BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF047M16

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009619497.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    209   2e-62   Nicotiana tomentosiformis
ref|XP_006340651.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    209   3e-62   Solanum tuberosum [potatoes]
ref|XP_004232427.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      208   4e-62   Solanum lycopersicum
ref|XP_009762330.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    206   5e-61   Nicotiana sylvestris
ref|XP_003612065.1|  Mannan endo-1,4-beta-mannosidase                   204   2e-60   Medicago truncatula
ref|XP_008241714.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      202   7e-60   Prunus mume [ume]
gb|ABY58035.1|  mannase                                                 202   8e-60   Prunus salicina [Japanese plum]
ref|XP_007202078.1|  hypothetical protein PRUPE_ppa005992mg             202   9e-60   Prunus persica
gb|ABV32548.1|  endo-1,4-beta-mannosidase protein 2                     202   1e-59   Prunus persica
ref|XP_010029765.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      201   4e-59   Eucalyptus grandis [rose gum]
ref|XP_009347596.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    200   6e-59   
gb|KDP44593.1|  hypothetical protein JCGZ_22175                         200   6e-59   Jatropha curcas
ref|XP_010254774.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    199   1e-58   Nelumbo nucifera [Indian lotus]
emb|CDP01989.1|  unnamed protein product                                198   3e-58   Coffea canephora [robusta coffee]
ref|XP_003517214.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    197   7e-58   Glycine max [soybeans]
ref|XP_010113415.1|  Mannan endo-1,4-beta-mannosidase 7                 197   1e-57   Morus notabilis
ref|XP_002264115.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      197   1e-57   Vitis vinifera
gb|KDO70993.1|  hypothetical protein CISIN_1g013811mg                   196   2e-57   Citrus sinensis [apfelsine]
ref|XP_006466833.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    196   2e-57   Citrus sinensis [apfelsine]
ref|XP_004512071.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    196   2e-57   Cicer arietinum [garbanzo]
ref|XP_006383170.1|  (1-4)-beta-mannan endohydrolase family protein     196   2e-57   Populus trichocarpa [western balsam poplar]
ref|XP_006425633.1|  hypothetical protein CICLE_v10025631mg             196   3e-57   
ref|XP_011015126.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    196   3e-57   Populus euphratica
ref|XP_011013722.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    196   3e-57   Populus euphratica
ref|XP_007156980.1|  hypothetical protein PHAVU_002G033500g             196   3e-57   Phaseolus vulgaris [French bean]
ref|XP_007046870.1|  Glycosyl hydrolase superfamily protein isofo...    196   4e-57   
gb|ACU18982.1|  unknown                                                 195   4e-57   Glycine max [soybeans]
gb|KHN36084.1|  Mannan endo-1,4-beta-mannosidase 7                      195   6e-57   Glycine soja [wild soybean]
ref|XP_002521547.1|  serine-threonine protein kinase, plant-type,...    200   9e-57   
ref|XP_002865067.1|  predicted protein                                  194   1e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_009340713.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      194   2e-56   Pyrus x bretschneideri [bai li]
ref|XP_003537602.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    194   2e-56   Glycine max [soybeans]
ref|XP_006590696.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    194   2e-56   Glycine max [soybeans]
gb|KHG22102.1|  Mannan endo-1,4-beta-mannosidase 7 -like protein        193   3e-56   Gossypium arboreum [tree cotton]
gb|KFK28321.1|  hypothetical protein AALP_AA8G500900                    193   4e-56   Arabis alpina [alpine rockcress]
ref|XP_010444793.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      192   8e-56   Camelina sativa [gold-of-pleasure]
ref|NP_201447.1|  mannan endo-1,4-beta-mannosidase 7                    192   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002310816.2|  hypothetical protein POPTR_0007s13190g             192   1e-55   
ref|XP_011025835.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      192   1e-55   Populus euphratica
ref|XP_011011941.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    191   3e-55   Populus euphratica
emb|CDY45231.1|  BnaA07g12590D                                          192   3e-55   Brassica napus [oilseed rape]
ref|XP_011083199.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      190   5e-55   Sesamum indicum [beniseed]
ref|XP_009112304.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    190   6e-55   Brassica rapa
ref|XP_010484638.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    189   8e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006393839.1|  hypothetical protein EUTSA_v10004263mg             189   9e-55   Eutrema salsugineum [saltwater cress]
ref|XP_010263608.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    189   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_009103527.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      189   1e-54   Brassica rapa
gb|KJB43465.1|  hypothetical protein B456_007G201600                    196   2e-54   Gossypium raimondii
gb|ACN78662.1|  endo-beta-mannanase                                     189   2e-54   Actinidia arguta
gb|AGG82699.1|  endo-1,4-beta-mannosidase                               188   2e-54   Morus alba var. multicaulis
ref|XP_008338221.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    188   3e-54   
ref|XP_010550422.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      188   3e-54   Tarenaya hassleriana [spider flower]
ref|XP_010110051.1|  Mannan endo-1,4-beta-mannosidase 7                 187   4e-54   Morus notabilis
ref|XP_010465469.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    187   5e-54   Camelina sativa [gold-of-pleasure]
emb|CDY68324.1|  BnaCnng58510D                                          192   7e-54   Brassica napus [oilseed rape]
ref|XP_008338066.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    187   8e-54   
ref|XP_006279868.1|  hypothetical protein CARUB_v10028560mg             186   1e-53   Capsella rubella
ref|XP_002281804.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      186   2e-53   Vitis vinifera
emb|CDX81394.1|  BnaC09g08050D                                          192   2e-53   
ref|XP_003528027.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    184   6e-53   Glycine max [soybeans]
ref|XP_008800703.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    184   7e-53   Phoenix dactylifera
ref|XP_008440745.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      184   1e-52   Cucumis melo [Oriental melon]
ref|XP_007136624.1|  hypothetical protein PHAVU_009G059700g             184   1e-52   Phaseolus vulgaris [French bean]
ref|XP_004143522.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    183   2e-52   Cucumis sativus [cucumbers]
emb|CDY18606.1|  BnaA09g07890D                                          190   2e-52   Brassica napus [oilseed rape]
gb|KEH36174.1|  mannan endo-1,4-beta-mannosidase-like protein           182   2e-52   Medicago truncatula
ref|XP_003545272.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    181   8e-52   Glycine max [soybeans]
gb|KHN20963.1|  Mannan endo-1,4-beta-mannosidase 7                      181   2e-51   Glycine soja [wild soybean]
ref|XP_010924295.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    180   3e-51   Elaeis guineensis
gb|ACN78666.1|  endo-beta-mannanase                                     179   6e-51   Vaccinium corymbosum [American blueberry]
ref|XP_008220834.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    179   9e-51   Prunus mume [ume]
ref|XP_004291857.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    178   2e-50   Fragaria vesca subsp. vesca
ref|XP_004500999.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    169   3e-50   Cicer arietinum [garbanzo]
gb|KHN45867.1|  Mannan endo-1,4-beta-mannosidase 7                      177   3e-50   Glycine soja [wild soybean]
ref|NP_001241893.1|  uncharacterized protein LOC100814337 precursor     177   4e-50   Glycine max [soybeans]
gb|KCW68225.1|  hypothetical protein EUGRSUZ_F01879                     178   4e-50   Eucalyptus grandis [rose gum]
ref|XP_006841534.1|  hypothetical protein AMTR_s00003p00158370          177   5e-50   Amborella trichopoda
ref|XP_010679767.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 7      177   5e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009394803.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    176   8e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006841527.1|  hypothetical protein AMTR_s00003p00152240          176   8e-50   Amborella trichopoda
ref|XP_010061294.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    175   2e-49   Eucalyptus grandis [rose gum]
ref|XP_007017589.1|  Glycosyl hydrolase superfamily protein             175   3e-49   Theobroma cacao [chocolate]
ref|XP_007222385.1|  hypothetical protein PRUPE_ppa006029mg             174   4e-49   Prunus persica
gb|ABV32547.1|  endo-1,4-beta-mannosidase protein 1                     174   4e-49   Prunus persica
ref|XP_003549439.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    174   7e-49   Glycine max [soybeans]
ref|XP_002510418.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    174   7e-49   Ricinus communis
ref|XP_009395690.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    174   8e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001280873.1|  mannan endo-1,4-beta-mannosidase 7-like prec...    174   8e-49   Malus domestica [apple tree]
ref|XP_009336054.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    173   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_009365114.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    173   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_010926118.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      173   1e-48   Elaeis guineensis
ref|XP_009406291.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    172   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB58235.1|  hypothetical protein B456_009G200500                    172   2e-48   Gossypium raimondii
gb|EMS54429.1|  Mannan endo-1,4-beta-mannosidase 1                      170   3e-48   Triticum urartu
ref|XP_007160733.1|  hypothetical protein PHAVU_001G012600g             171   4e-48   Phaseolus vulgaris [French bean]
gb|EMT30727.1|  Mannan endo-1,4-beta-mannosidase 1                      170   4e-48   
ref|XP_010673216.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    171   5e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|ACN78663.1|  endo-beta-mannanase                                     171   8e-48   Malus domestica [apple tree]
gb|ADN34185.1|  endo-beta-mannanase                                     170   1e-47   Cucumis melo subsp. melo
ref|XP_009602297.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    170   2e-47   Nicotiana tomentosiformis
ref|XP_008466539.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    170   4e-47   
gb|EYU45796.1|  hypothetical protein MIMGU_mgv1a0212341mg               162   4e-47   Erythranthe guttata [common monkey flower]
gb|KDP38537.1|  hypothetical protein JCGZ_04462                         169   6e-47   Jatropha curcas
ref|XP_011085841.1|  PREDICTED: putative mannan endo-1,4-beta-man...    168   8e-47   Sesamum indicum [beniseed]
ref|XP_011007449.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    167   2e-46   Populus euphratica
ref|XP_006841038.1|  hypothetical protein AMTR_s00085p00132560          160   2e-46   
ref|XP_008797528.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    167   2e-46   
ref|XP_009416732.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    167   2e-46   
gb|ABF69949.1|  (1-4)-beta-mannan endohydrolase (mannan endo-1,4-...    167   2e-46   Musa acuminata [banana]
ref|XP_002515142.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    166   4e-46   Ricinus communis
ref|XP_002306881.1|  hypothetical protein POPTR_0005s25120g             166   5e-46   
ref|XP_009785219.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    166   5e-46   Nicotiana sylvestris
ref|XP_006441716.1|  hypothetical protein CICLE_v10023981mg             166   5e-46   
gb|KDO45466.1|  hypothetical protein CISIN_1g016140mg                   166   6e-46   Citrus sinensis [apfelsine]
ref|XP_004147857.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    166   6e-46   
ref|XP_004154850.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    166   6e-46   
gb|KGN59983.1|  hypothetical protein Csa_3G859700                       166   6e-46   Cucumis sativus [cucumbers]
ref|XP_011083658.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    166   8e-46   Sesamum indicum [beniseed]
ref|XP_009365529.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    166   8e-46   Pyrus x bretschneideri [bai li]
ref|XP_009122559.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    165   1e-45   Brassica rapa
ref|XP_006644473.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    165   2e-45   
ref|XP_006342222.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    164   2e-45   Solanum tuberosum [potatoes]
emb|CDP19235.1|  unnamed protein product                                164   3e-45   Coffea canephora [robusta coffee]
emb|CAC08442.1|  (1-4)-beta-mannan endohydrolase                        164   3e-45   Coffea arabica [arabica coffee]
ref|XP_009407087.1|  PREDICTED: putative mannan endo-1,4-beta-man...    163   5e-45   
ref|XP_004238284.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    163   7e-45   Solanum lycopersicum
ref|XP_004495835.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    162   9e-45   Cicer arietinum [garbanzo]
ref|XP_008805817.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    162   9e-45   
ref|XP_007051341.1|  Glycosyl hydrolase superfamily protein isofo...    162   1e-44   Theobroma cacao [chocolate]
ref|XP_010914840.1|  PREDICTED: putative mannan endo-1,4-beta-man...    162   1e-44   Elaeis guineensis
gb|KJB41765.1|  hypothetical protein B456_007G119100                    161   1e-44   Gossypium raimondii
gb|KJB41764.1|  hypothetical protein B456_007G119100                    162   2e-44   Gossypium raimondii
ref|XP_008799989.1|  PREDICTED: putative mannan endo-1,4-beta-man...    162   2e-44   
gb|KJB41766.1|  hypothetical protein B456_007G119100                    162   2e-44   Gossypium raimondii
gb|EYU22710.1|  hypothetical protein MIMGU_mgv1a023976mg                161   2e-44   Erythranthe guttata [common monkey flower]
gb|KCW46730.1|  hypothetical protein EUGRSUZ_K00551                     160   2e-44   Eucalyptus grandis [rose gum]
gb|EYU45779.1|  hypothetical protein MIMGU_mgv1a020287mg                161   2e-44   Erythranthe guttata [common monkey flower]
gb|EYU45780.1|  hypothetical protein MIMGU_mgv1a025011mg                161   2e-44   Erythranthe guttata [common monkey flower]
ref|XP_010911540.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    160   3e-44   Elaeis guineensis
ref|XP_006478472.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    161   3e-44   
ref|XP_009601553.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    161   4e-44   Nicotiana tomentosiformis
ref|XP_006435034.1|  hypothetical protein CICLE_v10001262mg             161   5e-44   Citrus clementina [clementine]
ref|XP_006473535.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    161   5e-44   Citrus sinensis [apfelsine]
gb|KDO84614.1|  hypothetical protein CISIN_1g014426mg                   161   5e-44   Citrus sinensis [apfelsine]
gb|KHG12601.1|  Mannan endo-1,4-beta-mannosidase 4                      160   5e-44   Gossypium arboreum [tree cotton]
ref|NP_001234473.1|  (1-4)-beta-mannan endohydrolase precursor          160   6e-44   Solanum lycopersicum
ref|XP_010035363.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    160   7e-44   Eucalyptus grandis [rose gum]
emb|CDP07490.1|  unnamed protein product                                160   7e-44   Coffea canephora [robusta coffee]
gb|KEH43148.1|  mannan endo-1,4-beta-mannosidase-like protein           160   7e-44   Medicago truncatula
ref|XP_010112044.1|  Mannan endo-1,4-beta-mannosidase 5                 160   7e-44   Morus notabilis
ref|XP_004303778.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    160   8e-44   Fragaria vesca subsp. vesca
emb|CAC08208.1|  (1-4)-beta-mannan endohydrolase                        160   8e-44   Coffea arabica [arabica coffee]
ref|XP_008805818.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    159   8e-44   
gb|KHN12693.1|  Mannan endo-1,4-beta-mannosidase 7                      159   9e-44   Glycine soja [wild soybean]
gb|KHN14185.1|  Putative mannan endo-1,4-beta-mannosidase 9             159   1e-43   Glycine soja [wild soybean]
ref|XP_003554587.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    159   1e-43   Glycine max [soybeans]
ref|XP_006356528.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    159   2e-43   Solanum tuberosum [potatoes]
ref|XP_004969435.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    159   2e-43   Setaria italica
ref|XP_010486712.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    159   2e-43   Camelina sativa [gold-of-pleasure]
ref|NP_001235608.1|  endo-1,4-beta-mannanase precursor                  159   2e-43   Glycine max [soybeans]
ref|XP_002272344.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      159   2e-43   
ref|XP_002884818.1|  predicted protein                                  159   2e-43   Arabidopsis lyrata subsp. lyrata
gb|AES61540.2|  mannan endo-1,4-beta-mannosidase-like protein           158   2e-43   Medicago truncatula
ref|XP_003591288.1|  Mannan endo-1,4-beta-mannosidase                   159   3e-43   Medicago truncatula
gb|KFK38477.1|  hypothetical protein AALP_AA3G118100                    159   3e-43   Arabis alpina [alpine rockcress]
ref|XP_009785847.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    159   3e-43   Nicotiana sylvestris
ref|XP_003569504.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      159   3e-43   Brachypodium distachyon [annual false brome]
ref|XP_009616037.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    159   3e-43   Nicotiana tomentosiformis
gb|EYU45794.1|  hypothetical protein MIMGU_mgv1a011066mg                155   5e-43   Erythranthe guttata [common monkey flower]
ref|XP_009621242.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    158   6e-43   Nicotiana tomentosiformis
ref|XP_010490985.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    158   6e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010464779.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    158   6e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010490811.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    157   7e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010490914.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    157   8e-43   
ref|XP_009763332.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    157   8e-43   Nicotiana sylvestris
ref|XP_009593808.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    157   1e-42   Nicotiana tomentosiformis
ref|XP_003591289.1|  NADH dehydrogenase subunit F                       159   1e-42   
ref|XP_006407494.1|  hypothetical protein EUTSA_v10020842mg             157   1e-42   Eutrema salsugineum [saltwater cress]
emb|CDP20125.1|  unnamed protein product                                157   2e-42   Coffea canephora [robusta coffee]
ref|XP_009789471.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    156   2e-42   Nicotiana sylvestris
gb|KEH43147.1|  mannan endo-1,4-beta-mannosidase-like protein           156   2e-42   Medicago truncatula
emb|CAC51690.3|  endo-beta-1,4-mannanase                                156   2e-42   Lactuca sativa [cultivated lettuce]
ref|XP_009760858.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      156   2e-42   Nicotiana sylvestris
ref|NP_001043785.1|  Os01g0663300                                       156   2e-42   
ref|XP_006356570.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    156   4e-42   Solanum tuberosum [potatoes]
sp|Q0JKM9.2|MAN1_ORYSJ  RecName: Full=Mannan endo-1,4-beta-mannos...    156   4e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010490578.1|  PREDICTED: putative mannan endo-1,4-beta-man...    155   5e-42   
emb|CDP11079.1|  unnamed protein product                                155   5e-42   Coffea canephora [robusta coffee]
gb|KCW46728.1|  hypothetical protein EUGRSUZ_K00551                     155   5e-42   Eucalyptus grandis [rose gum]
ref|XP_007163264.1|  hypothetical protein PHAVU_001G219800g             155   5e-42   Phaseolus vulgaris [French bean]
ref|XP_010468110.1|  PREDICTED: putative mannan endo-1,4-beta-man...    149   5e-42   
gb|AHA84179.1|  endo-1,4-beta-mannanase                                 155   5e-42   Phaseolus vulgaris [French bean]
emb|CDX73899.1|  BnaA03g31480D                                          152   6e-42   
ref|XP_011468408.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    154   6e-42   Fragaria vesca subsp. vesca
ref|XP_006491440.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    155   7e-42   Citrus sinensis [apfelsine]
ref|XP_006444660.1|  hypothetical protein CICLE_v10020376mg             155   7e-42   Citrus clementina [clementine]
ref|XP_008245064.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    155   7e-42   Prunus mume [ume]
ref|XP_006356569.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    155   8e-42   Solanum tuberosum [potatoes]
gb|EEC71222.1|  hypothetical protein OsI_03157                          155   8e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_009779875.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    154   1e-41   Nicotiana sylvestris
ref|NP_001234575.1|  mannan endo-1,4-beta-mannosidase 1 precursor       154   1e-41   Solanum lycopersicum
ref|XP_009391931.1|  PREDICTED: putative mannan endo-1,4-beta-man...    155   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010943133.1|  PREDICTED: putative mannan endo-1,4-beta-man...    154   1e-41   
ref|XP_006300225.1|  hypothetical protein CARUB_v10016461mg             155   1e-41   
gb|EYU22711.1|  hypothetical protein MIMGU_mgv1a025294mg                154   1e-41   Erythranthe guttata [common monkey flower]
ref|XP_009616057.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      154   1e-41   Nicotiana tomentosiformis
ref|XP_009785881.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      154   2e-41   Nicotiana sylvestris
sp|Q9FUQ6.1|MAN3_SOLLC  RecName: Full=Mannan endo-1,4-beta-mannos...    154   2e-41   Solanum lycopersicum
ref|XP_010313893.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    154   2e-41   
ref|XP_002884819.1|  hypothetical protein ARALYDRAFT_478424             153   2e-41   
ref|XP_003553696.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    153   3e-41   Glycine max [soybeans]
ref|XP_006296763.1|  hypothetical protein CARUB_v10015594mg             153   3e-41   Capsella rubella
ref|XP_008800333.1|  PREDICTED: putative mannan endo-1,4-beta-man...    153   3e-41   Phoenix dactylifera
ref|NP_187700.1|  mannan endo-1,4-beta-mannosidase 3                    153   4e-41   Arabidopsis thaliana [mouse-ear cress]
pdb|1RH9|A  Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopers...    152   5e-41   Solanum lycopersicum
ref|NP_001234131.1|  mannan endo-1,4-beta-mannosidase 4 precursor       152   6e-41   Solanum lycopersicum
ref|NP_001234114.1|  mannan endo-1,4-beta-mannosidase precursor         152   6e-41   
ref|NP_001234874.1|  inactive endo-beta-mannanase precursor             152   6e-41   
ref|XP_003591290.1|  Mannan endo-1,4-beta-mannosidase                   153   7e-41   
ref|XP_006588317.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    152   7e-41   Glycine max [soybeans]
ref|XP_010038519.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    152   7e-41   Eucalyptus grandis [rose gum]
gb|KCW46726.1|  hypothetical protein EUGRSUZ_K00548                     152   7e-41   Eucalyptus grandis [rose gum]
ref|XP_002456093.1|  hypothetical protein SORBIDRAFT_03g030340          152   8e-41   Sorghum bicolor [broomcorn]
ref|XP_009621619.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    150   9e-41   Nicotiana tomentosiformis
ref|XP_009135138.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    152   1e-40   
