  ++LYATIDLEKARV
Sbjct  1    MEGTSLHGTLHATIYEIDRLHTGGSSNVFSMLRQNFEEAVGIGKGQTKLYATIDLEKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+L+ +  NP+W ESFHIYCAH ASNV+F+VK DNPIGA LIGRAY+P   ++ GEE
Sbjct  61   GRTRILESDPSNPKWNESFHIYCAHKASNVIFTVKDDNPIGATLIGRAYVPVEDIVDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+P+LD ++NPI   SKIHVKLQ+  V ++R WGRG+++ +FPGVPYT++ QR+GCK
Sbjct  121  VDKWVPILDENQNPIEEESKIHVKLQYFSVTKDRNWGRGIRSRKFPGVPYTYYSQRQGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  181  VSLYQDAHVP  190



>ref|XP_010465563.1| PREDICTED: phospholipase D alpha 1-like [Camelina sativa]
Length=810

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  ++E+D +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIFEIDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD W+ +LDND+NPI   SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121  EVDRWVEILDNDKNPIQGGSKIHVKLQYFHVEEDRNWNKGIKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|XP_010487412.1| PREDICTED: phospholipase D alpha 1 isoform X2 [Camelina sativa]
Length=810

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 148/191 (77%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  +YE+D +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIYEIDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGR Y+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRGYIPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD W+ +LDND+NPI   SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121  EVDRWVEILDNDKNPIQGGSKIHVKLQYFHVEEDRNWNKGIKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|NP_001105686.1| phospholipase D alpha 1 [Zea mays]
 sp|Q43270.1|PLDA1_MAIZE RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Zea mays]
 dbj|BAA11135.1| phospholipase D [Zea mays]
Length=812

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 151/195 (77%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+  + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLAVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            LGGEE+D+WL + D +R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121  LGGEEIDKWLEISDENREPV-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  180  RQGCKVTLYQDAHVP  194



>gb|ACG63795.1| phospholipase D alpha [Gossypium raimondii]
 gb|ACG70839.1| phospholipase D alpha [Gossypium raimondii]
 gb|ACV70145.1| phospholipase D [Gossypium raimondii]
 gb|ADD83101.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83102.1| PLDalpha [Gossypium hirsutum]
 gb|ADD83103.1| PLDalpha isoform 1 [Gossypium hirsutum]
 gb|ADD83105.1| PLDalpha isoform 2 [Gossypium hirsutum]
 gb|KJB70610.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70614.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=807

 Score =   253 bits (645),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 146/190 (77%), Gaps = 2/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G  K   ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGKGVPKIYATIDLERARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR ++ E  NPRW+ESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWFESFHIYCAHNASNVVFTVKDDNPIGATLIGRAYVPVKDLTEGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W+ +LD D+NPI S  KIHVKLQ+  V ++R W RG+ + +FPGVPYTF+PQR+GCK
Sbjct  120  VDRWVEILDEDKNPIKSGGKIHVKLQYFGVTKDRNWDRGIVSRKFPGVPYTFYPQRKGCK  179

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  180  VSLYQDAHIP  189



>ref|XP_010322318.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 ref|XP_010322320.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 ref|XP_010322321.1| PREDICTED: phospholipase PLDa1 isoform X1 [Solanum lycopersicum]
 gb|AAF17557.1|AF201661_1 phospholipase D alpha [Solanum lycopersicum]
Length=809

 Score =   253 bits (645),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 149/192 (78%), Gaps = 4/192 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK--TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            MAQ+ LHG+LHV ++EVD ++   +G H  F KI +  E  VG  K   +LYATIDLEKA
Sbjct  1    MAQIQLHGTLHVTIFEVDNLQGEEEGGH-FFSKIKQHFEETVGIGKGTPKLYATIDLEKA  59

Query  211  RVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR+++ E KNPRWYESFHIYCAHMASNV+F++K DNP GA LIGRAY+P   LL G
Sbjct  60   RVGRTRIIENEPKNPRWYESFHIYCAHMASNVIFTIKDDNPFGASLIGRAYVPVEELLEG  119

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            EE+D+W+ ++D + NP    SKIHVKLQF DV R+  WGRG++++R+PGVPYTFF QR G
Sbjct  120  EEIDKWVEIMDKEMNPTAEGSKIHVKLQFFDVSRDPNWGRGIRSSRYPGVPYTFFAQRPG  179

Query  568  CKVTLYQDAHVP  603
             +V+LYQDAHVP
Sbjct  180  SRVSLYQDAHVP  191



>gb|ADP23922.1| phospholipase D alpha [Litchi chinensis]
Length=800

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 151/190 (79%), Gaps = 8/190 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD++ T G  + F K++       G  K  S++YATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDQLDTGGGGHFFRKLI-------GLGKGQSKIYATIDLEKARV  53

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ +H NPRWYESFHIYCAHMAS+V+F+VK DN +GA LIGRA++P   +LGGEE
Sbjct  54   GRTRIIEKDHANPRWYESFHIYCAHMASDVIFTVKDDNAVGASLIGRAHVPVEEILGGEE  113

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+ LLD  +NPI + SKIHVKLQ+ DV ++R + RG+ +A++PGVP+TFF QR GCK
Sbjct  114  VDKWVELLDEHKNPIEAGSKIHVKLQYFDVTKDRNFSRGLISAKYPGVPFTFFAQRHGCK  173

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  174  VSLYQDAHVP  183



>ref|XP_007023176.1| Phospholipase D alpha 2 isoform 3 [Theobroma cacao]
 gb|EOY25798.1| Phospholipase D alpha 2 isoform 3 [Theobroma cacao]
Length=670

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 146/191 (76%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M  +LLHG+LHV +YE DK+ + G   + F K++   E  +G  K   ++YATIDLE+AR
Sbjct  1    MEDILLHGTLHVTIYEADKLHSGGGGGHFFRKLMANVEETIGIGKGIPKIYATIDLERAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+    LL GE
Sbjct  61   VGRTRIIEKEISNPRWYESFHIYCAHRASNVVFTVKDDNPIGATLIGRAYVSVDELLSGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD W+ +LD D+NPI S  KIHVKLQ+ DV R+R W RG+ + +FPGVP+TF+ QR+GC
Sbjct  121  EVDRWVEILDEDKNPIESGGKIHVKLQYFDVTRDRNWNRGIISRKFPGVPFTFYSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|XP_010503392.1| PREDICTED: phospholipase D alpha 1-like [Camelina sativa]
Length=810

 Score =   251 bits (642),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 148/191 (77%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  ++E+D +   G+   F  KI+   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIFEIDALHGGGVRQGFLGKILANVEETIGVGKGETQLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGR Y+P   ++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRGYVPVDEVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD W+ +LDND+NPI   SKIHVKLQ+  V  +R W +G+K+A+FPGVPYTFF QR+GC
Sbjct  121  EVDRWVEILDNDKNPIQGGSKIHVKLQYFHVEEDRNWNKGIKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>gb|ACV70146.1| phospholipase D [Gossypium arboreum]
Length=807

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 144/190 (76%), Gaps = 2/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M + LLHG+LH  +YEVD++  DG  N F K+V   +  +G      ++YATIDLE+ARV
Sbjct  1    MEETLLHGTLHATIYEVDRLH-DGGGNFFGKLVANVQETIGIGIGVPKIYATIDLERARV  59

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR ++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA  IGRAY+P + L  G+E
Sbjct  60   GRTRTIENETSNPRWYESFHIYCAHNASNVVFTVKDDNPIGATQIGRAYVPVKDLTEGDE  119

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W+ +LD D+NPI S  KIHVKLQ+ DV ++R W RG+   +FPGVPYTF+PQR+GCK
Sbjct  120  VDRWVVILDEDKNPIKSGGKIHVKLQYFDVTKDRNWARGIVNRKFPGVPYTFYPQRKGCK  179

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  180  VSLYQDAHIP  189



>dbj|BAA11136.1| phospholipase D [Oryza sativa Japonica Group]
 dbj|BAA19467.1| phospholipase D [Oryza sativa Japonica Group]
Length=812

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 147/195 (75%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E   +      +        K VEG E  VG  K A+++Y+TIDL
Sbjct  1    MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDTVGVGKGATKVYSTIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMASNV+F+VK+DNPIGA  IGRAY+P + L
Sbjct  61   EKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKIDNPIGATNIGRAYLPVQEL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            L GEE+D WL + DN+R  +   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121  LNGEEIDRWLDICDNNRESV-GESKIHVKLQYFDVSKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  180  RQGCKVTLYQDAHVP  194



>ref|XP_010691149.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=809

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 146/190 (77%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LHV +YE   +       +F K++   E  VG  +   ++YATIDLEKAR 
Sbjct  1    MAQILLHGTLHVTIYEASDLHHGNDPGVFRKLMANIEETVGLGQGTPKMYATIDLEKARA  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NPRWYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P   +LGGEE
Sbjct  61   GRTRIIENEPANPRWYESFHIYCAHLASSIIFTVKDDNPIGATLIGRAYVPVEEILGGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD W+ + D D+NP+ S +KIHVKLQF ++ +ER +  G+++ ++PGVPYTFFPQR GCK
Sbjct  121  VDRWVEICDRDKNPLDSGAKIHVKLQFFEITQERSFNHGIRSGKYPGVPYTFFPQRTGCK  180

Query  574  VTLYQDAHVP  603
            V+LYQDAH+P
Sbjct  181  VSLYQDAHIP  190



>ref|XP_006406922.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 ref|XP_006406923.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 gb|ESQ48375.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
 gb|ESQ48376.1| hypothetical protein EUTSA_v10020083mg [Eutrema salsugineum]
Length=810

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  ++EVD +   G+   F  K++   E  +G  K  ++LYATIDL+KAR
Sbjct  1    MAQHLLHGTLHATIFEVDALHGGGIRQGFLGKVLANVEEKIGVGKGETQLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESFHIYCAH+AS+++F+VK DNPIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYIPVDQVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD+W+ +LDNDRNPI   SKIHVKLQ+  V  +R W  G+K+A+FPGVPYTFF QR+GC
Sbjct  121  EVDQWVEILDNDRNPIEGGSKIHVKLQYFHVEEDRNWNMGIKSAKFPGVPYTFFSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQ AH+P
Sbjct  181  KVSLYQGAHIP  191



>ref|XP_009348321.1| PREDICTED: phospholipase D alpha 1 [Pyrus x bretschneideri]
Length=810

 Score =   250 bits (638),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 145/193 (75%), Gaps = 2/193 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            ++E     LHG+LH  +YEVDK+ +    N F KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MTEAENQWLHGTLHATIYEVDKLHSSS-GNFFRKITGKIEETVGIGKGISKLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NPRWYESFHIYCAH  +NV+F+VK  NPIGA LIGRAY+P + L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHTTANVIFTVKESNPIGASLIGRAYVPVQELIE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  564
            GEEVD+W  +LD  +NP+H + KIHVKLQF  V ++R WG G+++ +FPGVP+TFF QR+
Sbjct  120  GEEVDQWAEILDEKKNPVHGNPKIHVKLQFFHVTKDRSWGLGIRSPKFPGVPFTFFSQRQ  179

Query  565  GCKVTLYQDAHVP  603
            GCKV+LYQDAH+P
Sbjct  180  GCKVSLYQDAHIP  192



>gb|ABX83202.2| phospholipase D [Lolium temulentum]
Length=811

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 145/194 (75%), Gaps = 6/194 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTD----GLHNLFHKIVEGAERVVGFNKTASRLYATIDLE  204
            MAQ+LLHG+LHV ++E   + T            KIVEG E  VG  K AS+LYATIDLE
Sbjct  1    MAQILLHGNLHVTIFEAQALSTGRASAAAPKFLRKIVEGLEDTVGVGKGASKLYATIDLE  60

Query  205  KARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLL  381
            KARVGRTR+L +E  +PRWYESFHIYCAH+A++V+F+VK DN IGA LIGRAY+P   LL
Sbjct  61   KARVGRTRMLANEPVSPRWYESFHIYCAHLAADVIFTVKADNAIGAALIGRAYLPVSELL  120

Query  382  GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQR  561
             G+E+D WL + D DR PI   SKIHVKLQF +  ++R W RGV++A++PGVPYTFF QR
Sbjct  121  AGDEIDRWLEVCDTDRQPI-GESKIHVKLQFFEATKDRNWARGVRSAKYPGVPYTFFSQR  179

Query  562  RGCKVTLYQDAHVP  603
            +GC V LYQDAHVP
Sbjct  180  QGCNVRLYQDAHVP  193



>ref|XP_007023174.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 ref|XP_007023175.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 gb|EOY25796.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
 gb|EOY25797.1| Phospholipase D alpha 2 isoform 1 [Theobroma cacao]
Length=809

 Score =   249 bits (636),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 146/191 (76%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLH-NLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M  +LLHG+LHV +YE DK+ + G   + F K++   E  +G  K   ++YATIDLE+AR
Sbjct  1    MEDILLHGTLHVTIYEADKLHSGGGGGHFFRKLMANVEETIGIGKGIPKIYATIDLERAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR+++ E  NPRWYESFHIYCAH ASNVVF+VK DNPIGA LIGRAY+    LL GE
Sbjct  61   VGRTRIIEKEISNPRWYESFHIYCAHRASNVVFTVKDDNPIGATLIGRAYVSVDELLSGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD W+ +LD D+NPI S  KIHVKLQ+ DV R+R W RG+ + +FPGVP+TF+ QR+GC
Sbjct  121  EVDRWVEILDEDKNPIESGGKIHVKLQYFDVTRDRNWNRGIISRKFPGVPFTFYSQRQGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|XP_010687988.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010687989.1| PREDICTED: phospholipase D alpha 1-like [Beta vulgaris subsp. 
vulgaris]
Length=806

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA++LLHG LHV +YE +++   G    FHK+VEG E V+G  K A +LYA+ID+E ARV
Sbjct  1    MAKILLHGVLHVTIYEANRLFGGGGGKFFHKVVEGLESVIG--KGAGKLYASIDIEGARV  58

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTRL++   NPRWYE FHI CAHMAS++VF++K D  IGA L+GRAY+PA  +LGGEEV
Sbjct  59   GRTRLVENDSNPRWYEQFHICCAHMASDIVFTLKEDEAIGATLLGRAYLPATDILGGEEV  118

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  576
            D WL +LD D NPIH  SK+HV +QF DV R+  W  G+K  +FPGVPYT+F QR  CKV
Sbjct  119  DTWLDILDKDHNPIHKGSKVHVLVQFFDVTRDLNWNIGIKTPKFPGVPYTYFTQRNECKV  178

Query  577  TLYQDAHVP  603
            TLYQDAHVP
Sbjct  179  TLYQDAHVP  187



>ref|XP_010462102.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
 ref|XP_010462103.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
 ref|XP_010462104.1| PREDICTED: phospholipase D alpha 2 [Camelina sativa]
Length=810

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 145/191 (76%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M + LLHG LH  +YEVD++ T+G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLNTEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QRRGC
Sbjct  121  EVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRRGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>emb|CDX87920.1| BnaC06g09820D [Brassica napus]
Length=343

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 141/192 (73%), Gaps = 3/192 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            M + LLHG LH  +YE+D +     G      K++   E  +G  K  ++LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEIDALHATQGGRSGFLGKMLANVEEKIGVGKGETQLYATIDLEKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + +E K+P+W+ESFHIYC HMA +V+F+VK DNPIGA LIGR Y+P   +L G
Sbjct  61   RVGRTRKITNEPKSPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRGYVPVEDILHG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            EEVD W+ +LD ++ PI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QR+G
Sbjct  121  EEVDRWVEILDTEKKPIEGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRKG  180

Query  568  CKVTLYQDAHVP  603
            CKV+LYQDAH+P
Sbjct  181  CKVSLYQDAHIP  192



>ref|XP_008373955.1| PREDICTED: phospholipase D alpha 1 [Malus domestica]
Length=810

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 145/193 (75%), Gaps = 2/193 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            ++E     LHG+LH  +YEVDK+ +    N   KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MTEAENHWLHGTLHATIYEVDKLHSSS-GNFLRKIAGKIEETVGIGKGISKLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NPRWYESFHIYCAH A+NV+F+VK  NPIGA LIGRAY+P + L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHTAANVIFTVKESNPIGASLIGRAYVPVQELIE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  564
            GEEVD+W  +LD  +NP+H + KIHVKLQF  V ++R WG G+++ +FPGVP+TFF QR+
Sbjct  120  GEEVDQWAEILDEKKNPVHGNPKIHVKLQFFHVTKDRSWGLGIRSPKFPGVPFTFFSQRQ  179

Query  565  GCKVTLYQDAHVP  603
            GCKV+LYQDAH+P
Sbjct  180  GCKVSLYQDAHIP  192



>ref|XP_006392903.1| hypothetical protein EUTSA_v10011246mg [Eutrema salsugineum]
 gb|ESQ30189.1| hypothetical protein EUTSA_v10011246mg [Eutrema salsugineum]
Length=813

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 145/191 (76%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M + +LHG LH  +YEVD++  +G  + F  +I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFMLHGRLHATIYEVDRLHVEGGRSGFLGQILANVEETIGVGKGETQLYATIDLEKAR  60

Query  214  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +  GE
Sbjct  61   VGRTRKITKEPKNPKWYESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYVPVEDIFHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD W+ +LD +R PI+  SKIHVKLQ+  V ++R W RG+K+A+FPGVPYTFF QRRGC
Sbjct  121  EVDRWVEILDTERKPINGGSKIHVKLQYFGVEKDRNWNRGIKSAKFPGVPYTFFSQRRGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>gb|ADY75750.1| phospholipase D alpha [Dimocarpus longan]
Length=800

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 149/190 (78%), Gaps = 8/190 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MAQ+LLHG+LH  +YEVD++   G  + F K++       G  K  S++YATIDLEKARV
Sbjct  1    MAQILLHGTLHATIYEVDQLDRGGGGHFFRKLI-------GLGKGESKIYATIDLEKARV  53

Query  217  GRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR++  +H NPRWYESFHIYCAHMAS+V+F+VK DN +GA LIGRA++P   +LGGEE
Sbjct  54   GRTRIIGKDHANPRWYESFHIYCAHMASDVIFTVKDDNAVGASLIGRAHVPVEEILGGEE  113

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+ LLD  +NPI + SKIHVKLQ+ D+ ++R + RG+ +A++PGVP+TFF QR GCK
Sbjct  114  VDKWVELLDEHKNPIEAGSKIHVKLQYFDIRKDRNFSRGLISAKYPGVPFTFFTQRHGCK  173

Query  574  VTLYQDAHVP  603
            V+LYQDAHVP
Sbjct  174  VSLYQDAHVP  183



>ref|XP_008360327.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like 
[Malus domestica]
Length=810

 Score =   247 bits (630),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 144/193 (75%), Gaps = 2/193 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            ++E     LHG+LH  +YEVDK+ +    N   KI    E  VG  K  SRLYAT+DLE+
Sbjct  1    MTEAENHWLHGTLHATIYEVDKLHSSS-GNFLRKITGKLEETVGIGKGISRLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NPRWYESFHIYCAH A+NV+F+VK  NPIGA LIGRAY+P + L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHTAANVIFTVKESNPIGASLIGRAYVPVQELIE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  564
            GEEVD+W  +LD  + P+H + KIHVKLQF  V ++R WG G+++ +FPGVP+TFF QR+
Sbjct  120  GEEVDQWAEILDGKKEPVHGNPKIHVKLQFFHVTKDRSWGLGIRSPKFPGVPFTFFSQRQ  179

Query  565  GCKVTLYQDAHVP  603
            GCKV+LYQDAH+P
Sbjct  180  GCKVSLYQDAHIP  192



>gb|EMT03624.1| Phospholipase D alpha 1 [Aegilops tauschii]
Length=812

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 146/195 (75%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LHV ++E   +      + G      K VEG E  VG  K +S+LYATIDL
Sbjct  1    MAQILLHGNLHVTIFEASSLSHPGRASGGAPKFIRKFVEGIEETVGVGKGSSKLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR+L +E  NPRWYESFHIYCAH+A++V+F++K DN IGA LIGRAY+P   L
Sbjct  61   EKARVGRTRMLGNEPVNPRWYESFHIYCAHLAADVIFTMKADNAIGATLIGRAYLPVGEL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            LGGEE+D WL + D++R P+   SKIHVKLQ+  V ++R W RGV++ +FPGVPYTFF Q
Sbjct  121  LGGEEIDRWLEICDDNREPV-GESKIHVKLQYFGVDKDRNWARGVRSVKFPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GC V LYQDAHVP
Sbjct  180  RQGCNVRLYQDAHVP  194



>ref|XP_002894388.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70647.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=810

 Score =   246 bits (629),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLHAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  214  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR +  E KNP+W+ESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKITKEPKNPKWFESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYIPVEDILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD W+ +LDND+NPI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QRRGC
Sbjct  121  EVDRWVDILDNDKNPIAGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRRGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|XP_010500864.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010500866.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010500867.1| PREDICTED: phospholipase D alpha 2-like isoform X1 [Camelina 
sativa]
Length=811

 Score =   246 bits (628),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QRRGC
Sbjct  121  EVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRRGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|XP_010500868.1| PREDICTED: phospholipase D alpha 2-like isoform X2 [Camelina 
sativa]
Length=811

 Score =   246 bits (628),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QRRGC
Sbjct  121  EVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRRGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|XP_008243731.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
 ref|XP_008243732.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
 ref|XP_008243733.1| PREDICTED: phospholipase D alpha 1 [Prunus mume]
Length=810

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 144/193 (75%), Gaps = 2/193 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            ++E  +  LHG+LH  +YEVDK+ +    NL  KI    E  VG  K  SRLYAT+DLE+
Sbjct  1    MAEPQEQWLHGTLHATIYEVDKLHSSS-GNLLRKITGKIEETVGIGKGVSRLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NPRWYESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P   L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVDDLVE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  564
            GEEVD W  +LD  + P+H + KIHVKLQF  V ++R WG G+++ +FPGVP+TFF QR+
Sbjct  120  GEEVDRWAEILDEKKRPVHGNPKIHVKLQFFHVTKDRSWGLGIRSPKFPGVPFTFFSQRQ  179

Query  565  GCKVTLYQDAHVP  603
            GCKV LYQDAH+P
Sbjct  180  GCKVNLYQDAHIP  192



>ref|XP_007217042.1| hypothetical protein PRUPE_ppa001519mg [Prunus persica]
 gb|EMJ18241.1| hypothetical protein PRUPE_ppa001519mg [Prunus persica]
Length=810

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 144/193 (75%), Gaps = 2/193 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            ++E  +  LHG+LH  +YEVDK+ +    NL  KI    E  VG  K  SRLYAT+DLE+
Sbjct  1    MAEPQEQWLHGTLHATIYEVDKLHSSS-GNLLRKITGKIEETVGIGKGVSRLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NPRWYESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P   L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVDDLVE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  564
            GEEVD W  +LD  + P+H + KIHVKLQF  V ++R WG G+++ +FPGVP+TFF QR+
Sbjct  120  GEEVDRWAEILDEKKRPVHGNPKIHVKLQFFHVTKDRSWGLGIRSPKFPGVPFTFFSQRQ  179

Query  565  GCKVTLYQDAHVP  603
            GCKV LYQDAH+P
Sbjct  180  GCKVNLYQDAHIP  192



>gb|ACG80607.1| phospholipase D alpha [Prunus persica]
Length=810

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/193 (59%), Positives = 144/193 (75%), Gaps = 2/193 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            ++E  +  LHG+LH  +YEVDK+ +    NL  KI    E  VG  K  SRLYAT+DLE+
Sbjct  1    MAEPQEQWLHGTLHATIYEVDKLHSSS-GNLLRKITGKIEETVGIGKGVSRLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NPRWYESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P   L+ 
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVDDLVE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  564
            GEEVD W  +LD  + P+H + KIHVKLQF  V ++R WG G+++ +FPGVP+TFF QR+
Sbjct  120  GEEVDRWAEILDEKKRPVHGNPKIHVKLQFFHVTKDRSWGLGIRSPKFPGVPFTFFSQRQ  179

Query  565  GCKVTLYQDAHVP  603
            GCKV LYQDAH+P
Sbjct  180  GCKVNLYQDAHIP  192



>ref|XP_010925209.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
 ref|XP_010925210.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
 ref|XP_010925211.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
Length=810

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 146/192 (76%), Gaps = 3/192 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKT--DGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            MA +LLHG+LH+ ++E D + +   G      ++VEG    +G  K +S+LYATID+EKA
Sbjct  1    MAYILLHGTLHITIFEADSLSSASGGGPKFIRQLVEGIGDTIGLGKGSSQLYATIDVEKA  60

Query  211  RVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTRL+ +E   PRWYESFHIYCAH+A++V+F+VK D PIGA L+GRAY+P   +L G
Sbjct  61   RVGRTRLITNEPVKPRWYESFHIYCAHLAASVIFTVKDDKPIGASLVGRAYLPVTEILDG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            EE+D WL + D D  P+   +KIHVK+Q+ D+ ++R W RG+++A++PGVPYTFF QRRG
Sbjct  121  EEIDRWLEICDEDSKPLDGGAKIHVKVQYFDISKDRNWARGIRSAKYPGVPYTFFSQRRG  180

Query  568  CKVTLYQDAHVP  603
            CKVTLYQDAHVP
Sbjct  181  CKVTLYQDAHVP  192



>ref|XP_009365415.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=816

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 146/199 (73%), Gaps = 8/199 (4%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            ++E     LHG+LH  +YEVDK+ +    N F KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MTEAENQWLHGTLHATIYEVDKLHSSS-GNFFRKITGKIEETVGIGKGISKLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIG------RAYMP  366
            ARVGRTR+++ E  NPRWYESFHIYCAH A+NV+F+VK  NPIGA LIG      RAY+P
Sbjct  60   ARVGRTRVIEKEPSNPRWYESFHIYCAHTATNVIFTVKESNPIGASLIGGASLIGRAYVP  119

Query  367  ARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYT  546
             + L+ GEEVD+W  +LD  +NP+H + KIHVKLQF  V ++R WG G+++ +FPGVP+T
Sbjct  120  VQELIEGEEVDQWAEILDEKKNPVHGNPKIHVKLQFFHVTKDRSWGLGIRSPKFPGVPFT  179

Query  547  FFPQRRGCKVTLYQDAHVP  603
            FF QR+GCKV+LYQDAH+P
Sbjct  180  FFSQRQGCKVSLYQDAHIP  198



>ref|XP_006306783.1| hypothetical protein CARUB_v10008323mg, partial [Capsella rubella]
 gb|EOA39681.1| hypothetical protein CARUB_v10008323mg, partial [Capsella rubella]
Length=813

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 145/192 (76%), Gaps = 2/192 (1%)
 Frame = +1

Query  34   EMAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKA  210
            +M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKA
Sbjct  3    KMDEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKA  62

Query  211  RVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L G
Sbjct  63   RVGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHG  122

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            EEVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QR+G
Sbjct  123  EEVDRWVEILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRKG  182

Query  568  CKVTLYQDAHVP  603
            CKV+LYQDAH+P
Sbjct  183  CKVSLYQDAHIP  194



>gb|EYU24646.1| hypothetical protein MIMGU_mgv1a001477mg [Erythranthe guttata]
Length=812

 Score =   244 bits (624),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 142/190 (75%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG+LH  + EVDK+      N F K++E     VG  K   ++YAT+DLEK+RV
Sbjct  1    MAHILLHGTLHATICEVDKLHGGADGNFFGKLMENIGETVGIGKGTPKIYATVDLEKSRV  60

Query  217  GRTRLLDEHKN-PRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRL++   N PRWYESFHIYCAHMAS+V+F+VK  NPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRLIENEPNSPRWYESFHIYCAHMASSVIFTVKDANPIGATLIGRAYVPVHDLLDGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            +D W+ +LD ++NP+   SKI VKLQF DV R+R W  G+K+ + PGVPYTFF QRRGC+
Sbjct  121  IDRWVEILDENKNPVPEGSKIRVKLQFFDVTRDRNWAHGIKSPKNPGVPYTFFAQRRGCR  180

Query  574  VTLYQDAHVP  603
            V+L+QDAHVP
Sbjct  181  VSLFQDAHVP  190



>ref|NP_001267764.1| phospholipase D alpha 1-like [Setaria italica]
 gb|ADK60917.1| phospholipase D alpha 1 [Setaria italica]
Length=811

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/195 (58%), Positives = 148/195 (76%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E  ++      + G      K+VEG E  VG  K  +++YATIDL
Sbjct  1    MAQILLHGTLHATIFEAQELSNPHRASGGAPKFIRKLVEGIEDTVGVGKGTTKIYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EK RVGRTR++ +E  NPRWYESFHIYCAH+A++V+F+VK+DNPIGA LIGRA++P + L
Sbjct  61   EKTRVGRTRMISNEPANPRWYESFHIYCAHLAADVIFTVKIDNPIGATLIGRAHLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            L G+E+D+WL + D    PI   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF Q
Sbjct  121  LDGKEIDKWLEICDEGGEPI-GGSKIHVKLQYFDVSKDRNWARGVRSTKYPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAHVP
Sbjct  180  RQGCKVTLYQDAHVP  194



>gb|EPS60466.1| hypothetical protein M569_14336, partial [Genlisea aurea]
Length=770

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +1

Query  133  VEGAERVVGFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFS  312
             EG E  +GF KTASRLYATIDL  ARVGRTRLL+E  NPRWYESFHIYCAH  S+VVFS
Sbjct  1    AEGVEEALGFRKTASRLYATIDLGIARVGRTRLLEETSNPRWYESFHIYCAHTTSDVVFS  60

Query  313  VKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE  492
            VK+DNPIGAE+IGRA + A  ++ GEE+D WLP+L++D   IH + KIHVKLQF DV RE
Sbjct  61   VKIDNPIGAEVIGRAALAAADIVVGEEIDAWLPILNSDHKAIHGNPKIHVKLQFFDVARE  120

Query  493  RCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAH  597
            RCW RG+K+  FPGVPYTFFPQR+GC++TLYQD+H
Sbjct  121  RCWSRGIKSPNFPGVPYTFFPQRKGCRITLYQDSH  155



>tpg|DAA53245.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=332

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  127  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNV  303
            ++VEG E  VG  K A+++YAT+DLEKARVGRTR++ +E  NPRWYESFHIYCAHMA++V
Sbjct  34   QLVEGIEDTVGVGKGATKIYATVDLEKARVGRTRMISNEPVNPRWYESFHIYCAHMAADV  93

Query  304  VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  483
            +F+VK+DN IGA LIGRAY+P + LLGGEE+D+WL + D +R P+   SKIHVKLQ+ DV
Sbjct  94   IFTVKIDNSIGASLIGRAYLPVQDLLGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDV  152

Query  484  VRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
             ++R W RGV++ ++PGVPYTFF QR+GCKVTLYQDAHVP
Sbjct  153  GKDRNWARGVRSTKYPGVPYTFFSQRQGCKVTLYQDAHVP  192



>emb|CDM81985.1| unnamed protein product [Triticum aestivum]
Length=812

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 144/195 (74%), Gaps = 7/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LHV ++E   +      + G      K VEG E  VG  K +S+LYATIDL
Sbjct  1    MAQILLHGNLHVTIFEASSLSHPGRASGGAPKFIRKFVEGIEETVGVGKGSSKLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR+L +E  NPRWYESFHIYCAH+A++V+F++K DN IGA LIGRAY+P   L
Sbjct  61   EKARVGRTRMLGNEPVNPRWYESFHIYCAHLAADVIFTMKADNAIGATLIGRAYLPVAEL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            L GEE+D WL + D+ R P+   SKIHVKLQ+  V ++R W RGV++ +FPGVPYTFF Q
Sbjct  121  LEGEEIDRWLEICDDKREPV-GESKIHVKLQYFGVDKDRNWARGVRSVKFPGVPYTFFSQ  179

Query  559  RRGCKVTLYQDAHVP  603
            R+GC V LYQDAHVP
Sbjct  180  RQGCNVRLYQDAHVP  194



>ref|XP_010479770.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
 ref|XP_010479771.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
 ref|XP_010479772.1| PREDICTED: phospholipase D alpha 2-like [Camelina sativa]
Length=810

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 143/191 (75%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M + LLHG LH  +YEVD++  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEEFLLHGRLHATIYEVDRLNAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR +  E KNP+WYESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKISKEPKNPKWYESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYVPVEDILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD W+ +LDN++ PI   SKIHVK+Q+  V +++ W RG+K+A+FPGVPYTFF QRRGC
Sbjct  121  EVDRWVEILDNEKKPIAGGSKIHVKIQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRRGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|XP_004303313.1| PREDICTED: phospholipase D alpha 1 [Fragaria vesca subsp. vesca]
Length=810

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 145/193 (75%), Gaps = 2/193 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            + + A+  LHG+LH  +YEVDK+      N   KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MGDAAEHWLHGTLHATIYEVDKLHGSS-GNFLRKITGKLEETVGLGKGVSKLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NP+W+ESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P  +L+ 
Sbjct  60   ARVGRTRVIEKEPSNPKWFESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVEQLIE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  564
            GEEVD W  +LD+ + P+H   KIHVKLQF  V ++R WG+G+K+ +FPGVP+TFF QR+
Sbjct  120  GEEVDTWAEILDDKKKPVHGEPKIHVKLQFFHVSKDRSWGQGIKSPKFPGVPFTFFSQRQ  179

Query  565  GCKVTLYQDAHVP  603
            GC+V+L+QDAHVP
Sbjct  180  GCRVSLFQDAHVP  192



>gb|AAW83125.1| phospholipase D alpha [Fragaria x ananassa]
Length=810

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 144/193 (75%), Gaps = 2/193 (1%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            + + A+  LHG+LH  +YEVDK+      N   KI    E  VG  K  S+LYAT+DLE+
Sbjct  1    MGDSAEHWLHGTLHATIYEVDKLHGSS-GNFLRKITGKLEETVGLGKGVSKLYATVDLER  59

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NP W ESFHIYCAH+A+NV+F+VK  NPIGA LIGRAY+P  +L+ 
Sbjct  60   ARVGRTRVIEKEPSNPNWSESFHIYCAHVAANVIFTVKESNPIGASLIGRAYVPVEQLIE  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  564
            GEEVD W  +LD+ +NP+H   KIHVKLQF  V ++R WG+G+K+ +FPGVP+TFF QR+
Sbjct  120  GEEVDTWAKILDDKKNPVHGEPKIHVKLQFFHVSKDRSWGQGIKSPKFPGVPFTFFSQRQ  179

Query  565  GCKVTLYQDAHVP  603
            GC+V+L+QDAHVP
Sbjct  180  GCRVSLFQDAHVP  192



>ref|NP_175666.1| phospholipase D alpha 2 [Arabidopsis thaliana]
 sp|Q9SSQ9.1|PLDA2_ARATH RecName: Full=Phospholipase D alpha 2; Short=AtPLDalpha2; Short=PLD 
alpha 2; AltName: Full=Choline phosphatase 2; AltName: 
Full=Phosphatidylcholine-hydrolyzing phospholipase D 2 [Arabidopsis 
thaliana]
 gb|AAD55607.1|AC008016_17 Similar to gb|AF090445 phospholipase D1 from Brassica oleacea 
[Arabidopsis thaliana]
 gb|AEE32825.1| phospholipase D alpha 2 [Arabidopsis thaliana]
Length=810

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 143/191 (75%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            M + LLHG LH  +YEVD +  +G  + F   I+   E  +G  K  ++LYATIDLEKAR
Sbjct  1    MEECLLHGRLHATIYEVDHLHAEGGRSGFLGSILANVEETIGVGKGETQLYATIDLEKAR  60

Query  214  VGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR +  E KNP+W+ESFHIYC HMA +V+F+VK  NPIGA LIGR Y+P   +L GE
Sbjct  61   VGRTRKITKEPKNPKWFESFHIYCGHMAKHVIFTVKDANPIGATLIGRGYIPVEDILHGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD W+ +LDN++NPI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QRRGC
Sbjct  121  EVDRWVDILDNEKNPIAGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRRGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|XP_009123823.1| PREDICTED: phospholipase D alpha 2-like [Brassica rapa]
Length=812

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 140/192 (73%), Gaps = 3/192 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            M + LLHG LH  +YEVD +     G    F KI+   E  +G  K   +LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEVDSLHGSEGGRSGFFGKILANVEETIGVGKGEPQLYATIDLEKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + +E  NP+W+ESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRKITNEPNNPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYIPVEDILHG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            EEVD W+ +LD ++ P+   SKIHVKLQ+  V +++ W RG+K+ +FPGVPYTFF QRRG
Sbjct  121  EEVDRWVEILDTEKKPVEGGSKIHVKLQYFGVEKDKNWNRGIKSVKFPGVPYTFFSQRRG  180

Query  568  CKVTLYQDAHVP  603
            CKV+LYQDAH+P
Sbjct  181  CKVSLYQDAHIP  192



>emb|CDY47540.1| BnaC03g69220D [Brassica napus]
Length=812

 Score =   241 bits (615),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 140/192 (73%), Gaps = 3/192 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            M + LLHG LH  +YEVD +     G    F KI+   E  +G  K   +LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEVDSLHGSEGGRSGFFGKILANVEETIGVGKGEPQLYATIDLEKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + +E  NP+W+ESFHIYC HMA +V+F+VK DNPIGA LIGRAY+P   +L G
Sbjct  61   RVGRTRKITNEPNNPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRAYIPVEDILHG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            EEVD W+ +LD ++ P+   SKIHVKLQ+  V +++ W RG+K+ +FPGVPYTFF QRRG
Sbjct  121  EEVDRWVEILDTEKKPVEGGSKIHVKLQYFGVEKDKNWNRGIKSVKFPGVPYTFFSQRRG  180

Query  568  CKVTLYQDAHVP  603
            CKV+LYQDAH+P
Sbjct  181  CKVSLYQDAHIP  192



>gb|AAL48261.2|AF451979_1 phospholipase D1 [Papaver somniferum]
 gb|AAL48263.2|AF451981_1 phospholipase D1 [Papaver somniferum]
Length=813

 Score =   241 bits (615),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 153/195 (78%), Gaps = 6/195 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+ LHG+LHV ++E + I     KT G    F K+VE  E  VGF K AS LYA++DL
Sbjct  1    MAQISLHGTLHVTIFEANSISHPDRKTGGAPKFFRKLVENIEETVGFGKGASMLYASVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            +KARVGRTR++ DE  NP+WYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P  ++
Sbjct  61   DKARVGRTRIIKDEPVNPKWYESFHIYCAHMAANVIFTVKDDNPIGATLIGRAYVPIDKV  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            L GEEVDEW+ ++D +RNP+    KIHVKLQ+ DV +++ W RG+++A+FPGVPYTFF Q
Sbjct  121  LSGEEVDEWVEVVDQERNPVQGGCKIHVKLQYFDVGQDKNWARGIRSAKFPGVPYTFFTQ  180