gb|EPS69785.1|  endo-beta-mannanase                                     154   1e-40   Genlisea aurea
ref|XP_008459570.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    152   1e-40   Cucumis melo [Oriental melon]
ref|XP_009135139.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    152   1e-40   Brassica rapa
ref|XP_004494942.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    152   1e-40   Cicer arietinum [garbanzo]
emb|CBI17041.3|  unnamed protein product                                150   2e-40   Vitis vinifera
ref|XP_010064850.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    151   2e-40   Eucalyptus grandis [rose gum]
ref|XP_009631900.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    151   2e-40   Nicotiana tomentosiformis
ref|NP_187701.1|  putative mannan endo-1,4-beta-mannosidase 4           151   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464782.1|  PREDICTED: putative mannan endo-1,4-beta-man...    151   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_003605853.1|  Mannan endo-1,4-beta-mannosidase                   151   2e-40   Medicago truncatula
ref|XP_008778491.1|  PREDICTED: putative mannan endo-1,4-beta-man...    151   3e-40   
ref|XP_008778492.1|  PREDICTED: putative mannan endo-1,4-beta-man...    150   3e-40   
ref|XP_002269954.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      150   5e-40   
ref|XP_002270023.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      150   5e-40   Vitis vinifera
ref|XP_003634618.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    149   8e-40   
emb|CBI17039.3|  unnamed protein product                                150   1e-39   Vitis vinifera
ref|XP_003540598.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    149   1e-39   Glycine max [soybeans]
ref|XP_011025293.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    149   1e-39   Populus euphratica
ref|XP_004228885.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    149   1e-39   Solanum lycopersicum
gb|KFK24691.1|  hypothetical protein AALP_AA8G012100                    143   1e-39   Arabis alpina [alpine rockcress]
emb|CBI17044.3|  unnamed protein product                                149   1e-39   Vitis vinifera
ref|XP_004141631.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    149   1e-39   
ref|XP_011069567.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    149   2e-39   Sesamum indicum [beniseed]
gb|AFK43830.1|  unknown                                                 148   2e-39   Lotus japonicus
emb|CAN71995.1|  hypothetical protein VITISV_023484                     148   2e-39   Vitis vinifera
ref|XP_010246810.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    148   3e-39   Nelumbo nucifera [Indian lotus]
gb|KGN52650.1|  hypothetical protein Csa_5G648710                       148   3e-39   Cucumis sativus [cucumbers]
ref|XP_004141536.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    148   3e-39   
ref|XP_002272567.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 5      147   4e-39   Vitis vinifera
gb|KDP28371.1|  hypothetical protein JCGZ_14142                         147   5e-39   Jatropha curcas
ref|XP_002302695.1|  hypothetical protein POPTR_0002s18530g             147   5e-39   Populus trichocarpa [western balsam poplar]
ref|XP_009410508.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 8      147   7e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002528703.1|  hydrolase, hydrolyzing O-glycosyl compounds,...    148   7e-39   Ricinus communis
ref|XP_006836841.1|  hypothetical protein AMTR_s00099p00070100          147   9e-39   Amborella trichopoda
gb|EEE63239.1|  hypothetical protein OsJ_18049                          147   1e-38   Oryza sativa Japonica Group [Japonica rice]
sp|Q9LW44.3|MANP_ARATH  RecName: Full=Putative mannan endo-1,4-be...    146   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004164540.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    146   1e-38   
ref|XP_004962462.1|  PREDICTED: LOW QUALITY PROTEIN: putative man...    147   2e-38   
ref|XP_006300114.1|  hypothetical protein CARUB_v10016343mg             146   2e-38   
ref|XP_011090525.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    145   2e-38   Sesamum indicum [beniseed]
ref|XP_003548330.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    146   2e-38   
sp|Q5W6G0.2|MAN5_ORYSJ  RecName: Full=Putative mannan endo-1,4-be...    146   3e-38   Oryza sativa Japonica Group [Japonica rice]
gb|EPS60450.1|  mannan endo-1,4-beta-mannosidase 2                      140   3e-38   Genlisea aurea
gb|AAV44080.1|  hypothetical protein                                    146   3e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007216338.1|  hypothetical protein PRUPE_ppa020168mg             145   3e-38   
ref|XP_006655193.1|  PREDICTED: putative mannan endo-1,4-beta-man...    146   3e-38   
ref|XP_006599739.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    146   3e-38   Glycine max [soybeans]
ref|XP_009803520.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   4e-38   Nicotiana sylvestris
ref|XP_002466346.1|  hypothetical protein SORBIDRAFT_01g006080          146   4e-38   Sorghum bicolor [broomcorn]
ref|XP_008456477.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      145   4e-38   Cucumis melo [Oriental melon]
ref|XP_003552321.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    145   5e-38   Glycine max [soybeans]
gb|ACU19893.1|  unknown                                                 145   5e-38   Glycine max [soybeans]
gb|AED01931.1|  Mannan endo-1,4-beta-mannosidase                        141   5e-38   Lepidium sativum
gb|KHN42134.1|  Mannan endo-1,4-beta-mannosidase 6                      144   6e-38   Glycine soja [wild soybean]
ref|XP_010496823.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   8e-38   
ref|XP_006576282.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   8e-38   
ref|XP_003522088.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   8e-38   
ref|XP_010914857.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   9e-38   
ref|XP_004149910.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    145   9e-38   
ref|XP_006576280.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   9e-38   
ref|XP_006576281.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    144   9e-38   
ref|XP_002454605.1|  hypothetical protein SORBIDRAFT_04g034200          144   1e-37   
ref|XP_010038521.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    143   1e-37   
gb|KJB29839.1|  hypothetical protein B456_005G120600                    144   1e-37   
emb|CDP06381.1|  unnamed protein product                                144   2e-37   
ref|NP_001146694.1|  putative endo-1,4-beta-mannosidase family pr...    142   2e-37   
gb|AFW74407.1|  putative endo-1,4-beta-mannosidase family protein       144   2e-37   
ref|XP_006279332.1|  hypothetical protein CARUB_v10012718mg             143   2e-37   
tpg|DAA58240.1|  TPA: putative endo-1,4-beta-mannosidase family p...    143   2e-37   
ref|XP_004492573.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    143   3e-37   
ref|XP_007134568.1|  hypothetical protein PHAVU_010G058300g             143   3e-37   
ref|XP_007134569.1|  hypothetical protein PHAVU_010G058300g             143   3e-37   
gb|KEH23282.1|  mannan endo-1,4-beta-mannosidase                        143   3e-37   
gb|KEH23283.1|  mannan endo-1,4-beta-mannosidase                        143   3e-37   
gb|KHN29491.1|  Mannan endo-1,4-beta-mannosidase 6                      143   4e-37   
ref|XP_008648425.1|  PREDICTED: LOW QUALITY PROTEIN: putative man...    143   4e-37   
gb|KHN12618.1|  Mannan endo-1,4-beta-mannosidase 4                      140   4e-37   
ref|XP_008664308.1|  PREDICTED: LOW QUALITY PROTEIN: putative man...    142   4e-37   
gb|ACG41070.1|  1,4-beta-D-mannan endohydrolase precursor               142   5e-37   
ref|XP_003626162.1|  Mannan endo-1,4-beta-mannosidase                   142   5e-37   
ref|XP_011018989.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    142   5e-37   
ref|XP_007033493.1|  Mannan endo-1,4-beta-mannosidase 6 isoform 2       140   5e-37   
gb|KCW46727.1|  hypothetical protein EUGRSUZ_K00550                     141   5e-37   
gb|AFX59322.1|  endo-1,4-beta-mannanase                                 142   7e-37   
ref|XP_010543149.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    142   7e-37   
ref|XP_002323680.2|  hypothetical protein POPTR_0016s14550g             142   7e-37   
gb|KJB71480.1|  hypothetical protein B456_011G124800                    142   8e-37   
ref|XP_011001681.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    142   8e-37   
dbj|BAD17132.1|  putative (1-4)-beta-mannan endohydrolase               141   8e-37   
gb|KDP21853.1|  hypothetical protein JCGZ_00640                         142   8e-37   
ref|XP_010543147.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    142   8e-37   
ref|XP_010327703.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    142   9e-37   
ref|XP_011018982.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    142   9e-37   
ref|XP_010543148.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    142   9e-37   
ref|NP_001048226.2|  Os02g0766900                                       141   1e-36   
ref|XP_010922771.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    142   1e-36   
ref|NP_001145882.1|  uncharacterized protein LOC100279398 precursor     141   1e-36   
ref|XP_010922772.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    141   1e-36   
ref|XP_010327704.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   1e-36   
ref|XP_010683461.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      141   1e-36   
ref|XP_009614142.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    141   1e-36   
ref|XP_007140064.1|  hypothetical protein PHAVU_008G081200g             141   2e-36   
ref|XP_002870892.1|  hypothetical protein ARALYDRAFT_349416             141   2e-36   
ref|XP_006398561.1|  hypothetical protein EUTSA_v10013730mg             140   2e-36   
ref|XP_004249033.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    141   2e-36   
ref|XP_010921182.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    141   2e-36   
ref|XP_009774301.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    141   2e-36   
ref|XP_009774302.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    141   2e-36   
gb|KDO64139.1|  hypothetical protein CISIN_1g012093mg                   140   2e-36   
ref|XP_009614143.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   2e-36   
gb|KDO64137.1|  hypothetical protein CISIN_1g012093mg                   140   2e-36   
ref|XP_009614144.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   2e-36   
ref|NP_195813.1|  mannan endo-1,4-beta-mannosidase 6                    140   2e-36   
gb|AAN34823.1|  endo-beta-mannanase                                     140   2e-36   
ref|XP_010653331.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   2e-36   
gb|KHG08771.1|  Mannan endo-1,4-beta-mannosidase 6 -like protein        140   2e-36   
dbj|BAJ34043.1|  unnamed protein product                                140   2e-36   
ref|XP_010921181.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   2e-36   
ref|XP_010043514.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   3e-36   
ref|XP_010921180.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   3e-36   
ref|XP_007033492.1|  Mannan endo-1,4-beta-mannosidase 6 isoform 1       140   3e-36   
gb|KHN14221.1|  Mannan endo-1,4-beta-mannosidase 1                      139   3e-36   
ref|XP_009774303.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   3e-36   
ref|XP_008244712.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      140   3e-36   
ref|XP_008799988.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   3e-36   
gb|KDO64138.1|  hypothetical protein CISIN_1g012093mg                   140   4e-36   
ref|XP_009391672.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   4e-36   
ref|XP_008782689.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   4e-36   
ref|XP_002273389.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   4e-36   
ref|XP_010653330.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   4e-36   
emb|CBI18019.3|  unnamed protein product                                140   4e-36   
ref|XP_003521650.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   4e-36   
ref|XP_003534636.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   5e-36   
ref|XP_006362338.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   5e-36   
gb|KEH23290.1|  mannan endo-1,4-beta-mannosidase-like protein           139   5e-36   
ref|NP_001051777.1|  Os03g0828500                                       139   6e-36   
ref|XP_011095155.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   6e-36   
gb|EYU42035.1|  hypothetical protein MIMGU_mgv1a005847mg                140   6e-36   
ref|XP_008359828.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    140   6e-36   
ref|XP_010424017.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   6e-36   
gb|EYU42036.1|  hypothetical protein MIMGU_mgv1a005847mg                139   7e-36   
ref|XP_006481220.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   7e-36   
ref|XP_009130618.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   8e-36   
ref|XP_006429615.1|  hypothetical protein CICLE_v10011654mg             139   8e-36   
emb|CDY11173.1|  BnaA03g00090D                                          139   8e-36   
ref|XP_004302566.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   8e-36   
ref|XP_010043507.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   8e-36   
ref|XP_010490492.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   9e-36   
ref|XP_009130619.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   9e-36   
ref|XP_010424014.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   1e-35   
ref|XP_011095154.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   1e-35   
ref|XP_010424015.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   1e-35   
ref|XP_010522866.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   1e-35   
gb|EMT21292.1|  Putative mannan endo-1,4-beta-mannosidase 9             137   1e-35   
ref|XP_011466411.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    138   1e-35   
ref|XP_010522865.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    138   1e-35   
ref|XP_011466409.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   1e-35   
gb|EYU30896.1|  hypothetical protein MIMGU_mgv1a0228142mg               135   2e-35   
ref|XP_002309191.2|  hypothetical protein POPTR_0006s11040g             139   2e-35   
emb|CBI18021.3|  unnamed protein product                                137   2e-35   
ref|XP_011018983.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    138   2e-35   
ref|XP_008370277.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    138   2e-35   
ref|XP_011018984.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    138   3e-35   
ref|XP_011018985.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   3e-35   
ref|XP_008370275.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    138   3e-35   
ref|XP_004955228.1|  PREDICTED: putative mannan endo-1,4-beta-man...    137   3e-35   
ref|XP_007207326.1|  hypothetical protein PRUPE_ppa005849mg             137   4e-35   
ref|XP_011018981.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   4e-35   
ref|XP_002273230.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   5e-35   
ref|XP_008788512.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   5e-35   
ref|XP_004510098.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    139   5e-35   
gb|EMS67718.1|  Mannan endo-1,4-beta-mannosidase 2                      137   6e-35   
ref|XP_009416974.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    137   9e-35   
ref|XP_009370900.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    136   1e-34   
ref|XP_009370901.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    136   1e-34   
ref|XP_003626672.1|  Mannan endo-1,4-beta-mannosidase                   136   1e-34   
ref|XP_003626642.1|  Mannan endo-1,4-beta-mannosidase                   136   1e-34   
ref|XP_010244546.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      136   1e-34   
gb|KEH17803.1|  mannan endo-1,4-beta-mannosidase-like protein           135   2e-34   
gb|AET01118.2|  mannan endo-1,4-beta-mannosidase-like protein           135   2e-34   
gb|AET01148.2|  mannan endo-1,4-beta-mannosidase-like protein           135   2e-34   
dbj|BAJ87988.1|  predicted protein                                      135   3e-34   
ref|XP_010227426.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    135   3e-34   
ref|XP_006649074.1|  PREDICTED: putative mannan endo-1,4-beta-man...    134   6e-34   
ref|XP_009337787.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 6      134   6e-34   
ref|XP_006644697.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    134   7e-34   
ref|XP_003569799.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    133   1e-33   
ref|XP_009407060.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    130   2e-33   
ref|XP_004981145.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    132   2e-33   
dbj|BAK05001.1|  predicted protein                                      132   2e-33   
gb|AAL79758.1|AC096687_22  putative endohydrolase                       132   3e-33   
gb|EEC76450.1|  hypothetical protein OsI_14158                          132   3e-33   
ref|NP_001044230.2|  Os01g0746700                                       132   4e-33   
gb|EAZ29139.1|  hypothetical protein OsJ_13202                          132   4e-33   
gb|EAZ13519.1|  hypothetical protein OsJ_03436                          131   4e-33   
ref|XP_002988915.1|  hypothetical protein SELMODRAFT_129038             131   4e-33   
gb|EAY75800.1|  hypothetical protein OsI_03716                          131   4e-33   
gb|EMT21291.1|  Putative mannan endo-1,4-beta-mannosidase 9             131   6e-33   
gb|ABC87082.1|  1,4-beta-D-mannan endohydrolase precursor               130   9e-33   
ref|XP_002463596.1|  hypothetical protein SORBIDRAFT_01g002630          130   1e-32   
ref|XP_002974905.1|  hypothetical protein SELMODRAFT_232427             130   1e-32   
dbj|BAK02230.1|  predicted protein                                      130   2e-32   
ref|XP_008665710.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   2e-32   
gb|KHN31990.1|  Mannan endo-1,4-beta-mannosidase 2                      129   2e-32   
ref|XP_008665709.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    130   2e-32   
gb|KHN43394.1|  Mannan endo-1,4-beta-mannosidase 4                      128   2e-32   
ref|XP_003539924.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   3e-32   
ref|XP_004487276.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   3e-32   
ref|XP_007132717.1|  hypothetical protein PHAVU_011G118900g             129   3e-32   
ref|XP_008804040.1|  PREDICTED: putative mannan endo-1,4-beta-man...    128   3e-32   
gb|KHN35251.1|  Mannan endo-1,4-beta-mannosidase 2                      129   4e-32   
ref|XP_003527431.2|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    129   4e-32   
ref|XP_002458478.1|  hypothetical protein SORBIDRAFT_03g034420          129   5e-32   
gb|KJB31674.1|  hypothetical protein B456_005G201100                    128   6e-32   
gb|KHG04578.1|  Mannan endo-1,4-beta-mannosidase 2 -like protein        128   6e-32   
ref|XP_009119647.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      128   7e-32   
emb|CDX89985.1|  BnaA10g00970D                                          128   7e-32   
ref|XP_004969933.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    128   7e-32   
ref|XP_007163300.1|  hypothetical protein PHAVU_001G223100g             127   9e-32   
ref|XP_004977393.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   9e-32   
ref|XP_006839096.1|  hypothetical protein AMTR_s00090p00128510          127   9e-32   
ref|XP_006412972.1|  hypothetical protein EUTSA_v10025261mg             127   1e-31   
ref|XP_003573047.1|  PREDICTED: putative mannan endo-1,4-beta-man...    127   2e-31   
ref|XP_002892099.1|  hypothetical protein ARALYDRAFT_470192             127   2e-31   
ref|XP_004505577.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    127   2e-31   
ref|XP_010260197.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    126   3e-31   
ref|XP_010260194.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    126   3e-31   
ref|XP_010260196.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    126   3e-31   
gb|KDP24127.1|  hypothetical protein JCGZ_25784                         126   4e-31   
ref|XP_010540874.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      126   4e-31   
ref|NP_001130322.1|  uncharacterized protein LOC100191416               126   4e-31   
gb|KFK35900.1|  hypothetical protein AALP_AA4G051000                    126   4e-31   
emb|CDY15229.1|  BnaC05g01080D                                          125   5e-31   
gb|KJB79973.1|  hypothetical protein B456_013G075700                    125   5e-31   
ref|XP_006663750.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    125   6e-31   
ref|NP_171733.2|  mannan endo-1,4-beta-mannosidase 1                    125   6e-31   
ref|XP_009793291.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    125   7e-31   
ref|XP_009590206.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    125   9e-31   
ref|XP_008669933.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    125   9e-31   
ref|XP_006304532.1|  hypothetical protein CARUB_v10011405mg             125   1e-30   
ref|XP_010089553.1|  Mannan endo-1,4-beta-mannosidase 2                 125   1e-30   
ref|XP_006418357.1|  hypothetical protein EUTSA_v10007769mg             124   1e-30   
ref|XP_010915914.1|  PREDICTED: LOW QUALITY PROTEIN: mannan endo-...    125   1e-30   
ref|XP_007043603.1|  Glycosyl hydrolase superfamily protein             125   1e-30   
gb|EYU24916.1|  hypothetical protein MIMGU_mgv1a007803mg                124   1e-30   
ref|XP_002985658.1|  hypothetical protein SELMODRAFT_234867             124   1e-30   
ref|XP_009144379.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    124   1e-30   
emb|CDY18983.1|  BnaC01g20850D                                          124   2e-30   
ref|XP_010526516.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    124   2e-30   
ref|XP_009144375.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    124   2e-30   
ref|XP_010272456.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    124   2e-30   
ref|NP_001065595.1|  Os11g0118200                                       120   2e-30   
ref|XP_007198827.1|  hypothetical protein PRUPE_ppa005783mg             124   2e-30   
ref|XP_009413849.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    124   2e-30   
ref|XP_010457203.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    124   2e-30   
ref|XP_002974285.1|  hypothetical protein SELMODRAFT_101525             123   3e-30   
gb|KEH39139.1|  glycoside hydrolase family 5 protein                    123   3e-30   
ref|XP_001760262.1|  predicted protein                                  123   3e-30   
ref|XP_007134664.1|  hypothetical protein PHAVU_010G065900g             117   4e-30   
ref|XP_008229003.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    123   4e-30   
ref|XP_011037345.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    123   4e-30   
ref|XP_007152175.1|  hypothetical protein PHAVU_004G108000g             123   4e-30   
ref|XP_009757172.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    123   4e-30   
ref|XP_006878501.1|  hypothetical protein AMTR_s00011p00202020          123   5e-30   
ref|XP_004139946.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    123   5e-30   
gb|KHN27892.1|  Mannan endo-1,4-beta-mannosidase 2                      122   5e-30   
ref|XP_009588484.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    123   5e-30   
ref|XP_008448293.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 2      123   5e-30   
ref|XP_010480869.1|  PREDICTED: mannan endo-1,4-beta-mannosidase 1      122   7e-30   
gb|KDO53904.1|  hypothetical protein CISIN_1g014151mg                   122   7e-30   
ref|XP_002983364.1|  hypothetical protein SELMODRAFT_234217             121   7e-30   
ref|XP_003540365.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    122   7e-30   
ref|XP_009421284.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    122   8e-30   
ref|XP_011100262.1|  PREDICTED: mannan endo-1,4-beta-mannosidase ...    122   8e-30   
ref|XP_006447301.1|  hypothetical protein CICLE_v10015394mg             122   8e-30   



>ref|XP_009619497.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
tomentosiformis]
Length=434

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRGIHFM+NG  FYANGFNAYWLMYVASDPSQR KVS AFR ASSHGLTVART
Sbjct  26   AGDGFIRTRGIHFMLNGDLFYANGFNAYWLMYVASDPSQRSKVSAAFREASSHGLTVART  85

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGY+ LQYAPGSYNED+FKGLDFVI+EAR+YG+KV+LSLANNYESFGG
Sbjct  86   WAFSDGGYKPLQYAPGSYNEDMFKGLDFVISEARRYGIKVVLSLANNYESFGG  138



>ref|XP_006340651.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Solanum tuberosum]
Length=433

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             +QQ  L   V+A G+GFI+TRGIHFM+NG  FYANGFNAYWLMY+A+DPSQR KV++AF
Sbjct  14   LLQQVCLFVQVEA-GDGFIRTRGIHFMLNGDPFYANGFNAYWLMYIAADPSQRSKVTDAF  72

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R ASSHGLTVARTWAFSDGGYR LQYAPGSYNED+FKGLDFVI+EAR++G+KVILS ANN
Sbjct  73   REASSHGLTVARTWAFSDGGYRPLQYAPGSYNEDMFKGLDFVISEARRHGIKVILSFANN  132