Query  559  RRGCKVTLYQDAHVP  603
            R GCKV+LYQDAHVP
Sbjct  181  RTGCKVSLYQDAHVP  195



>ref|XP_002443625.1| hypothetical protein SORBIDRAFT_08g022520 [Sorghum bicolor]
 gb|EES17463.1| hypothetical protein SORBIDRAFT_08g022520 [Sorghum bicolor]
Length=813

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 148/198 (75%), Gaps = 9/198 (5%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYAT  192
            ++EM+  LLHG+LH  ++E   +      +        K+VEG E  VG  K ++++YAT
Sbjct  1    MAEMS--LLHGTLHATIFEAASLSNPQRASGRAPKFIRKLVEGIEESVGVGKGSTKIYAT  58

Query  193  IDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPA  369
            IDLEK RVGRTR++ +E  NPRWYESFHIYCAH A+NV+F+VK+DNPIGA LIGRAYMP 
Sbjct  59   IDLEKTRVGRTRIISNEPVNPRWYESFHIYCAHRAANVIFTVKIDNPIGASLIGRAYMPV  118

Query  370  RRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTF  549
              +L GEE+D+WL + D+ R PI  HSKIHVK+Q+ DV ++  W RGV++ ++PGVPYTF
Sbjct  119  ADILVGEEIDKWLEICDDKREPI-GHSKIHVKIQYFDVSKDCNWARGVQSKKYPGVPYTF  177

Query  550  FPQRRGCKVTLYQDAHVP  603
            F QR+GCKVTLYQDAHVP
Sbjct  178  FSQRQGCKVTLYQDAHVP  195



>gb|AAL48262.2|AF451980_1 phospholipase D2 [Papaver somniferum]
 gb|AAL48264.2|AF451982_1 phospholipase D2 [Papaver somniferum]
Length=813

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 153/195 (78%), Gaps = 6/195 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI-----KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+ LHG+LHV ++E + I     KT G    F K+VE  E  VGF K AS LYA++DL
Sbjct  1    MAQISLHGTLHVTIFEANSISHPDRKTGGAPKFFRKLVENIEETVGFGKGASMLYASVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            +KARVGRTR++ DE  NP+WYESFHIYCAHMA+NV+F+VK DNPIGA LIGRAY+P  ++
Sbjct  61   DKARVGRTRIIKDEPVNPKWYESFHIYCAHMAANVIFTVKDDNPIGATLIGRAYVPIDQV  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            L GEEVDEW+ ++D +RNP+    KIHVKLQ+ DV +++ W RG+++A+FPGVPYTFF Q
Sbjct  121  LSGEEVDEWVEVVDEERNPVQGGCKIHVKLQYFDVGQDKNWARGIRSAKFPGVPYTFFTQ  180

Query  559  RRGCKVTLYQDAHVP  603
            R GCKV+LYQDAHVP
Sbjct  181  RTGCKVSLYQDAHVP  195



>ref|XP_010545768.1| PREDICTED: phospholipase D alpha 1 [Tarenaya hassleriana]
Length=810

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 145/191 (76%), Gaps = 2/191 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI-KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ LLHG+LH  VYE+D +    G    F +++   E  +G  K  ++LYAT+DLEKAR
Sbjct  1    MAQRLLHGTLHATVYEIDHLHGGGGRSGFFGQLLANVEETIGVGKGETQLYATVDLEKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + D+  +P+W ESFHIYCAHMASN++F+VK  NPIGA LIGRAY+P   +  GE
Sbjct  61   VGRTRKIKDDPNSPKWNESFHIYCAHMASNIIFTVKDANPIGATLIGRAYVPVEEIWDGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EV++W+ +LD +RNPI   SKI V+LQ+ DV ++R W RG+++A+FPGVPYTFF QR+GC
Sbjct  121  EVEKWVEILDTNRNPIKGDSKIRVRLQYFDVTKDRNWNRGIRSAKFPGVPYTFFSQRKGC  180

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  181  KVSLYQDAHIP  191



>ref|XP_007204652.1| hypothetical protein PRUPE_ppa001528mg [Prunus persica]
 gb|EMJ05851.1| hypothetical protein PRUPE_ppa001528mg [Prunus persica]
Length=807

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 142/191 (74%), Gaps = 6/191 (3%)
 Frame = +1

Query  37   MAQ-LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ +LLHG LH  +YEVD++  DG    F K+++   + V F K  S+ YATIDLE AR
Sbjct  1    MAQTVLLHGVLHTTIYEVDRLMADGCCIFFCKLLK---KSVEFGK-GSKFYATIDLENAR  56

Query  214  VGRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTRLL+   +NPRW ESFHIYCAH ASNVVFS+K DN IGA++IGRAYMPA  LL GE
Sbjct  57   VGRTRLLENATQNPRWRESFHIYCAHKASNVVFSIKEDNAIGAKVIGRAYMPAAELLNGE  116

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD WL +LDN+  P+H  SKIHVKL F  V  +  W RG+++  FPGVPYTFF QR GC
Sbjct  117  EVDRWLKILDNNNKPLHGGSKIHVKLCFSSVNEDPNWSRGIRSPEFPGVPYTFFTQRNGC  176

Query  571  KVTLYQDAHVP  603
            +VTLYQDAHVP
Sbjct  177  RVTLYQDAHVP  187



>ref|XP_008242775.1| PREDICTED: phospholipase D alpha 1-like [Prunus mume]
Length=807

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 141/191 (74%), Gaps = 6/191 (3%)
 Frame = +1

Query  37   MAQ-LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ +LLHG LH  +YEVD++   G    F K+++   + V F K  S+LYATIDLE AR
Sbjct  1    MAQTVLLHGVLHTTIYEVDRLMASGCSIFFCKLLK---KSVEFGK-GSKLYATIDLENAR  56

Query  214  VGRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTRLL+   KNPRW ESFHIYCAH ASNVVFS+K DN IGA +IGRAYMPA  LL GE
Sbjct  57   VGRTRLLENATKNPRWRESFHIYCAHKASNVVFSIKEDNAIGATVIGRAYMPAAELLNGE  116

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD WL +LDN+  P+H  SKIHVKL+   V  +  W RG+++  FPGVPYTFF QR GC
Sbjct  117  EVDRWLKILDNNNKPLHGGSKIHVKLRLSSVNEDPNWSRGIRSPEFPGVPYTFFTQRNGC  176

Query  571  KVTLYQDAHVP  603
            +VTLYQDAHVP
Sbjct  177  RVTLYQDAHVP  187



>emb|CDY60551.1| BnaA05g35700D [Brassica napus]
Length=812

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 141/192 (73%), Gaps = 3/192 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            M + LLHG LH  +YE+D +     G      K++   E  +G  K  ++LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEIDALHATQGGRSGFLGKMLANVEEKIGVGKGETQLYATIDLEKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + +E K+P+W+ESFHIYC HMA +V+F+VK DNPIGA LIGR Y+P   +L G
Sbjct  61   RVGRTRKITNEPKSPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRGYVPVEDILHG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            EEVD W+ +LD ++ PI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QR+G
Sbjct  121  EEVDRWVEILDTEKKPIEGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRKG  180

Query  568  CKVTLYQDAHVP  603
            CKV+LYQDAH+P
Sbjct  181  CKVSLYQDAHIP  192



>ref|XP_009144830.1| PREDICTED: phospholipase D alpha 2 [Brassica rapa]
Length=812

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 141/192 (73%), Gaps = 3/192 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI--KTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKA  210
            M + LLHG LH  +YE+D +     G      K++   E  +G  K  ++LYATIDLEKA
Sbjct  1    MEEFLLHGRLHATIYEIDALHATQGGRSGFLGKMLANVEEKIGVGKGETQLYATIDLEKA  60

Query  211  RVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGG  387
            RVGRTR + +E K+P+W+ESFHIYC HMA +V+F+VK DNPIGA LIGR Y+P   +L G
Sbjct  61   RVGRTRKITNEPKSPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRGYVPVEDILHG  120

Query  388  EEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            EEVD W+ +LD ++ PI   SKIHVKLQ+  V +++ W RG+K+A+FPGVPYTFF QR+G
Sbjct  121  EEVDRWVEILDTEKKPIEGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRKG  180

Query  568  CKVTLYQDAHVP  603
            CKV+LYQDAH+P
Sbjct  181  CKVSLYQDAHIP  192



>tpg|DAA53246.1| TPA: phospholipase D family protein [Zea mays]
Length=655

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 135/162 (83%), Gaps = 2/162 (1%)
 Frame = +1

Query  121  FHKIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMAS  297
            F ++VEG E  VG  K A+++YAT+DLEKARVGRTR++ +E  NPRWYESFHIYCAHMA+
Sbjct  5    FRQLVEGIEDTVGVGKGATKIYATVDLEKARVGRTRMISNEPVNPRWYESFHIYCAHMAA  64

Query  298  NVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFL  477
            +V+F+VK+DN IGA LIGRAY+P + LLGGEE+D+WL + D +R P+   SKIHVKLQ+ 
Sbjct  65   DVIFTVKIDNSIGASLIGRAYLPVQDLLGGEEIDKWLEICDENREPV-GDSKIHVKLQYF  123

Query  478  DVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
            DV ++R W RGV++ ++PGVPYTFF QR+GCKVTLYQDAHVP
Sbjct  124  DVGKDRNWARGVRSTKYPGVPYTFFSQRQGCKVTLYQDAHVP  165



>ref|XP_009787005.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Nicotiana 
sylvestris]
Length=790

 Score =   235 bits (600),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNV  303
            KI E  E  VG  K AS++YAT+DLEKARVGRTR+++ E  NPRW ESFHIYCAHMASNV
Sbjct  11   KIKETVEETVGVGKGASKMYATVDLEKARVGRTRVIENEPSNPRWNESFHIYCAHMASNV  70

Query  304  VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  483
            +F+VK +N IGA LIGRAY+P   LL GEEVDEW+ +LD D+NPI   SKIHV LQF D+
Sbjct  71   IFTVKDNNSIGATLIGRAYLPVNELLEGEEVDEWIEILDEDKNPIKEGSKIHVTLQFFDI  130

Query  484  VRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
             R+R WGRG+ + ++PGVPYTFFPQR GC+V+LYQDAH+P
Sbjct  131  SRDRNWGRGIGSPKYPGVPYTFFPQRSGCRVSLYQDAHIP  170



>sp|O04883.1|PLDA1_PIMBR RecName: Full=Phospholipase D alpha 1; Short=PLD alpha 1; AltName: 
Full=Choline phosphatase 1; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 1 [Spuriopimpinella brachycarpa]
 gb|AAB70463.1| phospholipase D [Spuriopimpinella brachycarpa]
Length=808

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 142/190 (75%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA+ LLHG+LHV ++EVD +K   +      +     + +   K   ++YA+IDL+KARV
Sbjct  1    MAKTLLHGTLHVTIFEVDHLKAGSVVVFSESLRRTLRKPLVLAKGTPKIYASIDLDKARV  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR+++ E  NP+W ESFHIYC H ++NV+F+VK DNPIGA LIGRAY+P   LL GEE
Sbjct  61   GRTRMIENEPNNPKWNESFHIYCGHPSTNVIFTVKDDNPIGATLIGRAYLPVHELLEGEE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+W+ +LD D+NPI   SKIHVKLQ+ D+ ++R W  G+++++FPGVPYTFF QR GC+
Sbjct  121  VDKWVEILDEDKNPISEGSKIHVKLQYFDITQDRNWAHGIRSSKFPGVPYTFFSQRPGCR  180

Query  574  VTLYQDAHVP  603
            ++LYQDAHVP
Sbjct  181  ISLYQDAHVP  190



>ref|XP_006654096.1| PREDICTED: phospholipase D alpha 1-like [Oryza brachyantha]
Length=818

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 145/199 (73%), Gaps = 10/199 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHG+LHV V+E D +      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MAKILLHGTLHVTVFEADGLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGTSKVYATIGL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            +KARVGRTR L D+   PRWYESFH+YCAH+AS+V+F++K  NPIG+ L+G AY+P R +
Sbjct  61   DKARVGRTRTLADDTAAPRWYESFHVYCAHLASDVLFTLKAKNPIGSSLLGVAYLPVRDI  120

Query  379  LGGEEVDEWLPLLDN---DRNPI-HSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYT  546
              G EV+ WLPL D+   +R P+    SK+HVKLQ+ D+ ++R WGRGV++ ++PGVPYT
Sbjct  121  FAGAEVERWLPLCDDVDAERKPVGDGDSKVHVKLQYFDISKDRSWGRGVRSGKYPGVPYT  180

Query  547  FFPQRRGCKVTLYQDAHVP  603
            FF QR+GCKVTLYQDAHVP
Sbjct  181  FFSQRQGCKVTLYQDAHVP  199



>ref|NP_001054773.2| Os05g0171000 [Oryza sativa Japonica Group]
 dbj|BAF16687.2| Os05g0171000 [Oryza sativa Japonica Group]
Length=686

 Score =   231 bits (590),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 143/198 (72%), Gaps = 9/198 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHG++HV ++E + +      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MAKILLHGTMHVTIFEAESLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGTSKVYATIGL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            +KARVGRTR L D+   PRWYESFH+YCAH+A++V F++K  NPIGA L+G  Y+P R +
Sbjct  61   DKARVGRTRTLADDTAAPRWYESFHVYCAHLATHVAFTLKAKNPIGASLLGVGYLPVRDV  120

Query  379  LGGEEVDEWLPLLDND--RNPI-HSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTF  549
            L G+EVD WLPL D+   R PI     K+HVKLQ+ D+ ++R WGRGV++ ++PGVPYTF
Sbjct  121  LAGDEVDRWLPLCDDTDARTPIGDGGGKVHVKLQYFDISKDRSWGRGVRSGKYPGVPYTF  180

Query  550  FPQRRGCKVTLYQDAHVP  603
            F QR+GCKVTLYQDAHVP
Sbjct  181  FSQRQGCKVTLYQDAHVP  198



>ref|XP_002440692.1| hypothetical protein SORBIDRAFT_09g005220 [Sorghum bicolor]
 gb|EES19122.1| hypothetical protein SORBIDRAFT_09g005220 [Sorghum bicolor]
Length=700

 Score =   231 bits (590),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 142/200 (71%), Gaps = 11/200 (6%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDG-----LHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHGSLHV ++E +++   G           K+VE  E  VG  K  S++YATI L
Sbjct  1    MARILLHGSLHVTIFEAEELSNSGRPSSQAPGFLRKLVETVEDTVGVGKGTSKIYATIGL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             KARVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61   GKARVGRTRTLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  379  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPY  543
              G EVD WL L D      +R P+ +  K+HVKLQ+ D+ ++R WGRGV++ ++PGVPY
Sbjct  121  FDGHEVDRWLHLCDGGGDDKNRTPLETGGKVHVKLQYFDISKDRSWGRGVRSGKYPGVPY  180

Query  544  TFFPQRRGCKVTLYQDAHVP  603
            TFF QR+GC+VTLYQDAHVP
Sbjct  181  TFFSQRQGCRVTLYQDAHVP  200



>ref|XP_010656428.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=814

 Score =   233 bits (593),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 141/190 (74%), Gaps = 7/190 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M Q L+HG+LH  +YEVD + T G  N   K+   ++R+VG     S++Y TIDLEKA V
Sbjct  2    MEQSLVHGTLHATIYEVDGLSTGGPWNFIQKL---SKRIVG--APISKIYVTIDLEKAGV  56

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRT  LD E  NPRWY+SFHIYCAH AS+VVFSVK DNPIGA +IGRA++P   LL GE 
Sbjct  57   GRTSKLDNEDSNPRWYQSFHIYCAHKASHVVFSVKQDNPIGATVIGRAHLPVGELLEGE-  115

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD WL L  +D  PI+  SK+HVKLQF+DV RE  W RG+++ +FPGVPYTFFPQR+GC+
Sbjct  116  VDRWLELFHHDHTPINGGSKLHVKLQFVDVTREFNWSRGIRSPKFPGVPYTFFPQRKGCR  175

Query  574  VTLYQDAHVP  603
            V LYQDAHVP
Sbjct  176  VLLYQDAHVP  185



>gb|AFW76092.1| phospholipase D family protein [Zea mays]
Length=529

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 140/200 (70%), Gaps = 11/200 (6%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDG-----LHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHGSLHV ++E +++               K+VEG E  VG  K  S++YATI L
Sbjct  1    MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  60

Query  202  EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61   GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  379  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPY  543
              G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++  WG+GV++ ++PGVPY
Sbjct  121  FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKDHSWGKGVRSGKYPGVPY  180

Query  544  TFFPQRRGCKVTLYQDAHVP  603
            TFF QR+GC+VTLYQDAHVP
Sbjct  181  TFFSQRQGCRVTLYQDAHVP  200



>ref|XP_008673447.1| PREDICTED: phospholipase D alpha 1 isoform X2 [Zea mays]
Length=810

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = +1

Query  127  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNV  303
            ++VEG E  VG  K A+++YAT+DLEKARVGRTR++ +E  NPRWYESFHIYCAHMA++V
Sbjct  34   QLVEGIEDTVGVGKGATKIYATVDLEKARVGRTRMISNEPVNPRWYESFHIYCAHMAADV  93

Query  304  VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  483
            +F+VK+DN IGA LIGRAY+P + LLGGEE+D+WL + D +R P+   SKIHVKLQ+ DV
Sbjct  94   IFTVKIDNSIGASLIGRAYLPVQDLLGGEEIDKWLEICDENREPV-GDSKIHVKLQYFDV  152

Query  484  VRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
             ++R W RGV++ ++PGVPYTFF QR+GCKVTLYQDAHVP
Sbjct  153  GKDRNWARGVRSTKYPGVPYTFFSQRQGCKVTLYQDAHVP  192



>ref|XP_002524502.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF37942.1| phopholipase d alpha, putative [Ricinus communis]
Length=725

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 138/190 (73%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG L + ++EVD++   G    F KI+E  E  VG  K  S+LYATIDLE  +V
Sbjct  1    MAPVLLHGILDLTIFEVDRLSGSGCSKFFCKILENVEETVGCGKGFSKLYATIDLEGTKV  60

Query  217  GRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR L   + +P+W ESFHIYCAH+ASNV FS+KV +PIG+++IGRAY+P   LL GE+
Sbjct  61   GRTRELKHARSDPQWDESFHIYCAHLASNVTFSIKVKDPIGSQVIGRAYLPVVELLNGEK  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+WL +L+ +  P+H   KIHV++QFLD  +   W +G+ +  F GVPYTFFPQR GC+
Sbjct  121  VDKWLRILNKNHKPLHRGLKIHVRVQFLDATKRSSWSKGITSPNFSGVPYTFFPQRSGCR  180

Query  574  VTLYQDAHVP  603
            VTLYQDAHVP
Sbjct  181  VTLYQDAHVP  190



>gb|AAU44332.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAY96710.1| hypothetical protein OsI_18631 [Oryza sativa Indica Group]
 dbj|BAH00843.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62492.1| hypothetical protein OsJ_17289 [Oryza sativa Japonica Group]
Length=824

 Score =   231 bits (590),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 143/198 (72%), Gaps = 9/198 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHG++HV ++E + +      +        K+VEG E  VG  K  S++YATI L
Sbjct  1    MAKILLHGTMHVTIFEAESLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGTSKVYATIGL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            +KARVGRTR L D+   PRWYESFH+YCAH+A++V F++K  NPIGA L+G  Y+P R +
Sbjct  61   DKARVGRTRTLADDTAAPRWYESFHVYCAHLATHVAFTLKAKNPIGASLLGVGYLPVRDV  120

Query  379  LGGEEVDEWLPLLDND--RNPI-HSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTF  549
            L G+EVD WLPL D+   R PI     K+HVKLQ+ D+ ++R WGRGV++ ++PGVPYTF
Sbjct  121  LAGDEVDRWLPLCDDTDARTPIGDGGGKVHVKLQYFDISKDRSWGRGVRSGKYPGVPYTF  180

Query  550  FPQRRGCKVTLYQDAHVP  603
            F QR+GCKVTLYQDAHVP
Sbjct  181  FSQRQGCKVTLYQDAHVP  198



>ref|XP_002282187.3| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
 ref|XP_010656427.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=814

 Score =   230 bits (586),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 137/190 (72%), Gaps = 7/190 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M Q+LLHG+LH  +YEVD++ + G  N   K+    ER       +S++Y TIDL+KARV
Sbjct  2    MEQILLHGTLHGTIYEVDRLSSGGPWNFIDKLKRRIERA-----GSSKVYVTIDLDKARV  56

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR L+ E  NP W E FHIYCAH AS+VVFSVK +NPIGA +IGRA +P   LL GE 
Sbjct  57   GRTRKLENEETNPHWSECFHIYCAHKASHVVFSVKQENPIGATVIGRAQLPVEELLEGE-  115

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD WL L  +DR PIH  SK+HVKLQF DV RE  W RG+ + +FPGVPYTFFPQR+GC+
Sbjct  116  VDRWLELFHHDRTPIHGGSKLHVKLQFFDVTRECNWSRGITSPKFPGVPYTFFPQRKGCR  175

Query  574  VTLYQDAHVP  603
            V LYQDAH+P
Sbjct  176  VLLYQDAHIP  185



>ref|XP_008650412.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
Length=733

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 140/200 (70%), Gaps = 11/200 (6%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDG-----LHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHGSLHV ++E +++               K+VEG E  VG  K  S++YATI L
Sbjct  1    MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  60

Query  202  EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61   GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  379  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPY  543
              G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++  WG+GV++ ++PGVPY
Sbjct  121  FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKDHSWGKGVRSGKYPGVPY  180

Query  544  TFFPQRRGCKVTLYQDAHVP  603
            TFF QR+GC+VTLYQDAHVP
Sbjct  181  TFFSQRQGCRVTLYQDAHVP  200



>ref|XP_002325225.2| hypothetical protein POPTR_0018s13110g [Populus trichocarpa]
 gb|EEF03790.2| hypothetical protein POPTR_0018s13110g [Populus trichocarpa]
Length=808

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 138/190 (73%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M  +LLHG+LHV +YE  ++   G      KI+E  ++ VGF K   +LYA I LE+ RV
Sbjct  1    MEPVLLHGTLHVTIYEACRVFGSGCSKFCCKILENIDKTVGFGKGFCKLYAGIYLEETRV  60

Query  217  GRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRLL+  H +P+W+ESFHIYCAH+ASNV+FSVK DNPI A +IG+AY+P   LL G+E
Sbjct  61   GRTRLLEHPHSDPQWFESFHIYCAHIASNVIFSVKEDNPIEAVVIGKAYLPVAELLDGKE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            V++WL +L  +  P+H  SKIHVK+QF D  +   W RG+ + +FPGVPYTFF QR GC+
Sbjct  121  VEKWLNILHKNHRPLHKGSKIHVKVQFFDATKRHYWSRGIGSPKFPGVPYTFFSQRSGCR  180

Query  574  VTLYQDAHVP  603
            VTLYQDAHVP
Sbjct  181  VTLYQDAHVP  190



>ref|XP_008649399.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
 ref|XP_008649400.1| PREDICTED: phospholipase D alpha 1-like [Zea mays]
Length=821

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 140/200 (70%), Gaps = 11/200 (6%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDG-----LHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHGSLHV ++E +++               K+VEG E  VG  K  S++YATI L
Sbjct  1    MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  60

Query  202  EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  61   GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  120

Query  379  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPY  543
              G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++  WG+GV++ ++PGVPY
Sbjct  121  FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKDHSWGKGVRSGKYPGVPY  180

Query  544  TFFPQRRGCKVTLYQDAHVP  603
            TFF QR+GC+VTLYQDAHVP
Sbjct  181  TFFSQRQGCRVTLYQDAHVP  200



>ref|XP_011017763.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011017764.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=831

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 138/190 (73%), Gaps = 1/190 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M  +L+HG+LHV +YE  ++   G      KI+E  ++ VGF K   +LYA I LE+ARV
Sbjct  24   MEPVLIHGTLHVTIYEACRVFGSGCSKFCCKILENIDKNVGFGKGFCKLYAGIYLEEARV  83

Query  217  GRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTRLL+  H +P+W+ESFHIYCAH+ASNV+FSVK DNPI A +IG+AY+P   LL G+E
Sbjct  84   GRTRLLEHPHSDPQWFESFHIYCAHIASNVIFSVKEDNPIEAVVIGKAYLPVAELLDGKE  143

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD+WL +L  +  P H  SKIHVK+QF D  +   W +G+ + +FPGVPYTFF QR GC+
Sbjct  144  VDKWLDILHKNHRPPHKGSKIHVKVQFFDATKRHYWSKGIGSPKFPGVPYTFFSQRSGCR  203

Query  574  VTLYQDAHVP  603
            VTLYQDAHVP
Sbjct  204  VTLYQDAHVP  213



>gb|AFW77332.1| phospholipase D family protein [Zea mays]
Length=925

 Score =   228 bits (582),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 140/200 (70%), Gaps = 11/200 (6%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDG-----LHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHGSLHV ++E +++               K+VEG E  VG  K  S++YATI L
Sbjct  105  MARILLHGSLHVTIFEAEELSNSSRPSSQAPGFLRKLVEGIEDTVGVGKGTSKIYATIGL  164

Query  202  EKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             K RVGRTR L DE  +PRWYESFH+YCAH+AS+VVF+++  NPIGA  +G AY+P R +
Sbjct  165  GKTRVGRTRKLTDETASPRWYESFHVYCAHLASDVVFTIRAKNPIGASTVGVAYLPVRDI  224

Query  379  LGGEEVDEWLPLLDN-----DRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPY  543
              G EVD WL L D      DR P+ S  K+HV+LQ+ D+ ++  WG+GV++ ++PGVPY
Sbjct  225  FEGHEVDRWLHLCDGGGDDKDRTPLESGGKVHVRLQYFDISKDHSWGKGVRSGKYPGVPY  284

Query  544  TFFPQRRGCKVTLYQDAHVP  603
            TFF QR+GC+VTLYQDAHVP
Sbjct  285  TFFSQRQGCRVTLYQDAHVP  304



>gb|KCW70693.1| hypothetical protein EUGRSUZ_F03862 [Eucalyptus grandis]
Length=773

 Score =   227 bits (578),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 128/154 (83%), Gaps = 3/154 (2%)
 Frame = +1

Query  145  ERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKV  321
            E  VG  K  S+LYATIDL KARVGRTRLL+ E  NPRWYESFHIYCAHMAS+V+F++K 
Sbjct  5    EETVGLGKGVSKLYATIDLGKARVGRTRLLEKEPSNPRWYESFHIYCAHMASDVIFTIKD  64

Query  322  DNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCW  501
            DNPIGA LIGRAY+P   LLGGEE+D W+ +LD +RNPI   SKIHVKL + DV ++R +
Sbjct  65   DNPIGATLIGRAYVPVDELLGGEELDRWVEILDKERNPI--GSKIHVKLHYFDVSKDRIY  122

Query  502  GRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
            GRG+++A+FPGVPYTFF QR+GCKV+LYQD+H+P
Sbjct  123  GRGIRSAKFPGVPYTFFSQRQGCKVSLYQDSHIP  156



>ref|XP_006656220.1| PREDICTED: phospholipase D alpha 2-like [Oryza brachyantha]
Length=820

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 136/196 (69%), Gaps = 7/196 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA LLLHG+L   + E D +      T G   +F K VEG E  +G  K A+RLYATIDL
Sbjct  1    MAHLLLHGTLEATILEADNLSDPTRATGGAPGIFRKFVEGFEDSLGLGKGATRLYATIDL  60

Query  202  EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++D E  NPRWYE FHIYCAH A++VVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVVDGESVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRER-CWGRGVKAARFPGVPYTFFP  555
            L G+ ++  L +LD  R  I     IHV+LQF DV  +R  WGRGV  AR+PGVPYTFF 
Sbjct  121  LSGQAIERRLDVLDASRKRISHGPTIHVRLQFRDVAGDRHGWGRGVCGARYPGVPYTFFS  180

Query  556  QRRGCKVTLYQDAHVP  603
            QR GCKVTLYQDAHVP
Sbjct  181  QRPGCKVTLYQDAHVP  196



>ref|XP_003568837.1| PREDICTED: phospholipase D alpha 1-like [Brachypodium distachyon]
Length=822

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 138/195 (71%), Gaps = 6/195 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA++LLHG+LHV V+E + +      +        K+VEG E  VG  K  S  YAT+ L
Sbjct  1    MAKILLHGTLHVTVFEAEGLSNPSRPSSQAPQFLRKLVEGIEDTVGVGKGNSNFYATVSL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             + R+GRTR L DE  +PRW+ESFHIYCAH+AS+V+F++K  + IGA ++G  ++P R +
Sbjct  61   GQCRIGRTRTLSDESTSPRWFESFHIYCAHLASDVLFTIKAKSAIGASVVGTGFLPVRDI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
              G+EV+ WLPL D+ RNP     K+HVKLQ+ D+ ++R WGRG+++ + PGVPYTFF Q
Sbjct  121  FPGDEVERWLPLCDDARNPADGGGKVHVKLQYFDISKDRAWGRGIRSPKHPGVPYTFFSQ  180

Query  559  RRGCKVTLYQDAHVP  603
            R+GCKVTLYQDAH+P
Sbjct  181  RQGCKVTLYQDAHIP  195



>ref|NP_001058017.1| Os06g0604400 [Oryza sativa Japonica Group]
 sp|P93844.2|PLDA2_ORYSJ RecName: Full=Phospholipase D alpha 2; Short=PLD alpha 2; AltName: 
Full=Choline phosphatase 2; AltName: Full=Phosphatidylcholine-hydrolyzing 
phospholipase D 2 [Oryza sativa Japonica 
Group]
 dbj|BAD35531.1| Phospholipase D alpha 2 [Oryza sativa Japonica Group]
 dbj|BAF19931.1| Os06g0604400 [Oryza sativa Japonica Group]
 gb|EEE65982.1| hypothetical protein OsJ_21907 [Oryza sativa Japonica Group]
Length=817

 Score =   225 bits (573),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 135/196 (69%), Gaps = 7/196 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA LLLHG+L   + E D +      T     +F K VEG E  +G  K A+RLYATIDL
Sbjct  1    MAHLLLHGTLEATILEADHLSNPTRATGAAPGIFRKFVEGFEDSLGLGKGATRLYATIDL  60

Query  202  EKARVGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++D+   NPRWYE FHIYCAH A++VVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVVDDEPVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIGRAYLPVREL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRER-CWGRGVKAARFPGVPYTFFP  555
            L GE ++  L +LD  R  I     IHV+LQF DV  +R  WGRGV  AR+PGVPYTFF 
Sbjct  121  LSGEAIERRLDILDAGRRRISHGPTIHVRLQFRDVAGDRHGWGRGVSGARYPGVPYTFFS  180

Query  556  QRRGCKVTLYQDAHVP  603
            QR GC+VTLYQDAHVP
Sbjct  181  QRPGCRVTLYQDAHVP  196



>ref|XP_011070230.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 1-like 
[Sesamum indicum]
Length=819

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 140/208 (67%), Gaps = 24/208 (12%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI------------------KTDGLHNLFHKIVEGAERVVGF  162
            MA  LLHG+LH  ++E D++                  KT    + F + +  +  +VG 
Sbjct  1    MAPRLLHGTLHATIFEADRLQGGFSLSHLFGTTGNPQKKTKSFLSQFKRFLLCSPEIVG-  59

Query  163  NKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  339
                SR+YATIDLE+ARVGRTR++ +E  NPRW E FHIYCAH  SN+VF+VK DNPIGA
Sbjct  60   ----SRIYATIDLERARVGRTRVIQNEPSNPRWSEYFHIYCAHNVSNIVFTVKDDNPIGA  115

Query  340  ELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKA  519
             LIGRAY+P   L+ G  VD W+ +LD DRNPIH  SKIHVKLQF  V++E  W +G+++
Sbjct  116  TLIGRAYLPVEELMSGHMVDRWIDILDEDRNPIHGGSKIHVKLQFFQVIQESSWSQGIRS  175

Query  520  ARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
            + F GVPYTFF QR+GCKV+LY DAHVP
Sbjct  176  SAFGGVPYTFFKQRQGCKVSLYPDAHVP  203



>ref|XP_004965943.1| PREDICTED: phospholipase D alpha 2-like [Setaria italica]
Length=818

 Score =   224 bits (571),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 137/196 (70%), Gaps = 7/196 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA LLLHG+L   + E D +      T G   +F K VEG E  +G  + A+RLYAT+D+
Sbjct  1    MAHLLLHGTLDATILEADHLTNPTRATGGAPGIFRKFVEGFEDSLGLGQGATRLYATVDI  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++  +  NPRWYE+FHIYCAH AS+VVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVIAGDPVNPRWYEAFHIYCAHFASDVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE-RCWGRGVKAARFPGVPYTFFP  555
            LGG E+D WL +LD  R  +    KI V+L+F DV  + R WGRGV  AR PGVPYTFF 
Sbjct  121  LGGHEIDRWLDVLDAARKRLPHGPKIRVRLRFQDVAADPRGWGRGVGGARCPGVPYTFFS  180

Query  556  QRRGCKVTLYQDAHVP  603
            QR GC+VTLYQDAHVP
Sbjct  181  QRPGCRVTLYQDAHVP  196



>emb|CAN76339.1| hypothetical protein VITISV_014670 [Vitis vinifera]
Length=801

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 132/190 (69%), Gaps = 19/190 (10%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M Q L+HG+LH  +YEVD + T G  N   KI                 Y TIDLEKA V
Sbjct  1    MEQSLVHGTLHATIYEVDGLSTGGPWNFIQKI-----------------YVTIDLEKAGV  43

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRT  LD E  NPRWY+SFHIYCAH AS+VVFSVK DNPIGA +IGRA++P   LL GE 
Sbjct  44   GRTSKLDNEDSNPRWYQSFHIYCAHKASHVVFSVKQDNPIGATVIGRAHLPVGELLEGE-  102

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD WL L  +D  PI+  SK+HVKLQF+DV RE  W RG+++ +FPGVPYTFFPQR+GC+
Sbjct  103  VDRWLELFHHDHTPINGGSKLHVKLQFVDVTREFNWSRGIRSPKFPGVPYTFFPQRKGCR  162

Query  574  VTLYQDAHVP  603
            V LYQDAHVP
Sbjct  163  VLLYQDAHVP  172



>gb|KJB68102.1| hypothetical protein B456_010G225600 [Gossypium raimondii]
Length=805

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 139/189 (74%), Gaps = 4/189 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA+  LHG+LHV +YEV+K++  G    F K++   E  +G  K + +LYATIDLEKARV
Sbjct  1    MARTSLHGNLHVTIYEVNKLEGGGF---FRKLMANVEESIGIGKGSGKLYATIDLEKARV  57

Query  217  GRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEV  396
            GRTR + E  +P W ESFHIYCAHMA++V+F+VK    IGA +IGRAY+P   +L GEEV
Sbjct  58   GRTRKV-ESDDPSWNESFHIYCAHMANDVIFTVKQAGSIGANVIGRAYLPVEDILSGEEV  116

Query  397  DEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKV  576
            D W+ L D ++  + + +KIHVK+++ DV ++R W RG+ + +FPGVPYT++PQR GCKV
Sbjct  117  DRWIELKDEEKQNLENEAKIHVKIRYFDVTKDRNWNRGIVSRKFPGVPYTYYPQRHGCKV  176

Query  577  TLYQDAHVP  603
             LYQD+H+P
Sbjct  177  FLYQDSHIP  185



>gb|KJB70612.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70613.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
 gb|KJB70615.1| hypothetical protein B456_011G083000 [Gossypium raimondii]
Length=795

 Score =   221 bits (564),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 126/160 (79%), Gaps = 1/160 (1%)
 Frame = +1

Query  127  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNV  303
            ++V   +  +G  K   ++YATIDLE+ARVGRTR ++ E  NPRW+ESFHIYCAH ASNV
Sbjct  18   QLVANVQETIGIGKGVPKIYATIDLERARVGRTRTIENETSNPRWFESFHIYCAHNASNV  77

Query  304  VFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV  483
            VF+VK DNPIGA LIGRAY+P + L  G+EVD W+ +LD D+NPI S  KIHVKLQ+  V
Sbjct  78   VFTVKDDNPIGATLIGRAYVPVKDLTEGDEVDRWVEILDEDKNPIKSGGKIHVKLQYFGV  137

Query  484  VRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
             ++R W RG+ + +FPGVPYTF+PQR+GCKV+LYQDAH+P
Sbjct  138  TKDRNWDRGIVSRKFPGVPYTFYPQRKGCKVSLYQDAHIP  177



>dbj|BAA19466.1| phospholipase D [Oryza sativa Japonica Group]
Length=818

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 134/196 (68%), Gaps = 7/196 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA LLLHG+L   + E D +      T     +F K VEG E  +G  K A+RLYATIDL
Sbjct  1    MAHLLLHGTLEATILEADHLSNPTRATGAAPGIFRKFVEGFEDSLGLGKGATRLYATIDL  60

Query  202  EKARVGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++D+   NPRWYE FHIYCAH A++VVFSVK   PIGA LI RAY+P R L
Sbjct  61   GRARVGRTRVVDDEPVNPRWYEVFHIYCAHFAADVVFSVKAAQPIGATLIDRAYLPVREL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRER-CWGRGVKAARFPGVPYTFFP  555
            L GE ++  L +LD  R  I     IHV+LQF DV  +R  WGRGV  AR+PGVPYTFF 
Sbjct  121  LCGEAIERRLDILDAGRRRISHGPTIHVRLQFRDVAGDRHGWGRGVSGARYPGVPYTFFS  180

Query  556  QRRGCKVTLYQDAHVP  603
            QR GC+VTLYQDAHVP
Sbjct  181  QRPGCRVTLYQDAHVP  196



>ref|XP_009787006.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Nicotiana 
sylvestris]
Length=762

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = +1

Query  181  LYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  357
            +YAT+DLEKARVGRTR+++ E  NPRW ESFHIYCAHMASNV+F+VK +N IGA LIGRA
Sbjct  1    MYATVDLEKARVGRTRVIENEPSNPRWNESFHIYCAHMASNVIFTVKDNNSIGATLIGRA  60

Query  358  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGV  537
            Y+P   LL GEEVDEW+ +LD D+NPI   SKIHV LQF D+ R+R WGRG+ + ++PGV
Sbjct  61   YLPVNELLEGEEVDEWIEILDEDKNPIKEGSKIHVTLQFFDISRDRNWGRGIGSPKYPGV  120

Query  538  PYTFFPQRRGCKVTLYQDAHVP  603
            PYTFFPQR GC+V+LYQDAH+P
Sbjct  121  PYTFFPQRSGCRVSLYQDAHIP  142



>gb|EYU32345.1| hypothetical protein MIMGU_mgv1a001383mg [Erythranthe guttata]
Length=828