Query  460  YESFGG  477
            YESFGG
Sbjct  133  YESFGG  138



>ref|XP_004232427.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Solanum lycopersicum]
Length=434

 Score =   208 bits (530),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRGIHFM+NG  FYANGFNAYWLMY+A+DPSQR KV++AFR ASSHGLTVART
Sbjct  26   AGDGFIRTRGIHFMLNGDPFYANGFNAYWLMYIAADPSQRSKVTDAFREASSHGLTVART  85

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQYAPGSYNED+FKGLDFVI+EAR+YG+KVILS ANNYESFGG
Sbjct  86   WAFSDGGYRPLQYAPGSYNEDMFKGLDFVISEARRYGIKVILSFANNYESFGG  138



>ref|XP_009762330.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
sylvestris]
Length=434

 Score =   206 bits (523),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRGIHFM+NG  FYANGFNAYWLMYVASDPSQR KVS AF+ ASSHGLTVART
Sbjct  26   AGDGFIRTRGIHFMLNGDPFYANGFNAYWLMYVASDPSQRSKVSAAFKEASSHGLTVART  85

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGY+ LQYAPGSYN D+FKGLDFVI+EAR+YG+KV+LSLANNYESFGG
Sbjct  86   WAFSDGGYKPLQYAPGSYNADMFKGLDFVISEARRYGMKVVLSLANNYESFGG  138



>ref|XP_003612065.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES95023.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=438

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V Q   + +V+AAG+GF++TRGIHFM+NG  +YANGFNAYWLMY ASDPSQR+KVS AF
Sbjct  14   LVHQECFNINVEAAGDGFVRTRGIHFMLNGNPYYANGFNAYWLMYTASDPSQRFKVSNAF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R A+SHGLTVARTWAFSDGGY  LQY+PG YNE +FKGLDFVI+EARK+G+K+ILSL NN
Sbjct  74   REATSHGLTVARTWAFSDGGYSPLQYSPGFYNEQMFKGLDFVISEARKHGIKLILSLVNN  133

Query  460  YESFGG  477
            YESFGG
Sbjct  134  YESFGG  139



>ref|XP_008241714.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Prunus mume]
Length=433

 Score =   202 bits (515),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFN YWLMYVASDPSQRYKVS  FR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFLLNGSPYYANGFNGYWLMYVASDPSQRYKVSSVFREATSHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQY+PGSYNE +FKGLDFVIAEAR+YG+K+ILSL NNYESFGG
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQMFKGLDFVIAEARRYGIKLILSLVNNYESFGG  137



>gb|ABY58035.1| mannase [Prunus salicina]
Length=433

 Score =   202 bits (515),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFN YWLMYVASDPSQRYKVS  FR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFLLNGSPYYANGFNGYWLMYVASDPSQRYKVSSVFREATSHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQY+PGSYNE +FKGLDFVIAEAR+YG+K+ILSL NNYESFGG
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQLFKGLDFVIAEARRYGIKLILSLVNNYESFGG  137



>ref|XP_007202078.1| hypothetical protein PRUPE_ppa005992mg [Prunus persica]
 gb|EMJ03277.1| hypothetical protein PRUPE_ppa005992mg [Prunus persica]
Length=433

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFN YWLMYVASDPSQRYKVS  FR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFLLNGSPYYANGFNGYWLMYVASDPSQRYKVSSVFREATSHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQY+PGSYNE +FKGLDFVIAEAR+YG+K+ILSL NNYESFGG
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQMFKGLDFVIAEARRYGIKLILSLVNNYESFGG  137



>gb|ABV32548.1| endo-1,4-beta-mannosidase protein 2 [Prunus persica]
Length=433

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFN YWLMYVASDPSQRYKVS  FR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFLLNGSPYYANGFNGYWLMYVASDPSQRYKVSSVFREATSHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQY+PGSYNE +FKGLDFVIAEAR+YG+K+ILSL NNYESFGG
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQMFKGLDFVIAEARRYGIKLILSLVNNYESFGG  137



>ref|XP_010029765.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Eucalyptus grandis]
 gb|KCW56722.1| hypothetical protein EUGRSUZ_I02413 [Eucalyptus grandis]
Length=427

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  103  VQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFR  282
            + Q+     +  AG+GF++ RGIHFM+NG  +YANGFNAYWLMY+ASDPSQR++VS AFR
Sbjct  14   IHQACFHARLVEAGDGFVRARGIHFMLNGSPYYANGFNAYWLMYMASDPSQRHQVSAAFR  73

Query  283  GASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNY  462
             ASSHGLTVARTWAFSDGGYR LQY+PGSYNE +F+GLDFVIAEAR+YG+K+ILSL N+Y
Sbjct  74   EASSHGLTVARTWAFSDGGYRPLQYSPGSYNEQMFQGLDFVIAEARRYGIKLILSLVNDY  133

Query  463  ESFGG  477
            E+FGG
Sbjct  134  ENFGG  138



>ref|XP_009347596.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
7-like [Pyrus x bretschneideri]
 ref|XP_009347607.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
7-like [Pyrus x bretschneideri]
Length=436

 Score =   200 bits (509),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +1

Query  106  QQSSLSG-SVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFR  282
            QQ  +S   V AAG+ FI+ RG+HF++NG  +YANGFN YWLMYVASDPSQR+KVS AFR
Sbjct  16   QQCFISPIHVSAAGDDFIRVRGVHFLLNGSPYYANGFNGYWLMYVASDPSQRHKVSSAFR  75

Query  283  GASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNY  462
             A+SHGLTVARTWAFSDGGYR LQ++PGSYNE +FKGLDFVIAEAR+YG+K+ILSL NNY
Sbjct  76   EATSHGLTVARTWAFSDGGYRPLQFSPGSYNEQMFKGLDFVIAEARRYGIKLILSLVNNY  135

Query  463  ESFGG  477
            ESFGG
Sbjct  136  ESFGG  140



>gb|KDP44593.1| hypothetical protein JCGZ_22175 [Jatropha curcas]
Length=434

 Score =   200 bits (509),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = +1

Query  106  QQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRG  285
            QQ +    VKA G+ FI+TRG HF +NG  +YANGFNAYWLMY+ASDPSQRYKVS AF  
Sbjct  16   QQGNFHIHVKA-GDSFIRTRGTHFFLNGNPYYANGFNAYWLMYIASDPSQRYKVSSAFHE  74

Query  286  ASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            A+SHGL+VARTWAFSDGGYR LQY+PGSYNE +FKGLDFVIAEARKYG+K+ILSLANNYE
Sbjct  75   AASHGLSVARTWAFSDGGYRPLQYSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANNYE  134

Query  466  SFGG  477
            SFGG
Sbjct  135  SFGG  138



>ref|XP_010254774.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nelumbo nucifera]
Length=433

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +1

Query  103  VQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFR  282
            +QQ +    V+A  +GF++TRG+ FM+NG  +YANGFNAYWLMYVASDPSQR KVS AF+
Sbjct  14   IQQRNFLIQVEAQ-DGFVRTRGMRFMLNGSPYYANGFNAYWLMYVASDPSQRSKVSSAFQ  72

Query  283  GASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNY  462
             ASSHGLTVARTWAFSDGGY+ LQYAPGSYNE++FKGLDFVI+EAR+YG+K+ILSLANNY
Sbjct  73   QASSHGLTVARTWAFSDGGYKPLQYAPGSYNEEMFKGLDFVISEARRYGIKLILSLANNY  132

Query  463  ESFGG  477
            ESFGG
Sbjct  133  ESFGG  137



>emb|CDP01989.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GF++T GIHFM+N   +YANGFNAYWLMYVASDPSQR KVS AFR ASSHGLTVART
Sbjct  25   AGDGFVRTGGIHFMLNNGPYYANGFNAYWLMYVASDPSQRSKVSAAFREASSHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DGGYRALQYAPG+YNE  FKGLDFV+AEAR+YG+K+ILSLANNYESFGG
Sbjct  85   WAFNDGGYRALQYAPGAYNEQTFKGLDFVVAEARRYGIKLILSLANNYESFGG  137



>ref|XP_003517214.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=431

 Score =   197 bits (502),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V Q     SV+A  + F++TRGIHFM+NGY +YANGFNAYWLMY ASDPSQR+KVS AF
Sbjct  13   LVPQECFHVSVEARDD-FVRTRGIHFMLNGYPYYANGFNAYWLMYTASDPSQRFKVSNAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R A+SHGLTVARTWAFSDGGYR LQY+PG YNE +F GLDFV++EARKYG+K+ILSL NN
Sbjct  72   REAASHGLTVARTWAFSDGGYRPLQYSPGFYNEQMFTGLDFVVSEARKYGIKLILSLVNN  131

Query  460  YESFGG  477
            YE+FGG
Sbjct  132  YENFGG  137



>ref|XP_010113415.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
 gb|EXC35442.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
Length=436

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +1

Query  58   MKHlgllaallailFVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYV  237
            MKH  L   L+ IL  QQ SL   V+A  +GFI+T G HF++NG  +YANGFNAYWLMY+
Sbjct  1    MKHFRLAILLVVILVHQQISLHSFVEARNDGFIRTWGHHFVLNGNPYYANGFNAYWLMYM  60

Query  238  ASDPSQRYKVSEAFRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEA  417
            ASDPSQRY VS A + ASSHGLTVARTWAFSDGGYR LQYAPGSYNE  FKGLDFV+AEA
Sbjct  61   ASDPSQRYLVSNALKEASSHGLTVARTWAFSDGGYRPLQYAPGSYNEQTFKGLDFVVAEA  120

Query  418  RKYGLKVILSLANNYESFGG  477
            RK+G+K+ILSL NNYE+FGG
Sbjct  121  RKHGIKLILSLVNNYENFGG  140



>ref|XP_002264115.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Vitis vinifera]
 emb|CBI17484.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFNAYWLMY+ASDPSQR KVS AFR ASSHGLTVART
Sbjct  25   AGDGFIRTRGVHFVMNGSPYYANGFNAYWLMYLASDPSQRAKVSAAFREASSHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQY+PG YN+ +FKGLDFV+AEAR+YG+K+ILSL NNYESFGG
Sbjct  85   WAFSDGGYRPLQYSPGFYNQQMFKGLDFVVAEARRYGIKLILSLVNNYESFGG  137



>gb|KDO70993.1| hypothetical protein CISIN_1g013811mg [Citrus sinensis]
Length=436

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            F+ + S +     AG+GFI+TRG HF++NG  ++ANGFNAYWLMYVASDPSQR KVS AF
Sbjct  15   FIHRQSFNVLHVEAGDGFIRTRGSHFLLNGNLYFANGFNAYWLMYVASDPSQRSKVSTAF  74

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
              A+SHGLTVARTWAFSDGGYR LQ +PGSYNE +FKGLDFVIAEARKYG+K+ILSLANN
Sbjct  75   HEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANN  134

Query  460  YESFGG  477
            Y+SFGG
Sbjct  135  YDSFGG  140



>ref|XP_006466833.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Citrus sinensis]
Length=436

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            F+ + S +     AG+GFI+TRG HF++NG  ++ANGFNAYWLMYVASDPSQR KVS AF
Sbjct  15   FIHRQSFNVLHVEAGDGFIRTRGSHFLLNGNLYFANGFNAYWLMYVASDPSQRSKVSTAF  74

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
              A+SHGLTVARTWAFSDGGYR LQ +PGSYNE +FKGLDFVIAEARKYG+K+ILSLANN
Sbjct  75   HEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANN  134

Query  460  YESFGG  477
            Y+SFGG
Sbjct  135  YDSFGG  140



>ref|XP_004512071.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cicer arietinum]
Length=424

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 105/118 (89%), Gaps = 1/118 (1%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            GSV+A G+GF++TRGIHFM+NG  +YANGFNAYWLMY ASDPSQRYKVS AF  A+SHGL
Sbjct  17   GSVEA-GDGFVRTRGIHFMLNGNPYYANGFNAYWLMYTASDPSQRYKVSNAFHEATSHGL  75

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TVARTWAFSDGGY  LQY+PG YNE +FKGLDFVI+EARKY +K+ILSL NNYESFGG
Sbjct  76   TVARTWAFSDGGYSPLQYSPGFYNEQMFKGLDFVISEARKYKIKLILSLVNNYESFGG  133



>ref|XP_006383170.1| (1-4)-beta-mannan endohydrolase family protein [Populus trichocarpa]
 gb|ABK95661.1| unknown [Populus trichocarpa]
 gb|ERP60967.1| (1-4)-beta-mannan endohydrolase family protein [Populus trichocarpa]
Length=435

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFNAYWLMY ASDPSQR KVS AFR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFLLNGSPYYANGFNAYWLMYTASDPSQRPKVSAAFREAASHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQY+PGSYNE +FKGLDFV+AEAR YG+K+ILS ANNY+SFGG
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQMFKGLDFVVAEARSYGIKLILSFANNYDSFGG  137



>ref|XP_006425633.1| hypothetical protein CICLE_v10025631mg [Citrus clementina]
 gb|ESR38873.1| hypothetical protein CICLE_v10025631mg [Citrus clementina]
Length=436

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            F+ + S +     AG+GFI+TRG HF++NG  ++ANGFNAYWLMYVASDPSQR KVS AF
Sbjct  15   FIHRQSFNVLHVEAGDGFIRTRGSHFLLNGNLYFANGFNAYWLMYVASDPSQRSKVSTAF  74

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
              A+SHGLTVARTWAFSDGGYR LQ +PGSYNE +FKGLDFVIAEARKYG+K+ILSLANN
Sbjct  75   HEAASHGLTVARTWAFSDGGYRPLQRSPGSYNEQMFKGLDFVIAEARKYGIKLILSLANN  134

Query  460  YESFGG  477
            Y+SFGG
Sbjct  135  YDSFGG  140



>ref|XP_011015126.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=435

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFNAYWLMY ASDPSQR KVS AFR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFLLNGSPYYANGFNAYWLMYTASDPSQRPKVSAAFREAASHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQY+PGSYNE +FKGLDFV+AEAR YG+K+ILS ANNY+SFGG
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQMFKGLDFVVAEARSYGIKLILSFANNYDSFGG  137



>ref|XP_011013722.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=435

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF++NG  +YANGFNAYWLMY ASDPSQR KVS AFR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFLLNGSPYYANGFNAYWLMYTASDPSQRPKVSAAFREAASHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQY+PGSYNE +FKGLDFV+AEAR YG+K+ILS ANNY+SFGG
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQMFKGLDFVVAEARSYGIKLILSFANNYDSFGG  137



>ref|XP_007156980.1| hypothetical protein PHAVU_002G033500g [Phaseolus vulgaris]
 gb|ESW28974.1| hypothetical protein PHAVU_002G033500g [Phaseolus vulgaris]
Length=431