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 137/207 (66%), Gaps = 24/207 (12%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI------------------KTDGLHNLFHKIVEGAERVVGF  162
            MA  LLHG+LH  +YE D++                  +T    + F + V     VVG 
Sbjct  1    MAPRLLHGTLHATIYEADRLQGRFNFDLCGGTAGNPQKRTKRFLSQFKRYVLCRPEVVG-  59

Query  163  NKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  339
                SR+YATIDLE+ARVGRTR+++ E  NPRWYE+FHIYCAH  SN+VF+VK DNPIGA
Sbjct  60   ----SRVYATIDLERARVGRTRMIENEPSNPRWYENFHIYCAHTVSNIVFTVKDDNPIGA  115

Query  340  ELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKA  519
             LIGRAY+P   L+ G  VD W+ ++D DRNPIH  SKIHVKLQ+  V +E  W +G+K 
Sbjct  116  ILIGRAYLPVEDLISGRAVDRWIEIVDEDRNPIHGGSKIHVKLQYFHVFQESNWSQGIKT  175

Query  520  ARFPGVPYTFFPQRRGCKVTLYQDAHV  600
              F GVPYTFF QR+GCKV+LY DAHV
Sbjct  176  PSFGGVPYTFFRQRQGCKVSLYPDAHV  202



>gb|EMT24153.1| Phospholipase D alpha 1 [Aegilops tauschii]
Length=906

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = +1

Query  130  IVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVV  306
            +VEG E  VG  K AS+LYAT+ L KAR+GRTR L DE   PRW+ESFHIYCAH+A++V+
Sbjct  4    LVEGIEDTVGVGKGASKLYATVGLGKARIGRTRTLNDESSTPRWFESFHIYCAHLATDVL  63

Query  307  FSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  486
            F++K  + IGA ++G  Y+P R + GG+EV+ WLPL D+ RNP+    KIHVKLQ+ D+ 
Sbjct  64   FTIKGSSTIGASVVGTGYLPVRDIYGGDEVERWLPLCDDSRNPVEGGGKIHVKLQYFDIS  123

Query  487  RERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
            ++R WGRG+++ + PGVPYTFF QR+GCKVTLYQDAH+P
Sbjct  124  KDRAWGRGIRSGKNPGVPYTFFSQRQGCKVTLYQDAHIP  162



>emb|CBI36314.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 131/178 (74%), Gaps = 4/178 (2%)
 Frame = +1

Query  28   LSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEK  207
            +SE  ++ LHG+LH  ++E+D++ + G    F K+VE  E  VGF K  S+LYATID+ +
Sbjct  1    MSEFNEIPLHGTLHATIFEIDRLHSGGAPKFFRKLVENIEETVGFGKGTSKLYATIDIGR  60

Query  208  ARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            ARVGRTR+++ E  NPRWYESFHIYCAHMA +++F+VK DNPIGA LIGRA +P + +LG
Sbjct  61   ARVGRTRMIENEPSNPRWYESFHIYCAHMAGHIIFTVKDDNPIGATLIGRASVPIQEILG  120

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            GEEVD+W+ +++ +  PIH  SKIHVKLQ+ +V  +R WGRG++ A    VP  F P+
Sbjct  121  GEEVDKWVEIVNEELKPIHGGSKIHVKLQYFEVTADRSWGRGIRNAH---VPDNFVPK  175



>gb|KDP32412.1| hypothetical protein JCGZ_13337 [Jatropha curcas]
Length=810

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 136/188 (72%), Gaps = 3/188 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            MA +LLHG LHV ++E+D++      N F KIVE  E  V   K+ S++YATI+LE+AR+
Sbjct  1    MASVLLHGILHVTIFEIDRLSGSSCCNFFCKIVEKCEGTVACGKSISKIYATIELEEARI  60

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR L     NP+W+ESFHIYCAHMASNV FS+K+ +PIG+++IGRA +PA ++L GE 
Sbjct  61   GRTRELKHASSNPQWHESFHIYCAHMASNVTFSIKIKDPIGSQVIGRASLPAMQVLNGEA  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            ++ WL +L+    P+   SKIHVKLQF DV +   W +G+ +    GVP+TFFPQR GC+
Sbjct  121  LNTWLRILNKKNKPL--RSKIHVKLQFFDVSKGSNWSKGITSPNVLGVPHTFFPQRNGCR  178

Query  574  VTLYQDAH  597
            VTLYQD+H
Sbjct  179  VTLYQDSH  186



>ref|XP_004287315.1| PREDICTED: phospholipase D alpha 1-like [Fragaria vesca subsp. 
vesca]
Length=809

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 135/192 (70%), Gaps = 7/192 (4%)
 Frame = +1

Query  37   MAQ-LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MAQ +LLHG LH  ++EVD +K  G    F K+ E +   VG  K   R YATIDLE AR
Sbjct  1    MAQTVLLHGVLHATIFEVDSLKAGGCCTFFCKLFEES---VGLGK-GCRPYATIDLENAR  56

Query  214  VGRTRLLDEHK-NPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTRLL+E   NP+W E+FHIYCAHMASNVVFS+K  NPIGA +IG AY+PA  L  GE
Sbjct  57   VGRTRLLEETTTNPQWNEAFHIYCAHMASNVVFSIKEYNPIGANVIGEAYLPAAELFNGE  116

Query  391  EVDEWLPL-LDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRG  567
            EVD WL + + +   P+H  SKI VKL+F  V     W  G+K+ ++PGVPYTFFPQR G
Sbjct  117  EVDRWLKITMHHHGRPLHGGSKIRVKLRFYPVTGNCNWSHGIKSPKYPGVPYTFFPQRNG  176

Query  568  CKVTLYQDAHVP  603
            C+VTLYQDAHVP
Sbjct  177  CRVTLYQDAHVP  188



>ref|XP_003563661.1| PREDICTED: phospholipase D alpha 2-like [Brachypodium distachyon]
Length=823

 Score =   216 bits (551),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 136/200 (68%), Gaps = 11/200 (6%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA  LLHG+LH  + E DK+      T G   +F K VEG E  +G  K ++RLYATIDL
Sbjct  1    MAHRLLHGTLHATILEADKLTDPTRATGGAPGIFRKFVEGFEETIGRGKGSTRLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++ D+  NPRWYE FHIYCAH A++VVF+VK D PIGA L+GRAY+P R L
Sbjct  61   GRARVGRTRVIADDPVNPRWYEEFHIYCAHFAADVVFTVKADQPIGATLLGRAYLPVRDL  120

Query  379  L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVR---ERCWGRGVKAARFPGVPY  543
            L   G+E++  L +LD  +  +     IHV+L+F DV      R WGRG+   RFPGVPY
Sbjct  121  LDAAGKEIERRLDVLDPGKKKLPHGPTIHVRLRFCDVAAAEGRREWGRGIGGLRFPGVPY  180

Query  544  TFFPQRRGCKVTLYQDAHVP  603
            TFF QR GCKVTLYQDAH P
Sbjct  181  TFFSQRPGCKVTLYQDAHTP  200



>emb|CBI28204.3| unnamed protein product [Vitis vinifera]
Length=703

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 132/181 (73%), Gaps = 5/181 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEG-AERVVGFNKTASRLYATIDLEKAR  213
            M Q L+HG+LH  +YEVD + T G  N   K+    ++R+VG     S++Y TIDLEKA 
Sbjct  2    MEQSLVHGTLHATIYEVDGLSTGGPWNFIQKVYTTLSKRIVG--APISKIYVTIDLEKAG  59

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRT  LD E  NPRWY+SFHIYCAH AS+VVFSVK DNPIGA +IGRA++P   LL GE
Sbjct  60   VGRTSKLDNEDSNPRWYQSFHIYCAHKASHVVFSVKQDNPIGATVIGRAHLPVGELLEGE  119

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
             VD WL L  +D  PI+  SK+HVKLQF+DV RE  W RG+++ +FPGVPYTFFPQR+GC
Sbjct  120  -VDRWLELFHHDHTPINGGSKLHVKLQFVDVTREFNWSRGIRSPKFPGVPYTFFPQRKGC  178

Query  571  K  573
            +
Sbjct  179  R  179



>dbj|BAJ93878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=783

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +1

Query  124  HKIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASN  300
             ++VEG E  VG  K AS+LYAT+ L KAR+GRTR L DE   PRW+ESFHIYCAH+AS+
Sbjct  3    QQLVEGIEDTVGVGKGASKLYATVGLGKARIGRTRTLNDESSTPRWFESFHIYCAHLASD  62

Query  301  VVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLD  480
            V+F++K  + IGA ++G  Y+P R + GG+EV+ WLPL D+ RNP+    KIHVKLQ+ D
Sbjct  63   VLFTIKGKSTIGAVVVGTGYLPVRDIYGGDEVERWLPLCDDSRNPVEGGGKIHVKLQYFD  122

Query  481  VVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
            + ++R WG G+++ + PGVPYTFF QR+GCKVTLYQDAH+P
Sbjct  123  ISKDRGWGHGIRSGKHPGVPYTFFSQRQGCKVTLYQDAHIP  163



>emb|CBI28205.3| unnamed protein product [Vitis vinifera]
Length=604

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 128/180 (71%), Gaps = 7/180 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M Q+LLHG+LH  +YEVD++ + G  N   K+    ER       +S++Y TIDL+KARV
Sbjct  1    MEQILLHGTLHGTIYEVDRLSSGGPWNFIDKLKRRIERA-----GSSKVYVTIDLDKARV  55

Query  217  GRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
            GRTR L+ E  NP W E FHIYCAH AS+VVFSVK +NPIGA +IGRA +P   LL GE 
Sbjct  56   GRTRKLENEETNPHWSECFHIYCAHKASHVVFSVKQENPIGATVIGRAQLPVEELLEGE-  114

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD WL L  +DR PIH  SK+HVKLQF DV RE  W RG+ + +FPGVPYTFFPQR+GC+
Sbjct  115  VDRWLELFHHDRTPIHGGSKLHVKLQFFDVTRECNWSRGITSPKFPGVPYTFFPQRKGCR  174



>ref|XP_010090252.1| Phospholipase D alpha 1 [Morus notabilis]
 gb|EXB39153.1| Phospholipase D alpha 1 [Morus notabilis]
Length=788

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 134/191 (70%), Gaps = 22/191 (12%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR-  213
            MAQ+LLHG LH                    ++E  E +VGF K  S+LYATIDLE +R 
Sbjct  1    MAQVLLHGVLH--------------------LIEKFEEIVGFRKGTSKLYATIDLENSRS  40

Query  214  VGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VG TR+L+ +  NPRWYESF IYCAH ASNVVF++K D PIGAE+I RAY+P   LL G+
Sbjct  41   VGSTRVLECKTWNPRWYESFDIYCAHKASNVVFTIKQDKPIGAEVIARAYLPVDELLSGK  100

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD+WL L+D+   P+H  SKIHV+++F DV ++  W +G+ + +FPGVPYTFFPQR  C
Sbjct  101  EVDQWLHLMDHKHKPLHHGSKIHVRVRFCDVSKDINWSKGIGSPKFPGVPYTFFPQRNDC  160

Query  571  KVTLYQDAHVP  603
            +VTLYQDAHVP
Sbjct  161  RVTLYQDAHVP  171



>ref|NP_001146242.1| uncharacterized protein LOC100279815 [Zea mays]
 gb|ACL53544.1| unknown [Zea mays]
 gb|AFW87188.1| phospholipase D family protein [Zea mays]
Length=816

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 135/196 (69%), Gaps = 7/196 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA LLLHG+L   + E D +      T G   +F K VEG E  +G  + ++RLYAT+DL
Sbjct  1    MAHLLLHGTLDATILEADHLTNPTRATGGAPGIFRKFVEGFEDSLGLGQGSTRLYATVDL  60

Query  202  EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++  +  NPRWYE FHIYCAH AS+VVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVITGDPVNPRWYEVFHIYCAHFASDVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE-RCWGRGVKAARFPGVPYTFFP  555
            + G+E++  L +LD  +  +    KI V+L+F DV  + R WGRGV  AR+PGVPYTFF 
Sbjct  121  IAGQEIERSLDILDASKKRLPHGPKIRVRLRFQDVSADPRGWGRGVGGARYPGVPYTFFS  180

Query  556  QRRGCKVTLYQDAHVP  603
            QR GC+VTLYQDAH P
Sbjct  181  QRPGCRVTLYQDAHTP  196



>ref|XP_008385550.1| PREDICTED: phospholipase D alpha 1-like [Malus domestica]
Length=809

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 133/187 (71%), Gaps = 5/187 (3%)
 Frame = +1

Query  46   LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRT  225
            +LLHG LH  +YEVD++   G    F K +     +VG  K  S LYATIDLE  RVGRT
Sbjct  6    VLLHGVLHATIYEVDRLMPGGCCIFFCKFLG---ELVGLGK-GSXLYATIDLENVRVGRT  61

Query  226  RLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDE  402
            RLL+   KNP+W ESFHIYCAHM SNVVFS+K D   GA++IGRAYMPA  LL G+EVD 
Sbjct  62   RLLENSTKNPQWGESFHIYCAHMTSNVVFSIKEDKAFGAKVIGRAYMPAAELLDGKEVDR  121

Query  403  WLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTL  582
            WL ++ ++  P+H  SKIHVKLQF +V ++  W  G+++  F GVPYTFF Q+ GC+VTL
Sbjct  122  WLKIMYDNNKPLHIRSKIHVKLQFFNVNQDLNWSCGIRSPEFQGVPYTFFTQKNGCRVTL  181

Query  583  YQDAHVP  603
            YQ+AHVP
Sbjct  182  YQNAHVP  188



>ref|XP_009364028.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=807

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 134/187 (72%), Gaps = 7/187 (4%)
 Frame = +1

Query  46   LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRT  225
            +LLHG LH  +YEVD++   G    F K +  +   VG  K  SRLYATIDLE  RVGRT
Sbjct  6    VLLHGVLHATIYEVDRLMPGGCCIFFCKFLGES---VGLRK-GSRLYATIDLENVRVGRT  61

Query  226  RLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDE  402
            RLL+   KNP+W ESFHIYCAHM SNVVFS+K D   GA++IGRAYMPA  LL G+EVD 
Sbjct  62   RLLENSTKNPQWRESFHIYCAHMTSNVVFSIKEDKAFGAKVIGRAYMPAAELLNGKEVDR  121

Query  403  WLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTL  582
            WL ++ ++  P+  HSKIHVKLQF +V ++  W  G+++  F GVPYTFF QR GC+VTL
Sbjct  122  WLTIMYHNNKPL--HSKIHVKLQFFNVNQDLNWSCGIRSPEFQGVPYTFFTQRNGCRVTL  179

Query  583  YQDAHVP  603
            YQ+AHVP
Sbjct  180  YQNAHVP  186



>ref|XP_009368855.1| PREDICTED: phospholipase D alpha 1-like [Pyrus x bretschneideri]
Length=808

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 134/187 (72%), Gaps = 6/187 (3%)
 Frame = +1

Query  46   LLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRT  225
            +LLHG LH  +YEVD++   G    F K +  +   VGF K  SRLYATIDLE  RVGRT
Sbjct  6    VLLHGVLHATIYEVDRLMAGGCCIFFCKFLGES---VGFGK-GSRLYATIDLENVRVGRT  61

Query  226  RLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDE  402
            RLL+   KNP W ESFHIYCAHM SNVVFS+K DN  G ++IGRA+MPA  LL  E +D 
Sbjct  62   RLLENSTKNPLWCESFHIYCAHMTSNVVFSIKEDNAFGTKVIGRAHMPAAELLNSEVIDR  121

Query  403  WLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTL  582
            W+ ++ +++ P+H  SKIHVKL+F +V +E  W RG+++  F GVPYTFF QR GC+VTL
Sbjct  122  WVRIIYHNK-PLHGRSKIHVKLRFFNVNQESNWSRGIRSPEFQGVPYTFFTQRNGCRVTL  180

Query  583  YQDAHVP  603
            YQDAHVP
Sbjct  181  YQDAHVP  187



>gb|AAC49274.1| phospholipase D [Arabidopsis thaliana]
Length=809

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 132/191 (69%), Gaps = 3/191 (2%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDG-LHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            MA  LLHG+LH  +YEVD +   G +     KI+   E  +G  K  +RLYATIDL+KAR
Sbjct  1    MAHDLLHGTLHATIYEVDALHGGGVMQGFLGKILANVEETIGVGKGETRLYATIDLQKAR  60

Query  214  VGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            VGRTR + +E KNP+WYESF +             K D PIGA LIGRAY+P  +++ GE
Sbjct  61   VGRTRKIKNEPKNPKWYESFQVSVVTWLLISSSLSKDDIPIGATLIGRAYIPVDQVINGE  120

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
             VD+W+ +LDNDRNPI   SKIHVKLQ+  V  +R W  G+K+A+FPGVPYTFF QR+GC
Sbjct  121  -VDQWVEILDNDRNPIQGGSKIHVKLQYFHVEEDRNWNMGIKSAKFPGVPYTFFSQRQGC  179

Query  571  KVTLYQDAHVP  603
            KV+LYQDAH+P
Sbjct  180  KVSLYQDAHIP  190



>dbj|BAJ85695.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96017.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87850.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=820

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 134/198 (68%), Gaps = 9/198 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA  LLHG+LH  + E D +      T G   +F + VEG E  +G  K +++LYAT+DL
Sbjct  1    MAHRLLHGTLHATILEADNLTNPDRATGGAPQIFRRFVEGFEETIGRGKGSTQLYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             KARVGRTR++  +  NPRWYE FHIYCAH A++VVF+VK   PIGA LIGRAY+P R L
Sbjct  61   GKARVGRTRVIAGDPVNPRWYEEFHIYCAHFAADVVFTVKAAQPIGATLIGRAYLPVRDL  120

Query  379  L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV-VRERCWGRGVKAARFPGVPYTF  549
            L  GG+E++  L +LD  +  IH    IHV+L+F DV    R WG G+  AR PGVPYTF
Sbjct  121  LDAGGQEIERRLDVLDPSKKKIHHGPTIHVRLRFCDVAANRREWGAGLGGARHPGVPYTF  180

Query  550  FPQRRGCKVTLYQDAHVP  603
            F QR GC+VTLYQDAH P
Sbjct  181  FSQRPGCRVTLYQDAHTP  198



>dbj|BAJ94103.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=820

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 134/198 (68%), Gaps = 9/198 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA  LLHG+LH  + E D +      T G   +F + VEG E  +G  K +++LYAT+DL
Sbjct  1    MAHRLLHGTLHATILEADNLTNPDRATGGAPQIFRRFVEGFEETIGRGKGSTQLYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             KARVGRTR++  +  NPRWYE FHIYCAH A++VVF+VK   PIGA LIGRAY+P R L
Sbjct  61   GKARVGRTRVIAGDPVNPRWYEEFHIYCAHFAADVVFTVKAAQPIGATLIGRAYLPVRDL  120

Query  379  L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDV-VRERCWGRGVKAARFPGVPYTF  549
            L  GG+E++  L +LD  +  IH    IHV+L+F DV    R WG G+  AR PGVPYTF
Sbjct  121  LDAGGQEIERRLDVLDPSKKKIHHGPTIHVRLRFCDVAANRREWGAGLGGARHPGVPYTF  180