 Score =   196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 106/123 (86%), Gaps = 1/123 (1%)
 Frame = +1

Query  109  QSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGA  288
            Q     +V+A  +GF++TRGIHFM+NGY +Y NGFNAYWLMY ASDPSQR+KVS AFR A
Sbjct  16   QECFHATVEAR-DGFVRTRGIHFMLNGYPYYVNGFNAYWLMYTASDPSQRFKVSNAFREA  74

Query  289  SSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            +SHGLTVARTWAFSDGGYR LQY+PG YN+ +F GLDFVI+EARKYG+K+ILSL NNYE+
Sbjct  75   ASHGLTVARTWAFSDGGYRPLQYSPGFYNDQMFMGLDFVISEARKYGIKLILSLVNNYEN  134

Query  469  FGG  477
            FGG
Sbjct  135  FGG  137



>ref|XP_007046870.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046871.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046872.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046873.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91027.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91028.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91029.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91030.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
Length=433

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 108/123 (88%), Gaps = 1/123 (1%)
 Frame = +1

Query  109  QSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGA  288
            Q  LS  V+A  + FI+TRG+HF++NG  +YANGFNAYWLMYVASDPSQR KVS +FR A
Sbjct  16   QHLLSVQVEARDD-FIRTRGVHFLLNGNPYYANGFNAYWLMYVASDPSQRPKVSASFREA  74

Query  289  SSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            ++HGLTVARTWAFSDGGYR LQYAPGSYNE +FKGLDFVIAEAR+Y +K+ILSLANNYES
Sbjct  75   AAHGLTVARTWAFSDGGYRPLQYAPGSYNEQMFKGLDFVIAEARRYRIKLILSLANNYES  134

Query  469  FGG  477
            FGG
Sbjct  135  FGG  137



>gb|ACU18982.1| unknown [Glycine max]
Length=431

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V Q     SV+A  + F++ RGIHFM+NGY +YANGFNAYWLMY ASDPSQR+KVS AF
Sbjct  13   LVPQECFHVSVEARDD-FVRARGIHFMLNGYPYYANGFNAYWLMYTASDPSQRFKVSNAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R A+SHGLTVARTWAFSDGGYR LQY+PG YNE +F GLDFV++EARKYG+K+ILSL NN
Sbjct  72   REAASHGLTVARTWAFSDGGYRPLQYSPGFYNEQMFTGLDFVVSEARKYGIKLILSLVNN  131

Query  460  YESFGG  477
            YE+FGG
Sbjct  132  YENFGG  137



>gb|KHN36084.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=431

 Score =   195 bits (495),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V Q     SV+A  + F++TRGIHF +NGY +YANGFNAYWLMY ASDPSQR+KVS AF
Sbjct  13   LVPQECFHVSVEARDD-FVRTRGIHFTLNGYPYYANGFNAYWLMYTASDPSQRFKVSNAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R A+SHGLTVARTWAFSDGGYR LQY+PG YNE +F GLDFV++EARKYG+K+ILSL NN
Sbjct  72   REAASHGLTVARTWAFSDGGYRPLQYSPGFYNEQMFTGLDFVVSEARKYGIKLILSLVNN  131

Query  460  YESFGG  477
            YE+FGG
Sbjct  132  YENFGG  137



>ref|XP_002521547.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF40818.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=874

 Score =   200 bits (509),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+TRG+HF +NG  +YANGFNAYWLMY+ASDPSQR+KVS AFR A+SHGLTVART
Sbjct  25   AGDGFIRTRGVHFFLNGNPYYANGFNAYWLMYIASDPSQRHKVSTAFREAASHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQY+P SYNE +FKGLDFVIAEAR+YG+K+ILSL NNYE+FGG
Sbjct  85   WAFSDGGYRPLQYSPASYNEQMFKGLDFVIAEARRYGIKLILSLVNNYETFGG  137



>ref|XP_002865067.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41326.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=431

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G+   + NGF++T+G+ F +NGY +YANGFNAYWLMYVASDPSQR K+S AF+ AS HGL
Sbjct  22   GADALSSNGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPSQRSKISTAFQDASRHGL  81

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TVARTWAFSDGGYRALQY+PGSYNED+F+GLDF +AEAR++G+K+ILS ANNYESFGG
Sbjct  82   TVARTWAFSDGGYRALQYSPGSYNEDMFQGLDFALAEARRHGIKIILSFANNYESFGG  139



>ref|XP_009340713.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Pyrus x bretschneideri]
Length=436

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V AA + FI+ RG+HF++NG  +YANGFN YWLMYVASDPSQR+KVS  FR A+SHGLTV
Sbjct  25   VSAAVDNFIRVRGVHFLLNGSPYYANGFNGYWLMYVASDPSQRHKVSSVFREATSHGLTV  84

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            ARTWAFSDGGYR LQ++PG YNE +FKGLDFVIAEAR+YG+K+ILSL NNYESFGG
Sbjct  85   ARTWAFSDGGYRPLQFSPGLYNEQMFKGLDFVIAEARRYGIKLILSLVNNYESFGG  140



>ref|XP_003537602.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like isoform X1 
[Glycine max]
 gb|KHN41948.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=425

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V Q     SV+A  + F++TRGIHFM NGY +YANGFNAYWLMY ASDPSQR+KVS AF
Sbjct  13   LVPQECFHVSVEARDD-FVRTRGIHFMQNGYPYYANGFNAYWLMYTASDPSQRFKVSNAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R A+SHGLTVARTWAFSDGGYR LQY PG YNE +F GLDFV++EARKYG+K+ILSL NN
Sbjct  72   REAASHGLTVARTWAFSDGGYRPLQYFPGFYNEQMFTGLDFVVSEARKYGIKLILSLVNN  131

Query  460  YESFGG  477
            YE+FGG
Sbjct  132  YENFGG  137



>ref|XP_006590696.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like isoform X2 
[Glycine max]
Length=423

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V Q     SV+A  + F++TRGIHFM NGY +YANGFNAYWLMY ASDPSQR+KVS AF
Sbjct  13   LVPQECFHVSVEARDD-FVRTRGIHFMQNGYPYYANGFNAYWLMYTASDPSQRFKVSNAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            R A+SHGLTVARTWAFSDGGYR LQY PG YNE +F GLDFV++EARKYG+K+ILSL NN
Sbjct  72   REAASHGLTVARTWAFSDGGYRPLQYFPGFYNEQMFTGLDFVVSEARKYGIKLILSLVNN  131

Query  460  YESFGG  477
            YE+FGG
Sbjct  132  YENFGG  137



>gb|KHG22102.1| Mannan endo-1,4-beta-mannosidase 7 -like protein [Gossypium arboreum]
Length=434

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 1/123 (1%)
 Frame = +1

Query  109  QSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGA  288
            Q+ L+  V+A G+ F++TR +HF +NG  ++ANGFNAYWLMYVASDPSQR KVS AFR A
Sbjct  17   QNLLTVHVEA-GDDFVRTRRVHFFLNGNPYFANGFNAYWLMYVASDPSQRPKVSAAFREA  75

Query  289  SSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            ++HGLTVARTWAFSDGGYR LQYAPGSYNE +FKGLDFVIAEARKY +K+ILSLANNYES
Sbjct  76   AAHGLTVARTWAFSDGGYRPLQYAPGSYNEQMFKGLDFVIAEARKYRIKLILSLANNYES  135

Query  469  FGG  477
            FGG
Sbjct  136  FGG  138



>gb|KFK28321.1| hypothetical protein AALP_AA8G500900 [Arabis alpina]
Length=433

 Score =   193 bits (490),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 108/126 (86%), Gaps = 1/126 (1%)
 Frame = +1

Query  103  VQQSSLSGSVKAAG-NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQS     V A+  +GF++T+G+ F +NGY +YANGFNAYWLMYVASDPSQR K+S AF
Sbjct  14   IQQSYWDLRVDASSRDGFVRTKGVQFTLNGYPYYANGFNAYWLMYVASDPSQRPKISAAF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + ASSHGLTVARTWAFSDGGYR LQY+PGSYNED+F+GLDF IAEAR++G+K+ILS ANN
Sbjct  74   QEASSHGLTVARTWAFSDGGYRPLQYSPGSYNEDMFQGLDFAIAEARRHGIKIILSFANN  133

Query  460  YESFGG  477
            Y SFGG
Sbjct  134  YVSFGG  139



>ref|XP_010444793.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Camelina sativa]
Length=434

 Score =   192 bits (488),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +1

Query  103  VQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQS L  G+     +GF++T+G+ F +NGY FYANGFNAYWLMYV+SDPSQR K+S A 
Sbjct  14   IQQSCLELGADALPNDGFVRTKGVQFSLNGYPFYANGFNAYWLMYVSSDPSQRSKISAAL  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + AS HGLTVARTWAFSDGGYRALQ +PGSYNED+F+GLDF IAEAR++G+K+ILS ANN
Sbjct  74   QDASRHGLTVARTWAFSDGGYRALQSSPGSYNEDMFQGLDFAIAEARRHGIKIILSFANN  133

Query  460  YESFGG  477
            Y+SFGG
Sbjct  134  YDSFGG  139



>ref|NP_201447.1| mannan endo-1,4-beta-mannosidase 7 [Arabidopsis thaliana]
 sp|Q9FJZ3.1|MAN7_ARATH RecName: Full=Mannan endo-1,4-beta-mannosidase 7; AltName: Full=Beta-mannanase 
7; AltName: Full=Endo-beta-1,4-mannanase 7; 
Short=AtMAN7; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10922.1| mannan endo-1,4-beta-mannosidase [Arabidopsis thaliana]
 gb|AAN17429.1| mannan endo-1,4-beta-mannosidase [Arabidopsis thaliana]
 gb|AAP49511.1| At5g66460 [Arabidopsis thaliana]
 gb|AED98217.1| mannan endo-1,4-beta-mannosidase 7 [Arabidopsis thaliana]
Length=431

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G+      GF++T+G+ F +NGY +YANGFNAYWLMYVASDPSQR K+S AF+ AS HGL
Sbjct  22   GTDALPSGGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPSQRSKISTAFQDASRHGL  81

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TVARTWAFSDGGYRALQY+PGSYNED+F+GLDF +AEAR++G+K+ILS ANNYESFGG
Sbjct  82   TVARTWAFSDGGYRALQYSPGSYNEDMFQGLDFALAEARRHGIKIILSFANNYESFGG  139



>ref|XP_002310816.2| hypothetical protein POPTR_0007s13190g [Populus trichocarpa]
 gb|EEE91266.2| hypothetical protein POPTR_0007s13190g [Populus trichocarpa]
Length=435

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+ RG+ F++NG  +YANGFNAYWLMY ASDPSQR KVS AFR A+SHGLTVART
Sbjct  25   AGDGFIRARGVQFLLNGSPYYANGFNAYWLMYTASDPSQRSKVSAAFREAASHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGY  LQY+PGSYNE +FKGLDFVIAEAR+YG+K+ILSLANNY+SFGG
Sbjct  85   WAFSDGGYSPLQYSPGSYNEQMFKGLDFVIAEARRYGIKLILSLANNYDSFGG  137



>ref|XP_011025835.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Populus euphratica]
Length=435

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/113 (79%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+ RG+ F++NG  +YANGFNAYWLMY ASDPSQR KVS AFR A+SHGLTVART
Sbjct  25   AGDGFIRARGVQFLLNGSPYYANGFNAYWLMYTASDPSQRSKVSAAFREAASHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGY  LQY+PGSYNE +FKGLDFVIAEAR+YG+K+ILSLANNY+SFGG
Sbjct  85   WAFSDGGYSPLQYSPGSYNEQMFKGLDFVIAEARRYGIKLILSLANNYDSFGG  137



>ref|XP_011011941.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=435

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFI+ RG+ F++NG  +YANGFNAYWLMY ASDPSQR KVS AFR A+SHGLTVART
Sbjct  25   AGDGFIRARGVQFLLNGSPYYANGFNAYWLMYTASDPSQRSKVSAAFREAASHGLTVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQY+PGSYNE +FKGLDFV+AEAR YG+K+ILS ANNY+SFGG
Sbjct  85   WAFSDGGYRPLQYSPGSYNEQMFKGLDFVVAEARSYGIKLILSFANNYDSFGG  137



>emb|CDY45231.1| BnaA07g12590D [Brassica napus]
Length=469

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = +1

Query  100  FVQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEA  276
             +QQS L  G+   + +GF++T+G+ F +NGY +YANGFNAYWLMYVASDPSQR K+S A
Sbjct  13   LIQQSYLKLGTDAFSRDGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPSQRPKISAA  72

Query  277  FRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLAN  456
            F+ AS HGLTVARTWAFSDGGYR LQY+PGSYNED+F+GLDF IAEAR++G+K+ILS AN
Sbjct  73   FQEASRHGLTVARTWAFSDGGYRPLQYSPGSYNEDMFQGLDFAIAEARRHGIKIILSFAN  132

Query  457  NYESFGG  477
            NY SFGG
Sbjct  133  NYVSFGG  139



>ref|XP_011083199.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Sesamum indicum]
Length=433

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A + FI+TRGIHF +NG  FYANGFNAYWLMY+ASDPSQR KVS  FR A++HGLTVART
Sbjct  24   AADMFIRTRGIHFFLNGTPFYANGFNAYWLMYLASDPSQRPKVSAVFRQAAAHGLTVART  83

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQY+PG+YN+ +FKGLDFV+AEAR++G+K+ILSLANNY+SFGG
Sbjct  84   WAFSDGGYRPLQYSPGAYNQQMFKGLDFVVAEARRHGIKLILSLANNYDSFGG  136



>ref|XP_009112304.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Brassica 
rapa]
Length=431

 Score =   190 bits (482),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 108/126 (86%), Gaps = 1/126 (1%)
 Frame = +1

Query  103  VQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQS L  G+  ++ +GF++T+G+ F +NGY +YANGFNAYWLMYVASDP+QR K+S AF
Sbjct  14   IQQSYLKLGADASSRDGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPTQRPKISAAF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + AS HGLTVARTWAFSDGGYR LQY+PGSYNED+F+GLDF IAEAR+ G+K+ILS ANN
Sbjct  74   QEASRHGLTVARTWAFSDGGYRPLQYSPGSYNEDMFQGLDFAIAEARRNGIKIILSFANN  133

Query  460  YESFGG  477
            Y SFGG
Sbjct  134  YVSFGG  139



>ref|XP_010484638.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Camelina 
sativa]
Length=434

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = +1

Query  103  VQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQS L  G+     +GF++T+G+ F +NGY FYANG NAYWLMYV+SDPSQR K+S A 
Sbjct  14   IQQSCLELGADALPNDGFVRTKGVQFSLNGYPFYANGVNAYWLMYVSSDPSQRSKISAAL  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + AS HGLTVARTWAFSDGGYRALQ +PGSYNED+F+GLDF IAEAR +G+KVILS ANN
Sbjct  74   QDASRHGLTVARTWAFSDGGYRALQSSPGSYNEDMFQGLDFAIAEARSHGIKVILSCANN  133

Query  460  YESFGG  477
            Y+SFGG
Sbjct  134  YDSFGG  139



>ref|XP_006393839.1| hypothetical protein EUTSA_v10004263mg [Eutrema salsugineum]
 gb|ABB45852.1| hypothetical protein [Eutrema halophilum]
 gb|ESQ31125.1| hypothetical protein EUTSA_v10004263mg [Eutrema salsugineum]
Length=431

 Score =   189 bits (481),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 106/126 (84%), Gaps = 1/126 (1%)
 Frame = +1

Query  103  VQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQS    G+   + +GF++T+G+ F +NGY +YANGFNAYWLMYVASDPSQR K+S AF
Sbjct  14   IQQSYWELGADAFSSDGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPSQRSKISAAF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + AS HGLTVARTWAFSDGGYR LQY PGSYNED+F+GLDF IAEAR++G+KVILS ANN
Sbjct  74   QEASRHGLTVARTWAFSDGGYRPLQYTPGSYNEDMFQGLDFAIAEARRHGIKVILSFANN  133

Query  460  YESFGG  477
            Y SFGG
Sbjct  134  YVSFGG  139



>ref|XP_010263608.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nelumbo nucifera]
Length=451

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF++T G HF++NG  +YANGFNAYWLMY+ASDPSQR KVS AF+ AS+HGLTVART
Sbjct  43   AQSGFVRTSGPHFVLNGSPYYANGFNAYWLMYMASDPSQRSKVSSAFQEASTHGLTVART  102

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGY+ LQY+PGSYNE +F+GLDFVIAEAR+YG+K+ILSLANNYE+FGG
Sbjct  103  WAFSDGGYKPLQYSPGSYNEQMFRGLDFVIAEARRYGIKLILSLANNYENFGG  155



>ref|XP_009103527.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Brassica rapa]
Length=426

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 107/127 (84%), Gaps = 1/127 (1%)
 Frame = +1

Query  100  FVQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEA  276
             +QQS L  G+   + +GF++T+G+ F +NGY +YANGFNAYWLMYVASDPSQR K+S A
Sbjct  13   LIQQSYLKLGTDAFSRDGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPSQRPKISAA  72

Query  277  FRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLAN  456
            F+ AS HGLTVARTWAFSDGGYR LQY+PGSYNED+F+GLDF IAEAR++G+K+ILS A 
Sbjct  73   FQEASRHGLTVARTWAFSDGGYRPLQYSPGSYNEDMFQGLDFAIAEARRHGIKIILSFAT  132

Query  457  NYESFGG  477
            NY SFGG
Sbjct  133  NYVSFGG  139



>gb|KJB43465.1| hypothetical protein B456_007G201600 [Gossypium raimondii]
Length=1149

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 108/123 (88%), Gaps = 1/123 (1%)
 Frame = +1

Query  109  QSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGA  288
            Q+ L+  V+A G+ F++TR +HF +NG  ++ANGFNAYWLMYVASDPSQR KVS AFR A
Sbjct  17   QNLLTVHVEA-GDDFVRTRRVHFFLNGNPYFANGFNAYWLMYVASDPSQRPKVSTAFREA  75

Query  289  SSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            ++HGLTVARTWAFSDGGYR LQYAPGSYNE +FKGLDFVIAEARKY +K+ILSLANNYES
Sbjct  76   AAHGLTVARTWAFSDGGYRPLQYAPGSYNEQMFKGLDFVIAEARKYRIKLILSLANNYES  135

Query  469  FGG  477
            FGG
Sbjct  136  FGG  138



>gb|ACN78662.1| endo-beta-mannanase [Actinidia arguta]
Length=433

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+ FI+TRG HFM+NG  +YANGFNAYWLMY A+DPSQR KVS AFR AS+HGL+VART
Sbjct  25   AGDDFIRTRGTHFMLNGSPYYANGFNAYWLMYFATDPSQRGKVSAAFREASNHGLSVART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQ++PG YNE  FKGLDFV+AEAR+YG+K++LSL NNYESFGG
Sbjct  85   WAFSDGGYRPLQFSPGYYNEQAFKGLDFVVAEARRYGIKLVLSLVNNYESFGG  137



>gb|AGG82699.1| endo-1,4-beta-mannosidase [Morus alba var. multicaulis]
Length=420

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG+  ++NGY FYANGFNAYWLMY+ASDPSQR KVS AF+ A +HGL++ART
Sbjct  21   AEDGFVKTRGVQLVLNGYPFYANGFNAYWLMYIASDPSQRDKVSSAFQEAKNHGLSIART  80

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGY  LQY+PGSYNE VF+GLDFV++EARKYG+K++LS  NNYE+FGG
Sbjct  81   WAFSDGGYMPLQYSPGSYNEKVFQGLDFVVSEARKYGIKLVLSFVNNYENFGG  133



>ref|XP_008338221.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Malus domestica]
Length=436

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V AAG+ FI+ RG+HF++NG  +YANGFN YWLMYVASD SQR+KVS  F  A+SHGLTV
Sbjct  25   VSAAGDNFIRVRGVHFLLNGSPYYANGFNGYWLMYVASDXSQRHKVSSVFSEATSHGLTV  84

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            ARTWAFSDGGY  LQ +PGSYNE +FKGLDFVIAEAR+YG+K+ILSL NNYESFGG
Sbjct  85   ARTWAFSDGGYXPLQLSPGSYNEQMFKGLDFVIAEARRYGIKLILSLVNNYESFGG  140



>ref|XP_010550422.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Tarenaya hassleriana]
Length=426

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +1

Query  145  NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWA  324
            +GF++TRG+ F+INGY +YANGFNAYWLMY ASDPSQR+K+S+AFR AS  GL+VARTWA
Sbjct  29   DGFVRTRGVQFLINGYPYYANGFNAYWLMYEASDPSQRFKISDAFRDASRRGLSVARTWA  88

Query  325  FSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            FSD GYR LQ++PGSYNE +F+GLDFVI+EAR+YG+K+ILSL NNY+SFGG
Sbjct  89   FSDAGYRPLQFSPGSYNEQMFQGLDFVISEARRYGIKLILSLVNNYDSFGG  139



>ref|XP_010110051.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
 gb|EXC25069.1| Mannan endo-1,4-beta-mannosidase 7 [Morus notabilis]
Length=420

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG+  ++NGY FYANGFNAYWLMY+ASDPSQR KVS AF+ A +HGL++ART
Sbjct  21   AEDGFVKTRGVQLVLNGYPFYANGFNAYWLMYIASDPSQRDKVSSAFQEAKNHGLSIART  80

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGY  LQY+PGSYNE VF+GLDFV++EARKYG+K++LS  NNYE+FGG
Sbjct  81   WAFSDGGYMPLQYSPGSYNEKVFQGLDFVVSEARKYGIKLVLSFVNNYENFGG  133



>ref|XP_010465469.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Camelina 
sativa]
Length=433

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = +1

Query  103  VQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQSSL  G+     +GF++T+G+ F +NGY FYANGFNAYWLMY ++DPSQR K+S A 
Sbjct  15   IQQSSLELGADALPNDGFVRTKGVQFNLNGYPFYANGFNAYWLMYESADPSQRSKISAAL  74

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + AS HGLTVARTWAFSDGGYR LQ +PGSYNED+F+GLDF IAEAR +G+K+ILS ANN
Sbjct  75   QDASRHGLTVARTWAFSDGGYRPLQSSPGSYNEDMFQGLDFAIAEARSHGIKIILSFANN  134

Query  460  YESFGG  477
            Y+SFGG
Sbjct  135  YDSFGG  140



>emb|CDY68324.1| BnaCnng58510D [Brassica napus]
Length=823

 Score =   192 bits (487),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = +1

Query  100  FVQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEA  276
             +QQS L  G+   + +GF++T+G+ F +NGY +YANGFNAYWLMYVASDPSQR K+S A
Sbjct  13   LIQQSYLKLGADAFSRDGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPSQRPKISAA  72

Query  277  FRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLAN  456
            F+ AS HGLTVARTWAFSDGGYR LQY+PGSYNED+F+GLDF IAEAR++G+K+ILS AN
Sbjct  73   FQEASRHGLTVARTWAFSDGGYRPLQYSPGSYNEDMFQGLDFAIAEARRHGIKIILSFAN  132

Query  457  NYESFGG  477
            NY SFGG
Sbjct  133  NYVSFGG  139



>ref|XP_008338066.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
7 [Malus domestica]
Length=430

 Score =   187 bits (474),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = +1

Query  106  QQSSLSG-SVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFR  282
            QQ  +S   V AAG+ FI+ RG+HF++NG  +YANGFN YWLMYVASDPS+R+KVS AFR
Sbjct  16   QQCFISPIHVSAAGDDFIRVRGVHFLLNGNPYYANGFNGYWLMYVASDPSRRHKVSSAFR  75

Query  283  GASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNY  462
             A+  GLTVARTWAFSDGGY  LQ++PGSYNE +FKGLDFVIAEAR+Y +K+ILSL NNY
Sbjct  76   EATXDGLTVARTWAFSDGGYMPLQFSPGSYNEHMFKGLDFVIAEARRYEIKMILSLVNNY  135

Query  463  ESFGG  477
            E+FGG
Sbjct  136  ENFGG  140



>ref|XP_006279868.1| hypothetical protein CARUB_v10028560mg [Capsella rubella]
 gb|EOA12766.1| hypothetical protein CARUB_v10028560mg [Capsella rubella]
Length=432

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 106/127 (83%), Gaps = 1/127 (1%)
 Frame = +1

Query  100  FVQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEA  276
             +QQS L  G+   + +GF++ +G+ F +NGY +YANGFNAYWLMYV+SDPSQR K+  A
Sbjct  13   LIQQSCLELGADALSSDGFVRAKGVQFTLNGYPYYANGFNAYWLMYVSSDPSQRSKLPAA  72

Query  277  FRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLAN  456
            F+ AS HGLTVARTWAFSDGGYRALQ +PGSYNED+F+GLDF IAEAR++G+K+ILS AN
Sbjct  73   FQDASRHGLTVARTWAFSDGGYRALQSSPGSYNEDMFQGLDFAIAEARRHGIKLILSFAN  132

Query  457  NYESFGG  477
            NY+ FGG
Sbjct  133  NYDIFGG  139



>ref|XP_002281804.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Vitis vinifera]
 emb|CBI19729.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 108/126 (86%), Gaps = 1/126 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            F+Q+      V+AA +GF+KT G+HF++NG  ++ANGFNAYWLMYVASDPSQR K+S AF
Sbjct  13   FIQKQGNFLQVEAA-DGFVKTSGMHFVLNGLPYHANGFNAYWLMYVASDPSQRSKISSAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
              A+ HGLT+ARTWAFSDGGYR LQY+PGSYNE +F+GLDFV++EA KYG+K++LSLANN
Sbjct  72   AEAAGHGLTIARTWAFSDGGYRPLQYSPGSYNEQMFQGLDFVVSEAGKYGIKLVLSLANN  131

Query  460  YESFGG  477
            YESFGG
Sbjct  132  YESFGG  137



>emb|CDX81394.1| BnaC09g08050D [Brassica napus]
Length=1046

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +1

Query  103  VQQSSLSGSVKAAG-NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQS L   V A+  +GF++T+G+ F +NGY +YANGFNAYWLMYVASDP QR K+S AF
Sbjct  14   IQQSYLKLGVDASSRDGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPIQRPKISAAF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + ASSHGLTVARTWAFSDGGYR LQY+PGSYNED+F+GLDF IAEAR+ G+K+ILS ANN
Sbjct  74   QEASSHGLTVARTWAFSDGGYRPLQYSPGSYNEDMFQGLDFAIAEARRNGIKIILSFANN  133

Query  460  YESFGG  477
            Y SFGG
Sbjct  134  YVSFGG  139



>ref|XP_003528027.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=420

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = +1

Query  106  QQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRG  285
            +QS L   V+A G GF+KTRG+  M+NG  +YANGFNAYWLMY+ASDPSQR K+S  F+ 
Sbjct  19   EQSKLLHHVEADG-GFVKTRGVQLMLNGSPYYANGFNAYWLMYLASDPSQRNKISSVFQQ  77

Query  286  ASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            AS+HGL +ARTWAFSDGGY+ LQY+PGSYN+ +F+GLDF IAEARKYG+K++LSL NNYE
Sbjct  78   ASNHGLNIARTWAFSDGGYQPLQYSPGSYNDQMFQGLDFAIAEARKYGIKMVLSLVNNYE  137

Query  466  SFGG  477
            + GG
Sbjct  138  NMGG  141



>ref|XP_008800703.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Phoenix dactylifera]
Length=430

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 104/116 (90%), Gaps = 1/116 (1%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+A G GF++T+G+HF+++G  F+ANGFNAYWL YVASDPSQRYKVS AFR ASSHGL+V
Sbjct  21   VEAKG-GFVRTKGLHFVLHGNPFFANGFNAYWLTYVASDPSQRYKVSNAFREASSHGLSV  79

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            ARTWAF+DGG  ALQY+PGSYNE +FKGLDFV++EARKY +++ILSL NNY+SFGG
Sbjct  80   ARTWAFNDGGSTALQYSPGSYNEQMFKGLDFVVSEARKYKIRLILSLVNNYDSFGG  135



>ref|XP_008440745.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Cucumis melo]
Length=418

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G+GF++T    F++NG  +YANGFNAYWLMYVASDPSQR KVS  FR ASSHGLTVAR
Sbjct  18   AGGDGFVRTGRTRFLLNGSPYYANGFNAYWLMYVASDPSQRSKVSSVFREASSHGLTVAR  77

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAFSDGGYR LQY+PG+YNE +F+G+DFV+AEAR++G+K+ILSL NNYE+FGG
Sbjct  78   TWAFSDGGYRPLQYSPGNYNEQMFQGMDFVVAEARRFGIKLILSLVNNYENFGG  131



>ref|XP_007136624.1| hypothetical protein PHAVU_009G059700g [Phaseolus vulgaris]
 gb|ESW08618.1| hypothetical protein PHAVU_009G059700g [Phaseolus vulgaris]
Length=432

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = +1

Query  103  VQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFR  282
            V+QS +       G  F+KTRG+  ++NG  +YANGFNAYWLMY+ASDPSQR KVS AF+
Sbjct  18   VEQSKVLKVEADDGGAFVKTRGVQLILNGSPYYANGFNAYWLMYIASDPSQRNKVSSAFQ  77