Query  550  FPQRRGCKVTLYQDAHVP  603
            F QR GC+VTLYQDAH P
Sbjct  181  FSQRPGCRVTLYQDAHTP  198



>gb|EMT32202.1| Phospholipase D alpha 2 [Aegilops tauschii]
Length=820

 Score =   211 bits (537),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 133/198 (67%), Gaps = 9/198 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA  LLHG+LH  + E D +      T G   +F + VEG E  +G  K +++LYAT+DL
Sbjct  1    MAHRLLHGTLHATILEADNLTNPDRATGGAPQIFRRFVEGFEETIGRGKGSTQLYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             KARVGRTR++  +  NPRWYE FHIYCAH A++VVF+VK   PIGA LIGRAY+P R L
Sbjct  61   GKARVGRTRVIAGDPVNPRWYEDFHIYCAHFAADVVFTVKAAQPIGATLIGRAYLPVREL  120

Query  379  L--GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV-RERCWGRGVKAARFPGVPYTF  549
            L  GG E++  L +LD  +  IH    IHV+L+F DV    R WG G+  AR PGVPYTF
Sbjct  121  LDAGGREIERRLDVLDPSKKKIHHGPTIHVRLRFCDVTANRREWGAGLGGARHPGVPYTF  180

Query  550  FPQRRGCKVTLYQDAHVP  603
            F QR GC+VTLYQDAH P
Sbjct  181  FSQRPGCRVTLYQDAHTP  198



>ref|XP_007013459.1| Phospholipase D alpha 1 [Theobroma cacao]
 gb|EOY31078.1| Phospholipase D alpha 1 [Theobroma cacao]
Length=806

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = +1

Query  130  IVEGAERVVGFNKTASRLYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVV  306
            +V+  E  VG  K  S+LY TIDLE+ RVGR+RLL+ E  N +W+ESFHIYCAH ASNVV
Sbjct  30   LVQNIEESVGVGKAFSKLYVTIDLEETRVGRSRLLENEGSNLQWHESFHIYCAHKASNVV  89

Query  307  FSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVV  486
            FS+K ++PIGA LIGRAY+P   LL GEEVD WL ++D +  P+   S+IHVKLQF D  
Sbjct  90   FSIKENDPIGASLIGRAYLPVEELLNGEEVDRWLKVVDKEYKPLCRGSRIHVKLQFFDTT  149

Query  487  RERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
            R   W +G+K+ +FPGVPYTFF QR GC+VTLYQDAHVP
Sbjct  150  RHPNWSQGIKSPKFPGVPYTFFSQREGCRVTLYQDAHVP  188



>gb|KDO48581.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
Length=610

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  229  LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWL  408
            L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEEVD+W+
Sbjct  2    LKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEEVDKWV  61

Query  409  PLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQ  588
             +LD DRNPI S SKIHVKLQ+ DV ++R W RG+++A++PGVP+TF+PQR+GCKV+LYQ
Sbjct  62   EILDEDRNPISSGSKIHVKLQYFDVTKDRSWARGIRSAKYPGVPFTFYPQRKGCKVSLYQ  121

Query  589  DAHVP  603
            DAHVP
Sbjct  122  DAHVP  126



>ref|XP_002515518.1| phopholipase d alpha, putative [Ricinus communis]
 gb|EEF46967.1| phopholipase d alpha, putative [Ricinus communis]
Length=817

 Score =   208 bits (529),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 137/198 (69%), Gaps = 15/198 (8%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTD----------GLHNLFHKIVEGAERVVGFNK--TASRLYAT  192
            LLHG+L V ++EVDK++T           G  N   + +   +RVV        + LYAT
Sbjct  4    LLHGTLSVTIFEVDKLQTGCGFNFFSRGPGQQNCGKRFLSQVKRVVLCRPEIVGTGLYAT  63

Query  193  IDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPA  369
            +DL+KARVGRTR L D+H NP+WYESFHIYCAH+ S+V+F++K D  +GA LIGRAY+P 
Sbjct  64   VDLDKARVGRTRKLEDQHYNPQWYESFHIYCAHLISHVIFTIKDDQFVGASLIGRAYIPV  123

Query  370  RRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTF  549
              ++ G  +D W+ +LD  RNPI   SKIHVKLQFL+V ++  W +G+K  R+ GVPY F
Sbjct  124  EDVITGYIIDRWVEILDEQRNPI--GSKIHVKLQFLNVTQDSSWSQGIKTPRYDGVPYAF  181

Query  550  FPQRRGCKVTLYQDAHVP  603
            F QR+GC+VTLYQDAHVP
Sbjct  182  FNQRQGCRVTLYQDAHVP  199



>gb|KDO48580.1| hypothetical protein CISIN_1g004579mg [Citrus sinensis]
Length=744

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  229  LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWL  408
            L  E  NPRWYESFHIYCAHMASN++F+VK DNPIGA LIGRAY+P   +LGGEEVD+W+
Sbjct  2    LKKEQSNPRWYESFHIYCAHMASNIIFTVKDDNPIGATLIGRAYVPVEEVLGGEEVDKWV  61

Query  409  PLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQ  588
             +LD DRNPI S SKIHVKLQ+ DV ++R W RG+++A++PGVP+TF+PQR+GCKV+LYQ
Sbjct  62   EILDEDRNPISSGSKIHVKLQYFDVTKDRSWARGIRSAKYPGVPFTFYPQRKGCKVSLYQ  121

Query  589  DAHVP  603
            DAHVP
Sbjct  122  DAHVP  126



>ref|XP_009407292.1| PREDICTED: phospholipase D alpha 1-like [Musa acuminata subsp. 
malaccensis]
Length=815

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 127/193 (66%), Gaps = 6/193 (3%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            M+Q LLHG LH  ++E   +      T        ++VE  E+ V F K  SR YATID+
Sbjct  1    MSQFLLHGVLHATIFEATSVSDRCRITRHAPKFVRELVEAVEKTVSFGKGWSRFYATIDI  60

Query  202  EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            E AR+GRTR++   H NPRW ESFHIYCAH A+NVVF+VK++ PIGA ++GRA +    L
Sbjct  61   EMARLGRTRVITGHHGNPRWNESFHIYCAHTAANVVFTVKLEEPIGARVVGRASLSTEEL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQ  558
            LG  EVD WL +LD DR P+     IHV L+F+    +  WGRGV + R+PGVP+TFF Q
Sbjct  121  LGCAEVDRWLEILDEDRRPLRGGPAIHVSLRFVAADMDPNWGRGVLSIRYPGVPHTFFSQ  180

Query  559  RRGCKVTLYQDAH  597
            R GC+VTLYQD H
Sbjct  181  RPGCRVTLYQDTH  193



>gb|KHN07080.1| Phospholipase D alpha 1 [Glycine soja]
Length=799

 Score =   202 bits (515),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 130/187 (70%), Gaps = 15/187 (8%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKT--DGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGR  222
            LLHG L V +YEVD + T  D   NL  K VE            + LYATIDL+KARVGR
Sbjct  4    LLHGRLDVIIYEVDTLPTLNDCNLNLCSKFVE------------TGLYATIDLDKARVGR  51

Query  223  TRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVD  399
            T+LL D+  NP W E+FH+YCAH+ S+V+F+VK  +PI A LIGRAY+P  +++ G  VD
Sbjct  52   TKLLNDQSSNPTWDETFHVYCAHLISHVIFTVKQKDPIDATLIGRAYVPVEQVVNGNIVD  111

Query  400  EWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVT  579
            EW+ +LD D NPI S SKIHVK+QF  V  +  W +G+++ RF GVP+TFF Q+ GCKVT
Sbjct  112  EWVQILDEDHNPIPSESKIHVKMQFSSVRNDINWSQGIRSPRFQGVPHTFFSQKNGCKVT  171

Query  580  LYQDAHV  600
            LYQDAHV
Sbjct  172  LYQDAHV  178



>ref|XP_011039694.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
 ref|XP_011039695.1| PREDICTED: phospholipase D alpha 1-like [Populus euphratica]
Length=820

 Score =   202 bits (514),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 136/202 (67%), Gaps = 13/202 (6%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKI---------KTDGLHNLFHKIVEGAERVVGF---NKTASR  180
            MA  LLHG+L V VY VD +         KT+G      + +   +R +     N   SR
Sbjct  1    MAPRLLHGTLDVTVYGVDNLQYGCGFSLLKTEGFLKFGKRCLVNVKRSMSCLPENVAGSR  60

Query  181  LYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  357
            LYAT+DL+KARV RTR++  E  NPRW ESFHIYCAH  S+VVF++K D+ IGA LIGRA
Sbjct  61   LYATVDLDKARVARTRMVGKEPYNPRWNESFHIYCAHSISHVVFTIKDDDAIGATLIGRA  120

Query  358  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGV  537
            Y+P   +  G+ ++ W+ ++D DR P+   S++H+KLQF DV ++R W +G+K+ ++ GV
Sbjct  121  YLPVEDIPNGKILERWVEIVDEDRKPVPGGSRVHIKLQFFDVNQDRYWSQGIKSPQYEGV  180

Query  538  PYTFFPQRRGCKVTLYQDAHVP  603
            PY FF QR+GC+VTLYQDAHVP
Sbjct  181  PYVFFNQRQGCRVTLYQDAHVP  202



>emb|CAN81667.1| hypothetical protein VITISV_017804 [Vitis vinifera]
Length=642

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +1

Query  181  LYATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  357
            +Y TIDL+KARVGRTR L+ E  NP W E FHIYCAH AS+VVFSVK +NPIGA +IGRA
Sbjct  40   VYVTIDLDKARVGRTRKLENEETNPHWSECFHIYCAHKASHVVFSVKQENPIGATVIGRA  99

Query  358  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGV  537
             +P   LL GE VD WL L  +DR PIH  SK+HVKLQF DV RE  W RG+ + +FPGV
Sbjct  100  QLPVEELLEGE-VDRWLELFHHDRTPIHGGSKLHVKLQFFDVTRECNWSRGITSXKFPGV  158

Query  538  PYTFFPQRRGCKVTLYQDAHVP  603
            PYTFFPQR+GC+V LYQDAH+P
Sbjct  159  PYTFFPQRKGCRVLLYQDAHIP  180



>ref|XP_011459180.1| PREDICTED: phospholipase D alpha 1-like [Fragaria vesca subsp. 
vesca]
Length=814

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 138/190 (73%), Gaps = 6/190 (3%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTD-GLHNLF---HKIVEGAERVV--GFNKTASRLYATIDLEKA  210
            LLHG+L+  +YE+DKI +  G+  L+    K V+  +R+V  G   + S++YAT+DL+KA
Sbjct  4    LLHGTLYATIYEIDKINSGCGIGLLWTSPKKFVDQVKRLVLCGPEISGSKIYATVDLDKA  63

Query  211  RVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            RV RTR+++  +NP W E FHIY AH  S+++F+VK ++PIGA LIGRAY+P   ++ G 
Sbjct  64   RVARTRMVNNPRNPIWKEDFHIYSAHNISHIIFTVKANDPIGATLIGRAYVPVEDIIKGY  123

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
             VD W+ +LD + NPIH +S+IHVKLQF  V+ +  W +G+++  + GVP+TFF QR+GC
Sbjct  124  VVDRWVEILDEEHNPIHGNSRIHVKLQFSSVIEDAHWSQGLRSPNYEGVPWTFFNQRQGC  183

Query  571  KVTLYQDAHV  600
            KVTLYQD+HV
Sbjct  184  KVTLYQDSHV  193



>ref|XP_008219493.1| PREDICTED: phospholipase D alpha 1-like [Prunus mume]
Length=806

 Score =   199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 136/197 (69%), Gaps = 17/197 (9%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTD-GLHNLFHK-----------IVEGAERVVGFNKTASRLYAT  192
            LLHG+L   +YEVD++    GLH L+             ++ G +++VG     S+LYAT
Sbjct  4    LLHGTLLATIYEVDRLYNGCGLHLLWKSPKIFVAQIKKLVLCGPKQIVG-----SKLYAT  58

Query  193  IDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPAR  372
            +DL+KARVGRTR++++  NP+W E FHIYCAH  S+++F+VK ++ IGA LIGRAY+P  
Sbjct  59   VDLDKARVGRTRMVNDPNNPKWREDFHIYCAHNISSLIFTVKSNDLIGATLIGRAYIPVE  118

Query  373  RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFF  552
             ++ G  VD WL + D D NPI+ +S+IHVKLQF  V  +  W  G+K+ ++ GVP+TFF
Sbjct  119  EIIKGYAVDRWLEIFDEDGNPIYGNSRIHVKLQFSSVKDDFHWSLGIKSPKYDGVPWTFF  178

Query  553  PQRRGCKVTLYQDAHVP  603
             QR GC+VTLYQD+HVP
Sbjct  179  NQREGCRVTLYQDSHVP  195



>ref|XP_006581357.1| PREDICTED: phospholipase D alpha 1-like [Glycine max]
Length=826

 Score =   197 bits (502),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 134/205 (65%), Gaps = 24/205 (12%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVG--------------------FNK  168
            LLHG L V +YEVD + T    NL +   +G  R VG                    F +
Sbjct  4    LLHGRLDVIIYEVDTLPTLNDCNL-NLCSKGTSRSVGKRFLSQLKSCFLCQCQCQPEFVE  62

Query  169  TASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAEL  345
            T   LYATIDL+KARVGRT+LL D+  NP W E+FH+YCAH+ S+V+F+VK  +PI A L
Sbjct  63   TG--LYATIDLDKARVGRTKLLNDQSSNPTWDETFHVYCAHLISHVIFTVKQKDPIDATL  120

Query  346  IGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAAR  525
            IGRAY+P  +++ G  VDEW+ +LD D NPI S SKIHVK+QF  V  +  W +G+++ R
Sbjct  121  IGRAYVPVEQVVNGNIVDEWVQILDEDHNPIPSESKIHVKMQFSSVRNDINWSQGIRSPR  180

Query  526  FPGVPYTFFPQRRGCKVTLYQDAHV  600
            F GVP+TFF Q+ GCKVTLYQDAHV
Sbjct  181  FQGVPHTFFSQKNGCKVTLYQDAHV  205



>ref|XP_009614730.1| PREDICTED: phospholipase D alpha 1 {ECO:0000250|UniProtKB:Q41142}-like 
[Nicotiana tomentosiformis]
Length=820

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 131/200 (66%), Gaps = 12/200 (6%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK---------TDGLHNLFHKIVEGAERV--VGFNKTASRL  183
            M   LLHG+LH  +YEVDKI+         T     +  + +   +++       + ++ 
Sbjct  1    MGPRLLHGTLHATIYEVDKIRGGCGDCCGPTASPQKVSRRFLNNVKKLFFCAPEISGTKF  60

Query  184  YATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAY  360
            YATIDL+KARVGRTR+  ++  NPRWYE+F IYCAH  SN++F++K +NPI A LIGRAY
Sbjct  61   YATIDLDKARVGRTRIFGNDPSNPRWYETFRIYCAHEISNIIFTIKDENPISATLIGRAY  120

Query  361  MPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVP  540
            +P   +L    VD W+P+LD D  PI   SKIHV+LQF +V ++  W RG+ +A F GVP
Sbjct  121  LPVEEVLNRYVVDRWVPILDEDGYPISGRSKIHVRLQFFNVKQDSNWSRGISSAAFGGVP  180

Query  541  YTFFPQRRGCKVTLYQDAHV  600
            YTFF +R+GC+VTLY DA +
Sbjct  181  YTFFKERQGCQVTLYPDADI  200



>ref|XP_010923204.1| PREDICTED: phospholipase D alpha 1-like [Elaeis guineensis]
Length=859

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 140/225 (62%), Gaps = 36/225 (16%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYE-----------------VDKIKTDGLHNLFH-------------  126
            MAQ LLHG+L V ++E                 + K  T     L               
Sbjct  1    MAQYLLHGTLQVTIFEATSLSNSNAISVSAPKPIQKAPTTSKRRLMRRLSWIKRVSFCRP  60

Query  127  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTR-LLDEHKNPRWYESFHIYCAHMASNV  303
            K+VE  E  VGF K +++LYATIDLE+ARVGRTR +++E  NPRWYESFHIYCAH  +N+
Sbjct  61   KLVEEIEDTVGFGKGSAKLYATIDLERARVGRTRVIMNEPNNPRWYESFHIYCAHWTANI  120

Query  304  VFSVKVDNPIGAELIGRAYMPARRLLGGEE---VDEWLPLLDNDRNPIHSHSKIHVKLQF  474
            +F++K DNP+GA LIGRAY+P + +L       VD WL +   D + +   ++IHV+L +
Sbjct  121  IFTIKADNPVGASLIGRAYLPVKDILNNNNSGAVDRWLNIYREDCSQVGGGAQIHVRLWY  180

Query  475  LDVVRER--CWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
            LDV ++    WG+G+ + ++ GVP+TFFPQR+ CK+TLYQDAHVP
Sbjct  181  LDVSKDPYLGWGQGIASLQYLGVPHTFFPQRQDCKLTLYQDAHVP  225



>ref|XP_008777837.1| PREDICTED: phospholipase D alpha 1-like [Phoenix dactylifera]
Length=859

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 135/225 (60%), Gaps = 36/225 (16%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLF------------------------------H  126
            MAQ LLHG+L   ++E   +      ++                                
Sbjct  1    MAQYLLHGTLQATIFEATSLSNSNTMSMSAPKRIQKAPTTSKRRLLRRLSWIKRVSFCGR  60

Query  127  KIVEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNV  303
            K+    E  VG     ++LYAT+DLEKARVGRTR++ +E  NPRWYESF IYCAH A++V
Sbjct  61   KLAGDIEESVGLGIGPAKLYATVDLEKARVGRTRVITNEPNNPRWYESFRIYCAHWAADV  120

Query  304  VFSVKVDNPIGAELIGRAYMPARRLL---GGEEVDEWLPLLDNDRNPIHSHSKIHVKLQF  474
            +F+VK DNP+GA LIGRAY+P   +L     E VD WL +   D + +   ++IHV+L +
Sbjct  121  IFTVKADNPVGASLIGRAYLPVMDILENNNSEAVDRWLDIYREDGSQVGGGAQIHVRLWY  180

Query  475  LDVVRE--RCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
             DV R+  + WGRG+ + R+PGVP+TFFPQR+GCKVTLYQDAHVP
Sbjct  181  WDVSRDPYQGWGRGIASPRYPGVPHTFFPQRQGCKVTLYQDAHVP  225



>emb|CDP13510.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   196 bits (499),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 130/203 (64%), Gaps = 14/203 (7%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKI---VEGAERVVGFNKTA---------SR  180
            MA  LLHG+L   ++E+D+++T    N   K     + A R     K A         SR
Sbjct  1    MASKLLHGTLQATIFEIDRLQTGWGFNFCGKTGGPAKMARRFFARLKRAVLCRPEIVGSR  60

Query  181  LYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  357
            LYATIDLE+ARVGRTR++++   NPRWYE F IYCAHM SNV+F+VK DN +GA LIGRA
Sbjct  61   LYATIDLERARVGRTRMIEKQLSNPRWYEGFRIYCAHMVSNVIFTVKDDNAVGATLIGRA  120

Query  358  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAA-RFPG  534
            Y+P   ++ G  VD WL +LD D  PI    KIHVKLQF  V  +  W +G+  +  F G
Sbjct  121  YLPVEEIISGFVVDRWLQILDEDGIPIQGGPKIHVKLQFFSVNHDPNWSQGIGGSLAFKG  180