Query  283  GASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNY  462
             AS+HGL +ARTWAFSDGGY  LQY+PGSYNE VF+GLDF IAEARKYG+K++LSL NNY
Sbjct  78   QASNHGLNIARTWAFSDGGYNPLQYSPGSYNEQVFQGLDFAIAEARKYGMKLVLSLVNNY  137

Query  463  ESFGG  477
            E+ GG
Sbjct  138  ENMGG  142



>ref|XP_004143522.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cucumis sativus]
 ref|XP_004167742.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cucumis sativus]
 gb|KGN48849.1| Endo-1,4-beta-mannosidase protein 2 [Cucumis sativus]
Length=418

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G+GF++T    F++NG  +YANGFNAYWLMYVASDPSQR KVS  FR ASSHGLTVAR
Sbjct  18   AGGDGFVRTGRTRFLLNGSPYYANGFNAYWLMYVASDPSQRSKVSAVFREASSHGLTVAR  77

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAFSDGGYR LQY+PG+YNE +F+G+DFV+AEAR++G+K+ILSL NNYE+FGG
Sbjct  78   TWAFSDGGYRPLQYSPGNYNEQMFQGMDFVVAEARRFGIKLILSLVNNYENFGG  131



>emb|CDY18606.1| BnaA09g07890D [Brassica napus]
Length=1113

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +1

Query  103  VQQSSLS-GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            +QQS L  G+  ++ +GF++T+G+ F +NGY +YANGFNAYWLMYVASDP QR K+S AF
Sbjct  14   IQQSYLKLGADASSRDGFVRTKGVQFSLNGYPYYANGFNAYWLMYVASDPIQRPKISAAF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + AS HGLTVARTWAFSDGGYR LQY+PGSYNED+F+GLDF IAEAR+ G+K+ILS ANN
Sbjct  74   QEASRHGLTVARTWAFSDGGYRPLQYSPGSYNEDMFQGLDFAIAEARRNGIKIILSFANN  133

Query  460  YESFGG  477
            Y SFGG
Sbjct  134  YVSFGG  139



>gb|KEH36174.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=410

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A + F+KTRG+  M+NG  +YANG+NAYWLMY ASDPSQR KVS  F+ AS HGL +ART
Sbjct  22   ADDEFVKTRGVQLMLNGSPYYANGYNAYWLMYFASDPSQRNKVSSTFQEASYHGLNIART  81

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGY+ LQY+PGSYNE++F+GLDFV+AEARKYG+KVILSL NNYE FGG
Sbjct  82   WAFSDGGYKPLQYSPGSYNEEMFQGLDFVLAEARKYGIKVILSLVNNYEDFGG  134



>ref|XP_003545272.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=429

 Score =   181 bits (460),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            AA +GF+K RG+  M+NG  +YANG+NAYWLMY+ASDPSQR KVS  F+  ++HGL +AR
Sbjct  29   AAADGFVKVRGVQLMLNGRPYYANGYNAYWLMYMASDPSQRNKVSSVFQKGTNHGLNIAR  88

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAFSDGGY+ LQY+PGSYNED+F+GLDFVI+EAR+YG K++LSL NNY++FGG
Sbjct  89   TWAFSDGGYKPLQYSPGSYNEDMFRGLDFVISEARRYGTKLVLSLVNNYDNFGG  142



>gb|KHN20963.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=417

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            AA +GF+K +G+  M+NG  +YANG+NAYWLMY+ASDPSQR KVS  F+  ++HGL +AR
Sbjct  16   AAADGFVKVKGVQLMLNGRPYYANGYNAYWLMYMASDPSQRNKVSSVFQKGTNHGLNIAR  75

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAFSDGGY+ LQY+PGSYNED+F+GLDFVI+EAR+YG K++LSL NNY++FGG
Sbjct  76   TWAFSDGGYKPLQYSPGSYNEDMFRGLDFVISEARRYGTKLVLSLVNNYDNFGG  129



>ref|XP_010924295.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like isoform X1 
[Elaeis guineensis]
Length=430

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 103/116 (89%), Gaps = 1/116 (1%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+A G GFI+T+G+HF++N Y F+ANGFNAYWL YVAS PSQRYKVS AFR ASSHGL+V
Sbjct  21   VEAKG-GFIRTKGLHFVLNRYPFFANGFNAYWLTYVASVPSQRYKVSNAFREASSHGLSV  79

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            ARTWAF+DGG  ALQY+PGSYNE +FKGLDFV++EARKY +++ILSL NNY+++GG
Sbjct  80   ARTWAFNDGGSTALQYSPGSYNEQMFKGLDFVVSEARKYKIRLILSLVNNYDNYGG  135



>gb|ACN78666.1| endo-beta-mannanase [Vaccinium corymbosum]
Length=425

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+GFIKTRG+ F++NG  +YANGFNAYWLMYVA+DPS+R KVS  F+ ASS GLT+ART
Sbjct  22   AGDGFIKTRGVQFVLNGSPYYANGFNAYWLMYVATDPSERNKVSSVFQEASSRGLTLART  81

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF DGGYRALQ +PGSYNE  F+GLDFVI+EA +YG+K+ILSL NNYE  GG
Sbjct  82   WAFGDGGYRALQNSPGSYNEQTFQGLDFVISEAGRYGVKLILSLVNNYEDLGG  134



>ref|XP_008220834.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Prunus mume]
Length=431

 Score =   179 bits (453),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 103/126 (82%), Gaps = 1/126 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             +Q   +   V+A  +GF+KTRG+  ++NG  +YANGFNAYWLMYVA+DPSQR K+S AF
Sbjct  13   LIQNQGILKPVEAE-DGFVKTRGLQLVLNGIPYYANGFNAYWLMYVATDPSQRDKISSAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + A+ HGL++ARTWAFSDGGYR LQ +PGSYNE  F+GLDF I+EA+K+G+K+ILSL NN
Sbjct  72   QEATQHGLSIARTWAFSDGGYRPLQSSPGSYNEQTFQGLDFAISEAKKHGIKLILSLMNN  131

Query  460  YESFGG  477
            YE+FGG
Sbjct  132  YENFGG  137



>ref|XP_004291857.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Fragaria 
vesca subsp. vesca]
Length=433

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A + F+KT+G+ FM+NG  +YANGFNAYWLMY+ASDPSQR  VS AF+ AS +GLT+ART
Sbjct  26   AEDDFVKTKGVQFMLNGTPYYANGFNAYWLMYMASDPSQRNLVSSAFQQASKNGLTIART  85

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DG YRALQY+PGSYNE  F+GLDFV++EARKYG+K++LSL N+YE+FGG
Sbjct  86   WAFNDGDYRALQYSPGSYNEQSFQGLDFVVSEARKYGIKLVLSLVNSYENFGG  138



>ref|XP_004500999.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cicer arietinum]
Length=135

 Score =   169 bits (428),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 94/109 (86%), Gaps = 2/109 (2%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A + F++TRG+  M+NG  +YANGFNAYWLMYVASDPSQR KVS  F+ AS+HGL +A T
Sbjct  22   ADSEFVETRGVQLMLNGSPYYANGFNAYWLMYVASDPSQRNKVSSTFQEASNHGLNIAIT  81

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            WAFSDGGY+ LQY+PGSYNED+F+GLDFVIAEAR+YG+KV+LSL  NYE
Sbjct  82   WAFSDGGYKPLQYSPGSYNEDMFQGLDFVIAEARRYGIKVVLSL--NYE  128



>gb|KHN45867.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=417

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +1

Query  130  VKAAGN-GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLT  306
            V+A G+ GF++TRG+  M+NG  +YANGFNAYWLMY+ASDPSQR KVS  F+ AS+HGL 
Sbjct  20   VEADGSVGFVRTRGVQLMLNGSPYYANGFNAYWLMYLASDPSQRNKVSSVFQQASNHGLN  79

Query  307  VARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            +ARTWAFSDGGY+ LQY+PGSYN  +F+GLDF IAEARKYG+K++LSL NNYE+ GG
Sbjct  80   IARTWAFSDGGYQPLQYSPGSYNYQMFQGLDFAIAEARKYGIKMVLSLVNNYENMGG  136



>ref|NP_001241893.1| uncharacterized protein LOC100814337 precursor [Glycine max]
 gb|ACU17987.1| unknown [Glycine max]
Length=418

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 100/117 (85%), Gaps = 1/117 (1%)
 Frame = +1

Query  130  VKAAGNG-FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLT  306
            V+A G+G F++TRG+  M+NG  +YANGFNAYWLMY+ASDPSQR KVS  F+ AS+HGL 
Sbjct  21   VEADGSGGFVRTRGVQLMLNGSPYYANGFNAYWLMYLASDPSQRNKVSSVFQQASNHGLN  80

Query  307  VARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            +ARTWAFSDGGY+ LQY+PGSYN  +F+GLDF IAEARKYG+K++LSL NNYE+ GG
Sbjct  81   IARTWAFSDGGYQPLQYSPGSYNYQMFQGLDFAIAEARKYGIKMVLSLVNNYENMGG  137



>gb|KCW68225.1| hypothetical protein EUGRSUZ_F01879 [Eucalyptus grandis]
Length=464

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +1

Query  46   AQQRMKHlgllaallailFVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYW  225
            A++ MKHL LL  L  +L  ++ S   +    G GF+KT G+HFM+NG  FYANGFNAYW
Sbjct  35   ARENMKHLRLLFFLALVLVQERRSHFAAKAEDGGGFVKTEGVHFMLNGSPFYANGFNAYW  94

Query  226  LMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFV  405
            LM++AS PSQR KV+ AF+ A+SHGL++ARTWAFSDGGY  LQ +PGSYNE +F+GLDFV
Sbjct  95   LMFLASYPSQRAKVTSAFQEATSHGLSIARTWAFSDGGYMPLQSSPGSYNEQMFQGLDFV  154

Query  406  IAEARKYGLKVILSLANNYESFGG  477
            I+EA+K+G+K++LSL +NYE+ GG
Sbjct  155  ISEAKKFGIKLVLSLVDNYEALGG  178



>ref|XP_006841534.1| hypothetical protein AMTR_s00003p00158370 [Amborella trichopoda]
 gb|ERN03209.1| hypothetical protein AMTR_s00003p00158370 [Amborella trichopoda]
Length=427

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG HFM+NG  FY NGFNAYWL  +ASDPS R KV+  F+ ASS+GLTVART
Sbjct  29   AQSGFVKTRGTHFMVNGSPFYVNGFNAYWLTQMASDPSTRGKVTSVFQQASSYGLTVART  88

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQ +PGSYNED+FKGLDFVI+EAR+YG+++ILS  NNY+  GG
Sbjct  89   WAFSDGGYRPLQISPGSYNEDMFKGLDFVISEARRYGVRLILSFVNNYKDLGG  141



>ref|XP_010679767.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Beta vulgaris 
subsp. vulgaris]
Length=431

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 102/129 (79%), Gaps = 4/129 (3%)
 Frame = +1

Query  103  VQQSSLSGSVKA----AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVS  270
            +QQ  L   V+A     GN FI+ RG  F++NG  +YANGFNAYWLMY+AS+PSQR+ VS
Sbjct  14   IQQCHLFFKVEANGRRVGNDFIRVRGTRFLLNGSPYYANGFNAYWLMYMASNPSQRHFVS  73

Query  271  EAFRGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSL  450
              F  ASSH L+VARTWAF+DGG RALQ +PGSY+E VF+GLDFVIAEARKYG+K+ILS 
Sbjct  74   NVFHEASSHSLSVARTWAFNDGGDRALQLSPGSYDEHVFQGLDFVIAEARKYGIKLILSF  133

Query  451  ANNYESFGG  477
            ANNYES GG
Sbjct  134  ANNYESMGG  142



>ref|XP_009394803.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=426

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG GFIKTRG++F+++G  F+ANGFNAYWLM +ASDPSQR KVS AF  ASSHGL VART
Sbjct  23   AGGGFIKTRGLNFVLDGNPFFANGFNAYWLMTLASDPSQRSKVSSAFGDASSHGLYVART  82

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGG  ALQY+PGSYNE  F+GLDFVI+EAR+Y +++ILSLANNY++FGG
Sbjct  83   WAFSDGGSNALQYSPGSYNEQTFRGLDFVISEARRYRIRLILSLANNYDTFGG  135



>ref|XP_006841527.1| hypothetical protein AMTR_s00003p00152240 [Amborella trichopoda]
 gb|ERN03202.1| hypothetical protein AMTR_s00003p00152240 [Amborella trichopoda]
Length=427

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KT+GIHF++NG  FY NGFNAYWLM +ASDPS R KV+  F+ ASS+GLTVART
Sbjct  29   AQSGFVKTKGIHFIVNGSPFYVNGFNAYWLMQMASDPSTRGKVTSVFQQASSYGLTVART  88

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQ +PGSYNED+F GLDFVI+EAR+YG+++ILS  NNY+  GG
Sbjct  89   WAFSDGGYRPLQISPGSYNEDMFNGLDFVISEARRYGVRLILSFVNNYKDLGG  141



>ref|XP_010061294.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Eucalyptus 
grandis]
Length=426

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G GF+KT G+HFM+NG  FYANGFNAYWLM++AS PSQR KV+ AF+ A+SHGL++ARTW
Sbjct  29   GGGFVKTEGVHFMLNGSPFYANGFNAYWLMFLASYPSQRAKVTSAFQEATSHGLSIARTW  88

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            AFSDGGY  LQ +PGSYNE +F+GLDFVI+EA+K+G+K++LSL +NYE+ GG
Sbjct  89   AFSDGGYMPLQSSPGSYNEQMFQGLDFVISEAKKFGIKLVLSLVDNYEALGG  140



>ref|XP_007017589.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
 gb|EOY14814.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
Length=431

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KT+G+  M++G  FYANGFNAYWLMY+A+DPSQR KVS AF+ A  HGL +ART
Sbjct  25   ADDGFVKTKGMQLMLDGSPFYANGFNAYWLMYMAADPSQRSKVSTAFQEAKQHGLNIART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGG R LQY+PGSYNE +F+GLDFV++EA++YG+K+ILS  NNY+ FGG
Sbjct  85   WAFSDGGDRPLQYSPGSYNEQMFQGLDFVVSEAKRYGIKLILSFVNNYDQFGG  137



>ref|XP_007222385.1| hypothetical protein PRUPE_ppa006029mg [Prunus persica]
 gb|EMJ23584.1| hypothetical protein PRUPE_ppa006029mg [Prunus persica]
Length=431

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             +Q   +   V+A  +GF+KTRG+  ++NG  +YA+GFNAYWLMYVA+DPSQR K+  AF
Sbjct  13   LIQSPGILKPVEAE-DGFVKTRGLQLVLNGVPYYAHGFNAYWLMYVATDPSQRDKILSAF  71