Query  535  VPYTFFPQRRGCKVTLYQDAHVP  603
            VP TFF +R+GC VTLYQDAH+P
Sbjct  181  VPRTFFKERQGCHVTLYQDAHMP  203



>gb|EMS46811.1| Phospholipase D alpha 2 [Triticum urartu]
Length=684

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 134/229 (59%), Gaps = 40/229 (17%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKI-----------------------  132
            MA  LLHG+LH  + E D +      T G   +F ++                       
Sbjct  1    MAHRLLHGTLHATILEADDLTNPDRATGGAPQIFRRVSHSPSFPASTCCNHGRVKLVGLV  60

Query  133  --------VEGAERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCA  285
                    VEG E  +G  K +++LYAT+DL KARVGRTR++  +  NPRWYE FHIYCA
Sbjct  61   RNLVWLQFVEGFEETIGRGKGSTQLYATVDLGKARVGRTRVIAGDPVNPRWYEDFHIYCA  120

Query  286  HMASNVVFSVKVDNPIGAELIGRAYMPARRLL--GGEEVDEWLPLLDNDRNPIHSHSKIH  459
            H A++VVF+VK   PIGA LIGRAY+P R LL  GG E++  L +LD  +  IH    IH
Sbjct  121  HFAADVVFTVKAAQPIGATLIGRAYLPVRELLDAGGREIERRLDVLDPSKKKIHHGPTIH  180

Query  460  VKLQFLDV-VRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
            V+L+F DV    R WG G+  AR PGVPYTFF QR GC+VTLYQDAH P
Sbjct  181  VRLRFCDVAANPREWGAGLGGARHPGVPYTFFSQRPGCRVTLYQDAHTP  229



>emb|CDP13512.1| unnamed protein product [Coffea canephora]
Length=825

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 128/203 (63%), Gaps = 14/203 (7%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGF------------NKTASR  180
            MA  LLHG+L   ++E+D+++T    N   K     +   GF                SR
Sbjct  1    MASKLLHGTLQATIFEIDRLRTGWGFNFCGKTGGPEKMARGFCARVKRAVFCRPEIVGSR  60

Query  181  LYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  357
            LYATIDLE+ARVGRTR++++   NPRWYE F IYCAHM SNV+F+VK DN +GA LIGRA
Sbjct  61   LYATIDLERARVGRTRMIEKQLSNPRWYEGFRIYCAHMVSNVIFTVKDDNAVGATLIGRA  120

Query  358  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAA-RFPG  534
            Y+P   ++ G  VD WL +LD D  PI    KIHVKLQF  V ++  W +G+  +    G
Sbjct  121  YLPVEEIINGFIVDRWLQILDEDGIPIQGGPKIHVKLQFFSVNQDPNWSQGIGGSLAVKG  180

Query  535  VPYTFFPQRRGCKVTLYQDAHVP  603
            VP TFF +R+GC VTLYQDAH+P
Sbjct  181  VPRTFFKERQGCHVTLYQDAHMP  203



>ref|XP_006350007.1| PREDICTED: phospholipase D alpha 1-like [Solanum tuberosum]
Length=819

 Score =   195 bits (495),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 132/199 (66%), Gaps = 11/199 (6%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKT--------DGLHNLFHKIVEGAERV--VGFNKTASRLY  186
            M   LLHG+LH  +YE+DKI+T             L  +++   +++       +A++LY
Sbjct  1    MGPRLLHGTLHATIYEIDKIRTGCADCCGPTSPQKLTKRVLNNVKKLFFCAPKISATKLY  60

Query  187  ATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYM  363
            ATIDL+KARVGRTR+ + E  NP W ++F  YCAH  SN++F+VK +NP+ A LIGRAY+
Sbjct  61   ATIDLDKARVGRTRIAENEPSNPHWNDTFRFYCAHEVSNIIFTVKDENPVSATLIGRAYL  120

Query  364  PARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPY  543
            P   +L    VD W+P++D +R+PI  HSKIHV+LQF  V ++  W RG+ +  F GVPY
Sbjct  121  PVEEVLNRYIVDRWVPIVDEERHPISGHSKIHVRLQFYSVKQDSNWSRGITSPAFGGVPY  180

Query  544  TFFPQRRGCKVTLYQDAHV  600
            TFF +R+GC+VTLY DA +
Sbjct  181  TFFKERQGCQVTLYPDADI  199



>ref|XP_009758055.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
 ref|XP_009758056.1| PREDICTED: phospholipase D alpha 1-like [Nicotiana sylvestris]
Length=820

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 130/200 (65%), Gaps = 12/200 (6%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK---------TDGLHNLFHKIVEGAERV--VGFNKTASRL  183
            M   LLHG+LH  +YEVDKI+         T     +  + +   +++       + ++ 
Sbjct  1    MGPRLLHGTLHATIYEVDKIRGGCGDCCGPTASPQKVSRRFLNNVKKLFFCAPEISGTKF  60

Query  184  YATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAY  360
            YATIDL+KARVGRTR+ + +  NPRWYE+F IYCAH  SN++F++K +NP+ A LIGRAY
Sbjct  61   YATIDLDKARVGRTRIFENDPSNPRWYETFRIYCAHEISNIIFTIKDENPVSATLIGRAY  120

Query  361  MPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVP  540
            +P   +L    VD W+P+LD D  PI   SKIHV+LQF +V ++  W RG+ +  F GVP
Sbjct  121  LPVEEVLNRYVVDRWVPILDEDGYPISGRSKIHVRLQFFNVKQDSNWSRGINSLAFGGVP  180

Query  541  YTFFPQRRGCKVTLYQDAHV  600
            YTFF +R+GC+VTLY DA +
Sbjct  181  YTFFKERQGCQVTLYPDADI  200



>gb|KDP33596.1| hypothetical protein JCGZ_07167 [Jatropha curcas]
Length=816

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 134/198 (68%), Gaps = 15/198 (8%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTDGLHNLFH----------KIVEGAERVVGFNK--TASRLYAT  192
            LLHG+L V V+E+D I+     NLF           + +   +R+V        S+LYAT
Sbjct  4    LLHGTLFVTVFEIDIIQNGCGFNLFSEGIGQQNCGKRFLSKMKRMVLCRPEIVCSKLYAT  63

Query  193  IDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPA  369
            +DL+KARVGRTR++ ++  NP+W+ESFHIYCAH+ SNV+F+VK D   GA LIGRAY+P 
Sbjct  64   VDLDKARVGRTRMITNQPYNPQWFESFHIYCAHLISNVIFTVKDDQLAGATLIGRAYIPV  123

Query  370  RRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTF  549
              ++ G  +D W+ +LD   NPI   SKIHVKLQ++ V ++  W +G+K  R+ GVPYTF
Sbjct  124  EDVIKGYIIDRWVEILDELHNPI--GSKIHVKLQYVSVTQDTNWSQGIKNPRYDGVPYTF  181

Query  550  FPQRRGCKVTLYQDAHVP  603
            F QR GC+VTLYQDAHVP
Sbjct  182  FNQRHGCRVTLYQDAHVP  199



>ref|XP_002963233.1| hypothetical protein SELMODRAFT_165923 [Selaginella moellendorffii]
 gb|EFJ35104.1| hypothetical protein SELMODRAFT_165923 [Selaginella moellendorffii]
Length=804

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 132/195 (68%), Gaps = 8/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYE----VDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH+ VYE    V++ +  G    F  K+VEG E  +G  K  S LYATIDL
Sbjct  1    MAQILLHGTLHITVYEAASLVNENRVSGASPKFMRKMVEGVEDSIGIGKGVSSLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            E+ RVGRTRL+  E   P W ESFHI CAH  +NVV SVK D  + A L+GRA +P +R+
Sbjct  61   ERQRVGRTRLIRKEPTKPVWNESFHIQCAHNIANVVVSVKDDLAVSAFLLGRAKVPVKRI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRG-VKAARFPGVPYTFFP  555
            + GE V+ W  L  ND      +S++ ++LQF D+ R+  WGRG V   +FPGVP+T+FP
Sbjct  121  MYGELVEGWFELY-NDSGKKLGNSRVRLRLQFFDITRDPRWGRGLVDGTKFPGVPFTYFP  179

Query  556  QRRGCKVTLYQDAHV  600
            QR+GCKVTLYQDAH+
Sbjct  180  QRKGCKVTLYQDAHM  194



>ref|XP_004251821.1| PREDICTED: phospholipase D alpha 1-like [Solanum lycopersicum]
Length=820

 Score =   194 bits (492),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 133/199 (67%), Gaps = 11/199 (6%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKT--------DGLHNLFHKIVEGAERV--VGFNKTASRLY  186
            M   LLHG+LH  +YE+DKI+T             L  +++   +++       +A++LY
Sbjct  1    MVPRLLHGTLHATIYEIDKIRTGCADCCGPTSPQKLTKRVLNNVKKLFFCAPKISATKLY  60

Query  187  ATIDLEKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYM  363
            ATIDL+KARVGRTR+ + E  NP W ++F +YCAH  SN++F+VK +NP+ A LIGRAY+
Sbjct  61   ATIDLDKARVGRTRIAENEPSNPHWNDTFRLYCAHEVSNIIFTVKDENPVSATLIGRAYL  120

Query  364  PARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPY  543
            P   +L    VD W+P++D +R+PI  HSKIHV+LQF  V ++  W RG+ +  F G+PY
Sbjct  121  PVEEVLNRYIVDRWVPIVDEERHPISGHSKIHVRLQFYSVKQDSNWSRGITSLAFGGLPY  180

Query  544  TFFPQRRGCKVTLYQDAHV  600
            TFF +R+GC+VTLY DA +
Sbjct  181  TFFKERQGCQVTLYPDADI  199



>ref|XP_002974536.1| hypothetical protein SELMODRAFT_267774 [Selaginella moellendorffii]
 gb|EFJ24056.1| hypothetical protein SELMODRAFT_267774 [Selaginella moellendorffii]
Length=804

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 132/195 (68%), Gaps = 8/195 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYE----VDKIKTDGLHNLF-HKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH+ VYE    V++ +  G    F  K+VEG E  +G  K  S LYATIDL
Sbjct  1    MAQILLHGTLHITVYEAASLVNENRVSGASPKFMRKMVEGVEDSIGIGKGVSSLYATIDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            E+ RVGRTRL+  E   P W ESFHI CAH  +NVV SVK D  + A L+GRA +P +R+
Sbjct  61   ERQRVGRTRLIRKEPTKPVWNESFHIQCAHNIANVVVSVKDDLAVSAFLLGRAKVPVKRI  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRG-VKAARFPGVPYTFFP  555
            + GE V+ W  L  ND      +S++ ++LQF D+ R+  WGRG V   +FPGVP+T+FP
Sbjct  121  MYGELVEGWFELY-NDSGKKLGNSRVRLRLQFFDITRDPRWGRGLVDGTKFPGVPFTYFP  179

Query  556  QRRGCKVTLYQDAHV  600
            QR+GCKVTLYQDAH+
Sbjct  180  QRKGCKVTLYQDAHM  194



>ref|XP_002437251.1| hypothetical protein SORBIDRAFT_10g023630 [Sorghum bicolor]
 gb|EER88618.1| hypothetical protein SORBIDRAFT_10g023630 [Sorghum bicolor]
Length=816

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 136/196 (69%), Gaps = 7/196 (4%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MA LLLHG+L   + E D +      T G   +F K VEG E  +G  + ++RLYAT+DL
Sbjct  1    MAHLLLHGTLDATILEADHLTNPTRATGGAPGIFRKFVEGFEESLGLGQGSTRLYATVDL  60

Query  202  EKARVGRTRLLD-EHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
             +ARVGRTR++  +  NPRWYE+FHIYCAH ASNVVFSVK   PIGA LIGRAY+P R L
Sbjct  61   GRARVGRTRVITGDPVNPRWYEAFHIYCAHFASNVVFSVKAAQPIGATLIGRAYLPVRDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRE-RCWGRGVKAARFPGVPYTFFP  555
            + G+E++  L +L+  +  +    K+ V+L+F DV  + R WGRGV  AR+PGVPYTFF 
Sbjct  121  IAGQEIERSLDILNASKKRLPHGPKLRVRLRFQDVAADRRGWGRGVGGARYPGVPYTFFS  180

Query  556  QRRGCKVTLYQDAHVP  603
            QR GC+VTLYQDAH P
Sbjct  181  QRPGCRVTLYQDAHTP  196



>gb|EPS71739.1| hypothetical protein M569_03019, partial [Genlisea aurea]
Length=782

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 111/143 (78%), Gaps = 1/143 (1%)
 Frame = +1

Query  175  SRLYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIG  351
            SR+YAT+DLE AR+GRTR++ +   NPRWYE+F IYCAH  SNVVF+VK DNPIGA LIG
Sbjct  21   SRIYATVDLEGARMGRTRMISKKASNPRWYENFRIYCAHTLSNVVFTVKDDNPIGATLIG  80

Query  352  RAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFP  531
            RAY+P   +L G+ +D W+ +LD D+NPI+  SKIHVKLQ+  V +E  W +G++   F 
Sbjct  81   RAYLPVEDILDGQIIDRWIQILDEDKNPINGGSKIHVKLQYFHVSQENNWSQGIRTPSFN  140

Query  532  GVPYTFFPQRRGCKVTLYQDAHV  600
            GVP+TFF QR+GCKVTLY DAHV
Sbjct  141  GVPHTFFRQRQGCKVTLYPDAHV  163



>ref|XP_007011867.1| Phospholipase D alpha 1 [Theobroma cacao]
 gb|EOY29486.1| Phospholipase D alpha 1 [Theobroma cacao]
Length=824

 Score =   193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 126/201 (63%), Gaps = 13/201 (6%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGF------------NKTASR  180
            MA  LLHG L V +Y +D +K     +L  K     +    F                S+
Sbjct  1    MATHLLHGKLTVRIYGIDTLKYPSGLSLLSKATGPTQLAKLFIAQLKRIMLCQSEMIGSK  60

Query  181  LYATIDLEKARVGRTRLLDEH-KNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  357
            LYAT+DL+KARV RTR++ +    P W ESF IYC H+ S+++F+VK  NPIGA LIGRA
Sbjct  61   LYATVDLDKARVARTRMISKKGSEPIWNESFRIYCGHLISDIIFTVKYANPIGATLIGRA  120

Query  358  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGV  537
            ++PA  ++ G  VD W+ +LD +RNPI   SKIHV+LQF +V ++R W +G+    F GV
Sbjct  121  HIPAEDVIQGAAVDRWVDILDENRNPIPGGSKIHVQLQFFNVTQDRNWSQGISNPGFEGV  180

Query  538  PYTFFPQRRGCKVTLYQDAHV  600
            PYTFF QR GCKVTLYQDAHV
Sbjct  181  PYTFFSQREGCKVTLYQDAHV  201



>ref|XP_010228542.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Brachypodium 
distachyon]
Length=824

 Score =   191 bits (485),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 130/210 (62%), Gaps = 22/210 (10%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVD--KIKTDGL-----HNLFHKIV------------EGAERVVG  159
            MA +LLHG +   + + D   + +DG        L  K V            +  E  +G
Sbjct  1    MALMLLHGVIDAQILDADLSSVSSDGQIRPNRKTLMKKKVFSWIKKLPFCNCQQVENAIG  60

Query  160  FNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  339
               TA +LYAT+D++KARVGRTR+L+    P+W + FHIYCAH A++V+F+VK DNP+GA
Sbjct  61   LGSTAGKLYATVDIDKARVGRTRMLEPTNTPKWGQEFHIYCAHDAAHVIFTVKADNPVGA  120

Query  340  ELIGRAYMP-ARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERC--WGRG  510
             LIGRAY+P    +  G+ VD+WLP+ D+ R P+    +IHV+L+F DV  +    WG G
Sbjct  121  TLIGRAYLPTGGAVAAGQRVDQWLPICDDKRRPLEGGDRIHVQLRFTDVAADPNARWGAG  180

Query  511  VKAARFPGVPYTFFPQRRGCKVTLYQDAHV  600
            +    +PGVP TFFPQR GC+V LYQDAH+
Sbjct  181  IGGVEYPGVPRTFFPQRSGCRVRLYQDAHI  210



>ref|XP_010648662.1| PREDICTED: phospholipase D alpha 1-like [Vitis vinifera]
Length=825

 Score =   191 bits (485),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 131/202 (65%), Gaps = 14/202 (7%)
 Frame = +1

Query  40   AQLLLHGSLHVCVYEVDK----------IKTDGLHNLFHKIVEGAERVVGFNK--TASRL  183
            A  +LHG+L+  ++++D+          IKT    NL  +++   +R+V        S+L
Sbjct  3    APFVLHGTLYATIFDIDRLYGGCECGHIIKTSRTQNLPKRLLGEVKRMVLCRPEVIGSKL  62

Query  184  YATIDLEKARVGRTRLLDE--HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRA  357
            YAT+DLEKARV RTRL++   +  PRW+ESF IYCAH  SN++F++K DNP+GA LIGRA
Sbjct  63   YATVDLEKARVARTRLIENRAYSKPRWFESFRIYCAHRISNIIFTIKEDNPVGARLIGRA  122

Query  358  YMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGV  537
            Y+P   +  G EVD  + +LD DRNP+  HS+IHVKL F    ++  W +G+       V
Sbjct  123  YVPVEAIKSGHEVDLQVEILDEDRNPLPGHSRIHVKLHFFHAKKQSDWSKGILNPELGEV  182

Query  538  PYTFFPQRRGCKVTLYQDAHVP  603
            P TFF QR+GCKV+LYQDAHVP
Sbjct  183  PCTFFMQRQGCKVSLYQDAHVP  204



>ref|NP_001146559.1| phospholipase D family protein [Zea mays]
 gb|ACN26583.1| unknown [Zea mays]
 gb|AFW80164.1| phospholipase D family protein [Zea mays]
Length=743

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 103/123 (84%), Gaps = 1/123 (1%)
 Frame = +1

Query  235  DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWLPL  414
            +E  NPRWYESFHIYCAHMA++VVF+VK+DNPIGA LIGRAY+P   +LGG+E+D+WL +
Sbjct  4    NEPVNPRWYESFHIYCAHMAADVVFTVKIDNPIGASLIGRAYLPVEDILGGDEIDKWLEI  63

Query  415  LDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQDA  594
             D  R PI   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF QR+GCKVTLYQDA
Sbjct  64   CDEKREPI-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQRQGCKVTLYQDA  122

Query  595  HVP  603
            HVP
Sbjct  123  HVP  125



>gb|ACL53520.1| unknown [Zea mays]
Length=743

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = +1

Query  229  LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWL  408
            + +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + LLGGEE+D+WL
Sbjct  2    ISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDLLGGEEIDKWL  61

Query  409  PLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQ  588
             + D +R P+   SKIHVKLQ+ DV ++R W RGV++ ++PGVPYTFF QR+GCKVTLYQ
Sbjct  62   EICDENREPV-GDSKIHVKLQYFDVGKDRNWARGVRSTKYPGVPYTFFSQRQGCKVTLYQ  120

Query  589  DAHVP  603
            DAHVP
Sbjct  121  DAHVP  125



>ref|XP_008394091.1| PREDICTED: phospholipase D alpha 1-like isoform X2 [Malus domestica]
Length=672

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 130/196 (66%), Gaps = 17/196 (9%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTDGLHNLFHK------------IVEGAERVVGFNKTASRLYAT  192
            LLHG L+  +YEVD++ T    NL  K            ++   +++VG     S+LYAT
Sbjct  4    LLHGMLYATIYEVDRLDTGCGFNLLCKSPKRFATQIKKLVLCRPQQIVG-----SKLYAT  58

Query  193  IDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPAR  372
            IDL+KARVGRTR++++  NP+W E F+IYCAH  S ++F+VK D+ IGA LIGRAY+P  
Sbjct  59   IDLDKARVGRTRMVNDPNNPKWREEFYIYCAHNISQIIFTVKDDDLIGATLIGRAYIPVG  118

Query  373  RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFF  552
             ++ G   + W+ +LD D NPIH +S+IHVKLQF  V  +  W  G++  ++ GVP TFF
Sbjct  119  DIIKGYVEERWVEILDEDHNPIHGNSRIHVKLQFSSVAEDFHWSLGIRNPKYEGVPRTFF  178

Query  553  PQRRGCKVTLYQDAHV  600
             QR GC+VTLYQD+HV
Sbjct  179  NQREGCRVTLYQDSHV  194



>ref|XP_007137028.1| hypothetical protein PHAVU_009G093500g [Phaseolus vulgaris]
 gb|ESW09022.1| hypothetical protein PHAVU_009G093500g [Phaseolus vulgaris]
Length=827

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 131/204 (64%), Gaps = 22/204 (11%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTDGLHNL-FHKIVEGAERVV------------------GFNKT  171
            LLHGSL V +YEVD + T  L++  F+   +G  R V                      T
Sbjct  4    LLHGSLDVTIYEVDTLPT--LNDCDFNLCCKGTSRSVRKRVLSQLKSCLFCQCQCQPGST  61

Query  172  ASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELI  348
             + LYAT+DL+KARVGRT++L DE  N  W ++F IYCAH+ S+V+F+VK  +PI A LI
Sbjct  62   QTGLYATVDLDKARVGRTKVLNDERSNTMWNDTFRIYCAHLISHVIFTVKQKDPINATLI  121

Query  349  GRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARF  528
            GRAY+P  +++ G  VD W+ +LD D NPI S SKIHVK+QF DV  +  W  G+++ RF
Sbjct  122  GRAYVPVEQVMTGNIVDTWVQILDEDLNPIPSDSKIHVKMQFSDVRNDINWSGGIRSPRF  181

Query  529  PGVPYTFFPQRRGCKVTLYQDAHV  600
             GVP+TFF QR GC VTLYQDAHV
Sbjct  182  QGVPHTFFGQRTGCNVTLYQDAHV  205



>ref|XP_008394090.1| PREDICTED: phospholipase D alpha 1-like isoform X1 [Malus domestica]
Length=810

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 130/196 (66%), Gaps = 17/196 (9%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTDGLHNLFHK------------IVEGAERVVGFNKTASRLYAT  192
            LLHG L+  +YEVD++ T    NL  K            ++   +++VG     S+LYAT
Sbjct  4    LLHGMLYATIYEVDRLDTGCGFNLLCKSPKRFATQIKKLVLCRPQQIVG-----SKLYAT  58

Query  193  IDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPAR  372
            IDL+KARVGRTR++++  NP+W E F+IYCAH  S ++F+VK D+ IGA LIGRAY+P  
Sbjct  59   IDLDKARVGRTRMVNDPNNPKWREEFYIYCAHNISQIIFTVKDDDLIGATLIGRAYIPVG  118

Query  373  RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFF  552
             ++ G   + W+ +LD D NPIH +S+IHVKLQF  V  +  W  G++  ++ GVP TFF
Sbjct  119  DIIKGYVEERWVEILDEDHNPIHGNSRIHVKLQFSSVAEDFHWSLGIRNPKYEGVPRTFF  178

Query  553  PQRRGCKVTLYQDAHV  600
             QR GC+VTLYQD+HV
Sbjct  179  NQREGCRVTLYQDSHV  194



>ref|XP_008673230.1| PREDICTED: phospholipase D family protein isoform X2 [Zea mays]
 ref|XP_008673233.1| PREDICTED: phospholipase D family protein isoform X2 [Zea mays]
 ref|XP_008673237.1| PREDICTED: phospholipase D family protein isoform X2 [Zea mays]
 ref|XP_008673242.1| PREDICTED: phospholipase D family protein isoform X2 [Zea mays]
 tpg|DAA45661.1| TPA: phospholipase D family protein isoform 1 [Zea mays]
 tpg|DAA45662.1| TPA: phospholipase D family protein isoform 2 [Zea mays]
 tpg|DAA45663.1| TPA: phospholipase D family protein isoform 3 [Zea mays]
 tpg|DAA45664.1| TPA: phospholipase D family protein isoform 4 [Zea mays]
Length=855

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 129/207 (62%), Gaps = 18/207 (9%)
 Frame = +1

Query  34   EMAQLLLHGSLHVCVYEVD-KIKTDGL-----HNLFHKIVEGAERVVGFNK---------  168
            +  QLLLHG +   + E D  + TDG        L  K V    R + F +         
Sbjct  21   QTTQLLLHGVIEATILEADLSVTTDGKLQPTKKTLMKKKVFSWIRKLTFCRNQLENAIGL  80

Query  169  -TASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAEL  345
             T  +LYAT+D++KARVGRTR++    +P W ESFH+YCAH ASN++F+VK DN IGA L
Sbjct  81   GTDGKLYATVDIDKARVGRTRMVPPVHSPMWDESFHLYCAHDASNIIFTVKADNAIGATL  140

Query  346  IGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERC--WGRGVKA  519
            IGRAY+P   ++ G +VD WLP+ D  R P+    +IHV++QF DV  +    WG G+ +
Sbjct  141  IGRAYLPTEGVVAGRKVDLWLPIRDEKRQPLEGGDQIHVQVQFTDVAADPTAGWGAGIGS  200

Query  520  ARFPGVPYTFFPQRRGCKVTLYQDAHV  600
            A + GVPYTFF QRRGC+V LY+DAHV
Sbjct  201  AAYGGVPYTFFKQRRGCRVRLYEDAHV  227



>tpg|DAA45660.1| TPA: phospholipase D family protein [Zea mays]
Length=715

 Score =   188 bits (477),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 129/210 (61%), Gaps = 22/210 (10%)
 Frame = +1

Query  34   EMAQLLLHGSLHVCVYEVD-KIKTDGL-----HNLFHKIV-------------EGAERVV  156
            +  QLLLHG +   + E D  + TDG        L  K V             +  E  +
Sbjct  21   QTTQLLLHGVIEATILEADLSVTTDGKLQPTKKTLMKKKVFSWIRKLTFCRNQQQLENAI  80

Query  157  GFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIG  336
            G   T  +LYAT+D++KARVGRTR++    +P W ESFH+YCAH ASN++F+VK DN IG
Sbjct  81   GLG-TDGKLYATVDIDKARVGRTRMVPPVHSPMWDESFHLYCAHDASNIIFTVKADNAIG  139

Query  337  AELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERC--WGRG  510
            A LIGRAY+P   ++ G +VD WLP+ D  R P+    +IHV++QF DV  +    WG G
Sbjct  140  ATLIGRAYLPTEGVVAGRKVDLWLPIRDEKRQPLEGGDQIHVQVQFTDVAADPTAGWGAG  199

Query  511  VKAARFPGVPYTFFPQRRGCKVTLYQDAHV  600
            + +A + GVPYTFF QRRGC+V LY+DAHV
Sbjct  200  IGSAAYGGVPYTFFKQRRGCRVRLYEDAHV  229



>ref|XP_004138856.1| PREDICTED: phospholipase D alpha 2-like [Cucumis sativus]
Length=810

 Score =   188 bits (478),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 125/192 (65%), Gaps = 13/192 (7%)
 Frame = +1

Query  25   PLSEMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLE  204
            P       LLHG+LH  +YE+D+++T G      KIV             SR+YAT+DL+
Sbjct  13   PKQRQMPRLLHGTLHADIYEIDRLQT-GFPVFCGKIV------------GSRMYATVDLD  59

Query  205  KARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLG  384
            KARVGRTR++D+  NP W + F IYCAH  S+++F+VK  + IGA LIGRAY+P   ++ 
Sbjct  60   KARVGRTRIVDQPYNPHWNDHFRIYCAHTVSHIIFTVKDGDFIGATLIGRAYVPVEEIIK  119

Query  385  GEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRR  564
            G   ++W+ +LD D  P++  S+IHVKLQF  V  +R W RG+    F GVP+TFF QR 
Sbjct  120  GFVYEKWVDILDEDGKPLYGRSRIHVKLQFSSVNEDRNWSRGILDPNFEGVPFTFFKQRW  179

Query  565  GCKVTLYQDAHV  600
            GCKV+LYQDAHV
Sbjct  180  GCKVSLYQDAHV  191



>ref|XP_008673211.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008673215.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008673217.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008673221.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008673223.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 ref|XP_008673226.1| PREDICTED: phospholipase D family protein isoform X1 [Zea mays]
 tpg|DAA45658.1| TPA: phospholipase D family protein isoform 1 [Zea mays]
 tpg|DAA45659.1| TPA: phospholipase D family protein isoform 2 [Zea mays]
Length=857

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 129/210 (61%), Gaps = 22/210 (10%)
 Frame = +1

Query  34   EMAQLLLHGSLHVCVYEVD-KIKTDGL-----HNLFHKIV-------------EGAERVV  156
            +  QLLLHG +   + E D  + TDG        L  K V             +  E  +
Sbjct  21   QTTQLLLHGVIEATILEADLSVTTDGKLQPTKKTLMKKKVFSWIRKLTFCRNQQQLENAI  80

Query  157  GFNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIG  336
            G   T  +LYAT+D++KARVGRTR++    +P W ESFH+YCAH ASN++F+VK DN IG
Sbjct  81   GLG-TDGKLYATVDIDKARVGRTRMVPPVHSPMWDESFHLYCAHDASNIIFTVKADNAIG  139

Query  337  AELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERC--WGRG  510
            A LIGRAY+P   ++ G +VD WLP+ D  R P+    +IHV++QF DV  +    WG G
Sbjct  140  ATLIGRAYLPTEGVVAGRKVDLWLPIRDEKRQPLEGGDQIHVQVQFTDVAADPTAGWGAG  199

Query  511  VKAARFPGVPYTFFPQRRGCKVTLYQDAHV  600
            + +A + GVPYTFF QRRGC+V LY+DAHV
Sbjct  200  IGSAAYGGVPYTFFKQRRGCRVRLYEDAHV  229



>dbj|BAK02630.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=828

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 130/210 (62%), Gaps = 22/210 (10%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVD-KIKTDGLHNLFHKIV------------------EGAERVVG  159
            MAQ+LLHG +   + E D  + +DG      K V                  +  E  +G
Sbjct  1    MAQMLLHGVVDAMILEADLSVGSDGQLRPTRKTVMKKRVFSWIKKLSFCNNCQQLENAIG  60

Query  160  FNKTASRLYATIDLEKARVGRTRLLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGA  339
               TA +LYAT+D++KARVGRTR+++    P W ESFHIYCAH AS+++F+VK DN +GA
Sbjct  61   LGGTAGKLYATVDIDKARVGRTRMVNPSNAPSWNESFHIYCAHDASHIIFTVKADNTVGA  120

Query  340  ELIGRAYMPAR-RLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVR--ERCWGRG  510
             LIGRAY+P    +L G+ VD+WLP+ D+ R P+    ++HV+L+F DV    E  WG G
Sbjct  121  TLIGRAYLPTDGAVLAGQWVDQWLPICDDKRRPLDGGDRVHVQLRFTDVAADPEARWGAG  180

Query  511  VKAARFPGVPYTFFPQRRGCKVTLYQDAHV  600
            + +A + GVP TFF QR GC+V LYQDAH+
Sbjct  181  IGSAGYSGVPRTFFRQRAGCRVRLYQDAHI  210



>ref|XP_010050012.1| PREDICTED: phospholipase D alpha 1-like [Eucalyptus grandis]
 ref|XP_010050013.1| PREDICTED: phospholipase D alpha 1-like [Eucalyptus grandis]
Length=812

 Score =   188 bits (477),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 121/190 (64%), Gaps = 1/190 (1%)
 Frame = +1

Query  34   EMAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKAR  213
            +M  +LLHG+LH+ ++EVD I        F K+ E   + +G  +    LY T+D+ K R
Sbjct  2    DMEDVLLHGTLHLKIFEVDGISGGKPAAFFRKLTEEIGKCIGCGRPTFELYTTVDIGKTR  61

Query  214  VGRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGE  390
            V RTRL +  H N RW ESFHIYCAH AS + FS+K  +PIGA +IG A +    ++ G+
Sbjct  62   VSRTRLTESGHGNLRWNESFHIYCAHAASQITFSIKESDPIGAPVIGTASLLVSEIVKGQ  121

Query  391  EVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGC  570
            EVD WL +   +   +H  SKIHVKL+F     +  W +G++   FPGVP+TFF QR+GC
Sbjct  122  EVDRWLKISRGEHTSLHRGSKIHVKLKFESATGDPHWSKGIRRPDFPGVPHTFFEQRKGC  181

Query  571  KVTLYQDAHV  600
            KVTLYQDAHV
Sbjct  182  KVTLYQDAHV  191



>tpg|DAA53239.1| TPA: phospholipase D family protein, partial [Zea mays]
Length=205

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 110/147 (75%), Gaps = 7/147 (5%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIK-----TDGLHNLFHKIVEGAERVVGFNKTASRLYATIDL  201
            MAQ+LLHG+LH  ++E + +      T G      K+VEG E  VG  K A+++YAT+DL
Sbjct  1    MAQILLHGTLHATIFEAESLSNPHRATGGAPKFIRKLVEGIEDTVGVGKGATKIYATVDL  60

Query  202  EKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRL  378
            EKARVGRTR++ +E  NPRWYESFHIYCAHMA++V+F+VK+DN IGA LIGRAY+P + L
Sbjct  61   EKARVGRTRMISNEPVNPRWYESFHIYCAHMAADVIFTVKIDNSIGASLIGRAYLPVQDL  120

Query  379  LGGEEVDEWLPLLDNDRNPIHSHSKIH  459
            LGGEE+D+WL + D +R P+   SKIH
Sbjct  121  LGGEEIDKWLEICDENREPV-GDSKIH  146



>ref|XP_004160794.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase D alpha 2-like 
[Cucumis sativus]
Length=820

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 124/184 (67%), Gaps = 13/184 (7%)
 Frame = +1

Query  49   LLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARVGRTR  228
            LLHG+LH  +YE+D+++T G      KIV             SR+YAT+DL+KARVGRTR
Sbjct  31   LLHGTLHADIYEIDRLQT-GFPVFCGKIV------------GSRMYATVDLDKARVGRTR  77

Query  229  LLDEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEEVDEWL  408
            ++D+  NP W + F IYCAH  S+++F+VK  + IGA LIGRAY+P   ++ G   ++W+
Sbjct  78   IVDQPYNPHWNDHFRIYCAHTVSHIIFTVKDGDFIGATLIGRAYVPVEEIIKGFVYEKWV  137

Query  409  PLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCKVTLYQ  588
             +LD D  P++  S+IHVKLQF  V  +R W RG+    F GVP+TFF QR GCKV+LYQ
Sbjct  138  DILDEDGKPLYGRSRIHVKLQFSSVNEDRNWSRGILDPNFEGVPFTFFKQRLGCKVSLYQ  197

Query  589  DAHV  600
            DAHV
Sbjct  198  DAHV  201



>gb|KCW82853.1| hypothetical protein EUGRSUZ_C04222 [Eucalyptus grandis]
Length=810

 Score =   187 bits (475),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 120/189 (63%), Gaps = 1/189 (1%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAERVVGFNKTASRLYATIDLEKARV  216
            M  +LLHG+LH+ ++EVD I        F K+ E   + +G  +    LY T+D+ K RV
Sbjct  1    MEDVLLHGTLHLKIFEVDGISGGKPAAFFRKLTEEIGKCIGCGRPTFELYTTVDIGKTRV  60

Query  217  GRTRLLDE-HKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAYMPARRLLGGEE  393
             RTRL +  H N RW ESFHIYCAH AS + FS+K  +PIGA +IG A +    ++ G+E
Sbjct  61   SRTRLTESGHGNLRWNESFHIYCAHAASQITFSIKESDPIGAPVIGTASLLVSEIVKGQE  120

Query  394  VDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVPYTFFPQRRGCK  573
            VD WL +   +   +H  SKIHVKL+F     +  W +G++   FPGVP+TFF QR+GCK
Sbjct  121  VDRWLKISRGEHTSLHRGSKIHVKLKFESATGDPHWSKGIRRPDFPGVPHTFFEQRKGCK  180

Query  574  VTLYQDAHV  600
            VTLYQDAHV
Sbjct  181  VTLYQDAHV  189



>gb|KJB07619.1| hypothetical protein B456_001G0333002, partial [Gossypium raimondii]
Length=806

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 132/200 (66%), Gaps = 14/200 (7%)
 Frame = +1

Query  37   MAQLLLHGSLHVCVYEVDKIKTDGLHNLFHKIVEGAER-----------VVGFNKTASRL  183
            M Q LLHG+L+V + E+D++K  G   L  K V   ++           V+  + T S++
Sbjct  1    MEQHLLHGTLNVTINEIDRLKISG--GLLSKDVGLLDKGKILLAQLKRLVLCQSITDSKI  58

Query  184  YATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVKVDNPIGAELIGRAY  360
            YAT+DL+KAR  RTR++ +E +   W ESF IYC H+ S+++F+VK  NPIGA LIGRAY
Sbjct  59   YATVDLDKARAARTRMVKNEGQASPWNESFRIYCGHLISHIIFTVKYVNPIGATLIGRAY  118

Query  361  MPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERCWGRGVKAARFPGVP  540
            +P + ++ G  VD W+ +LD +  PIH  SKIHV LQF +V ++  W RG+K   F GVP
Sbjct  119  VPVQDIINGNIVDRWVNILDQNHVPIHGDSKIHVHLQFFNVTQDAHWSRGIKNRDFNGVP  178

Query  541  YTFFPQRRGCKVTLYQDAHV  600
            YT+F QR+GCKVTLY+DAH 
Sbjct  179  YTYFAQRQGCKVTLYKDAHT  198



>ref|XP_002308663.2| hypothetical protein POPTR_0006s27000g [Populus trichocarpa]
 gb|EEE92186.2| hypothetical protein POPTR_0006s27000g [Populus trichocarpa]
Length=771

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 116/155 (75%), Gaps = 6/155 (4%)
 Frame = +1

Query  142  AERVVGFNKTASRLYATIDLEKARVGRTRLL-DEHKNPRWYESFHIYCAHMASNVVFSVK  318
            +E VVG     SRLYAT+DL+KARV RTR++ +E  NPRW ESFH+YCAH  S+VVF++K
Sbjct  5    SENVVG-----SRLYATVDLDKARVARTRMVGNEPHNPRWNESFHVYCAHSISHVVFTIK  59

Query  319  VDNPIGAELIGRAYMPARRLLGGEEVDEWLPLLDNDRNPIHSHSKIHVKLQFLDVVRERC  498
             D+ IGA LIGRAY+P   +  G  ++ W+ + D DR PI   S++H+KLQF DV ++R 
Sbjct  60   DDDAIGATLIGRAYLPVEDITNGNILERWVEVEDEDRKPIPGGSRVHIKLQFFDVNQDRH  119

Query  499  WGRGVKAARFPGVPYTFFPQRRGCKVTLYQDAHVP  603
            W +G+K+ ++ GVPY FF QR+GC+VTLYQDAHVP
Sbjct  120  WSQGIKSPQYEGVPYVFFNQRQGCRVTLYQDAHVP  154



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370