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + A+ HGL++ARTWAFSDGGYR LQ +PGSYNE  F+GLDF I+EA+K+G+K+ILSL NN
Sbjct  72   QEATKHGLSIARTWAFSDGGYRPLQSSPGSYNEQTFQGLDFAISEAKKHGIKLILSLVNN  131

Query  460  YESFGG  477
            YE+FGG
Sbjct  132  YENFGG  137



>gb|ABV32547.1| endo-1,4-beta-mannosidase protein 1 [Prunus persica]
Length=431

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG+  ++NG  +YA+GFNAYWLMYVA+DPSQR K+  AF+ A+ HGL++ART
Sbjct  25   AEDGFVKTRGLQLVLNGVPYYAHGFNAYWLMYVATDPSQRDKILSAFQEATKHGLSIART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQ +PGSYNE  F+GLDF I+EA+K+G+K+ILSL NNYE+FGG
Sbjct  85   WAFSDGGYRPLQSSPGSYNEQTFQGLDFAISEAKKHGIKLILSLVNNYENFGG  137



>ref|XP_003549439.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=432

 Score =   174 bits (440),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +1

Query  145  NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWA  324
            +GF+K RG+  M+NG  +YANG+NAYWLMY+ASDPSQR KVS  F+  ++HGL +ARTWA
Sbjct  33   DGFVKVRGVQLMLNGSPYYANGYNAYWLMYMASDPSQRNKVSSVFQKGTNHGLNIARTWA  92

Query  325  FSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            FSDGGY+ LQY+PG YNED+F GLDFVI+EAR+YG K++LSL NNY++FGG
Sbjct  93   FSDGGYKPLQYSPGFYNEDLFLGLDFVISEARRYGTKLVLSLVNNYDNFGG  143



>ref|XP_002510418.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF52605.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=432

 Score =   174 bits (440),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +1

Query  106  QQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRG  285
            Q+  +   VKAA +GF+ T+G+ FM+NG  FYANGFNAYWLMY A+D S R KVS  F+ 
Sbjct  15   QKQGMFLQVKAADDGFVSTKGVQFMLNGSPFYANGFNAYWLMYFATDNSMRNKVSSVFQE  74

Query  286  ASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            A +HGLT+ARTWAF+DG  RALQY+PGSYNE  F+GLDFVI+EA++ G+K++LSL NNYE
Sbjct  75   ARNHGLTLARTWAFNDGQDRALQYSPGSYNEQAFQGLDFVISEAKRNGIKLVLSLVNNYE  134

Query  466  SFGG  477
            SFGG
Sbjct  135  SFGG  138



>ref|XP_009395690.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=432

 Score =   174 bits (440),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 101/116 (87%), Gaps = 1/116 (1%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+AAG GFI+TRG++F+++G  F+ANGFNAYWLM +ASDPSQR KVS AFR ASSHGL V
Sbjct  21   VEAAG-GFIRTRGLNFVLDGNPFFANGFNAYWLMTLASDPSQRGKVSSAFREASSHGLLV  79

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            ARTWAFSDGG  ALQY+PG YN   F GLDFV++EAR+YG+++ILSLANNY++FGG
Sbjct  80   ARTWAFSDGGGNALQYSPGHYNGQTFTGLDFVVSEARRYGIRLILSLANNYDTFGG  135



>ref|NP_001280873.1| mannan endo-1,4-beta-mannosidase 7-like precursor [Malus domestica]
 gb|ACN78664.1| endo-beta-mannanase [Malus domestica]
Length=429

 Score =   174 bits (440),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG+  ++NG  +Y NGFNAYWLMY+A+DPS+R KVS AFR A+ +GLT+ART
Sbjct  23   AEDGFVKTRGVQLVLNGVPYYGNGFNAYWLMYMATDPSEREKVSSAFREATKNGLTIART  82

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DGGYRALQ +PGSY+E  F+GLDFVIAEA+K G+KV+LSL NNY+ FGG
Sbjct  83   WAFADGGYRALQTSPGSYDEKTFQGLDFVIAEAKKNGIKVMLSLVNNYDDFGG  135



>ref|XP_009336054.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Pyrus x bretschneideri]
Length=429

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG+  ++NG  +Y NGFNAYWLMY+A+DPS+R KVS AFR A+ +GLT+ART
Sbjct  23   AEDGFVKTRGVQLVLNGVPYYGNGFNAYWLMYMATDPSEREKVSSAFREATKNGLTIART  82

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DGGYRALQ +PGSY+E  F+GLDFVIAEA+K G+KV+LSL NNY++FGG
Sbjct  83   WAFADGGYRALQTSPGSYDEKTFQGLDFVIAEAKKNGIKVMLSLVNNYDNFGG  135



>ref|XP_009365114.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Pyrus x bretschneideri]
Length=429

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG+  ++NG  +Y NGFNAYWLMY+A+DPS+R KVS AFR A+ +GLT+ART
Sbjct  23   AEDGFVKTRGVQLVLNGVPYYGNGFNAYWLMYMATDPSEREKVSSAFREATKNGLTIART  82

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DGGYRALQ +PGSY+E  F+GLDFVIAEA+K G+KV+LSL NNY++FGG
Sbjct  83   WAFADGGYRALQTSPGSYDEKTFQGLDFVIAEAKKNGIKVMLSLVNNYDNFGG  135



>ref|XP_010926118.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 [Elaeis guineensis]
Length=430

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+A G GFI+T G+HF++NG  F+ANGFNAYWL  VASDPSQRYK+S AF  ASS GL+V
Sbjct  21   VEAQG-GFIRTSGLHFVLNGSPFFANGFNAYWLTCVASDPSQRYKISNAFMEASSRGLSV  79

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            ARTWAF+DGG  ALQY+PGSYNE +FKGLDFV++EA KY +++ILSL NNY+SFGG
Sbjct  80   ARTWAFNDGGSTALQYSPGSYNEQMFKGLDFVVSEAGKYNIRLILSLVNNYDSFGG  135



>ref|XP_009406291.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+AAG GFI+TRG+HF++NG  F+ANGFNAYW+M +ASDPS+R KVS A   AS HGL+V
Sbjct  21   VEAAG-GFIETRGLHFVLNGNPFFANGFNAYWMMTLASDPSRRDKVSSALSDASRHGLSV  79

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            ARTWAFSDGG  ALQ +PG+Y+E +F+GLDFV++EAR YG+K+ILSL NNY+SFGG
Sbjct  80   ARTWAFSDGGSNALQNSPGAYSEQIFQGLDFVVSEARNYGIKLILSLVNNYDSFGG  135



>gb|KJB58235.1| hypothetical protein B456_009G200500 [Gossypium raimondii]
 gb|KJB58236.1| hypothetical protein B456_009G200500 [Gossypium raimondii]
Length=431

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = +1

Query  106  QQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRG  285
            QQ +    VKA  + FIKT+G+  M++G  FYANGFNAYWLMY+A+D SQR KVS AF+ 
Sbjct  15   QQGNFLLRVKA-DDEFIKTKGLQLMLHGSPFYANGFNAYWLMYMAADSSQRSKVSSAFQQ  73

Query  286  ASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            A  HGLT+ARTWAFSDGG R LQY+PGSYNE +F+GLDFV++EA++YG+K++LS ANNY+
Sbjct  74   AKEHGLTIARTWAFSDGGDRPLQYSPGSYNEQMFQGLDFVVSEAKRYGIKLVLSFANNYD  133

Query  466  SFGG  477
             FGG
Sbjct  134  QFGG  137



>gb|EMS54429.1| Mannan endo-1,4-beta-mannosidase 1 [Triticum urartu]
Length=320

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            +AAG GF++ +G  F+ING  +YANGFNAYWLM +A+DP+QR KV+ A   A++ GL+VA
Sbjct  26   EAAGGGFVRAQGPRFVINGSPYYANGFNAYWLMTMAADPAQRGKVTSALSQAAARGLSVA  85

Query  313  RTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            RTWAFSDGG  ALQYAPGSYNE+ FKGLDFV++EARK G+KVILSL NNY++FGG
Sbjct  86   RTWAFSDGGSNALQYAPGSYNENTFKGLDFVLSEARKNGIKVILSLVNNYDTFGG  140



>ref|XP_007160733.1| hypothetical protein PHAVU_001G012600g [Phaseolus vulgaris]
 gb|ESW32727.1| hypothetical protein PHAVU_001G012600g [Phaseolus vulgaris]
Length=415

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G+ F+K RG+  ++N   +YANG+NAYWLMY+ASDPSQR KV+ AF+ A++HGL++ARTW
Sbjct  29   GDEFVKVRGVQLVLNERPYYANGYNAYWLMYMASDPSQRNKVTSAFQVAANHGLSIARTW  88

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            AFSDGG R LQY+PGSYNED+F GLDFVI+EAR+YG K++LSL NNY++FGG
Sbjct  89   AFSDGGDRPLQYSPGSYNEDMFLGLDFVISEARRYGTKLVLSLVNNYDNFGG  140



>gb|EMT30727.1| Mannan endo-1,4-beta-mannosidase 1 [Aegilops tauschii]
Length=348

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            +AAG GF++ +G  F+ING  +YANGFNAYWLM +A+DP+QR KV+ A   A++ GL+VA
Sbjct  26   EAAGGGFVRAQGTRFVINGSPYYANGFNAYWLMTMAADPAQRGKVTSALSQAAARGLSVA  85

Query  313  RTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            RTWAFSDGG  ALQYAPGSYNE+ FKGLDFV++EARK G+KVILSL NNY++FGG
Sbjct  86   RTWAFSDGGSNALQYAPGSYNENTFKGLDFVLSEARKNGIKVILSLVNNYDTFGG  140



>ref|XP_010673216.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Beta vulgaris 
subsp. vulgaris]
Length=418

 Score =   171 bits (434),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +1

Query  145  NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWA  324
            N FI T+G+   +NG  FY NGFNAYWLMY  SDPS+R+KVS  F+ AS+HGLT+ARTWA
Sbjct  35   NEFITTKGVKMWLNGNPFYGNGFNAYWLMYEGSDPSERHKVSSVFQEASNHGLTIARTWA  94

Query  325  FSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            FSDGGYR LQY PG YNE +F+GLDFV++EA+KYG+K++LSL NNYE FGG
Sbjct  95   FSDGGYRPLQYFPGFYNEQMFQGLDFVVSEAKKYGIKLVLSLVNNYEDFGG  145



>gb|ACN78663.1| endo-beta-mannanase, partial [Malus domestica]
Length=428

 Score =   171 bits (433),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A  GF+KTRG+  ++NG  +Y +GFNAYWLMY+ +DPS+R KVS A R A  HGLT+ART
Sbjct  22   AEEGFMKTRGVQLLLNGVPYYGHGFNAYWLMYMGTDPSERVKVSSALREAKEHGLTIART  81

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DGGYRALQ +PGSY+E  F+GLDFVI+EA+K G+KVILSL NNYE++GG
Sbjct  82   WAFADGGYRALQTSPGSYDEKTFRGLDFVISEAKKSGIKVILSLVNNYENYGG  134



>gb|ADN34185.1| endo-beta-mannanase [Cucumis melo subsp. melo]
Length=425

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF++T+G   ++NG  FYANGFNAYWLMY ASDPS + KVS AF+ A  HGL++ RT
Sbjct  21   ADDGFVRTKGQQLILNGTPFYANGFNAYWLMYFASDPSLKPKVSSAFQQAVDHGLSIGRT  80

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DGGY  LQY+PG YNE +F+GLDFV+AEARKYG+K+ILSL NNYES GG
Sbjct  81   WAFNDGGYSPLQYSPGQYNEKMFQGLDFVVAEARKYGIKLILSLVNNYESMGG  133



>ref|XP_009602297.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
tomentosiformis]
Length=419

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +1

Query  145  NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWA  324
            +GFI T+ +HFM+N   FYANGFNAYWLMY+ASD SQR KVS AF+ A++HGLTV RTWA
Sbjct  24   DGFITTKDVHFMLNDSPFYANGFNAYWLMYIASDSSQRDKVSSAFQEAANHGLTVGRTWA  83

Query  325  FSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            FSDGGY  LQY PGSYNE +F+GLDF I+EA K G+K+ILSLANNY+ FGG
Sbjct  84   FSDGGYSPLQYYPGSYNEKMFQGLDFAISEAGKNGMKLILSLANNYKDFGG  134



>ref|XP_008466539.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cucumis melo]
Length=476

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF++T+G   ++NG  FYANGFNAYWLMY ASDPS + KVS AF+ A  HGL++ RT
Sbjct  72   ADDGFVRTKGQQLILNGTPFYANGFNAYWLMYFASDPSLKPKVSSAFQQAVDHGLSIGRT  131

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DGGY  LQY+PG YNE +F+GLDFV+AEARKYG+K+ILSL NNYES GG
Sbjct  132  WAFNDGGYSPLQYSPGQYNEKMFQGLDFVVAEARKYGIKLILSLVNNYESMGG  184



>gb|EYU45796.1| hypothetical protein MIMGU_mgv1a0212341mg, partial [Erythranthe 
guttata]
Length=161

 Score =   162 bits (409),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A  + FI TRG  F++NG  FY NGFN+YWLMY+ASDPS R KV++ F  AS +G+ +AR
Sbjct  12   ARDDNFIGTRGSQFVMNGRPFYFNGFNSYWLMYMASDPSTRDKVTDTFAQASEYGMNLAR  71

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAFSDGGYRALQ +PGSYNED+FKGLDFV+AEA+K+G+ ++L+L NN+E FGG
Sbjct  72   TWAFSDGGYRALQTSPGSYNEDMFKGLDFVVAEAKKHGIYLLLTLVNNWEGFGG  125



>gb|KDP38537.1| hypothetical protein JCGZ_04462 [Jatropha curcas]
Length=431

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+ T+G+ FM+NG  FYANGFNAYWLMY A+DPS R KVS  F+ A +HGL +ART
Sbjct  25   AEDGFVTTKGVQFMLNGSPFYANGFNAYWLMYFANDPSTRNKVSSVFQEAKAHGLALART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DG  RALQY+PGSYNE  F+GLDFVI+EA++ G+K++LSL NNYE+FGG
Sbjct  85   WAFNDGQDRALQYSPGSYNEQAFQGLDFVISEAKRNGIKLVLSLVNNYENFGG  137



>ref|XP_011085841.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Sesamum 
indicum]
Length=400

 Score =   168 bits (425),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            +A   GF+ TRG  F++NG  FY NGFN+YWLMY+ASDPS R KVS+ F  A+ +G+ VA
Sbjct  23   RAVRGGFVGTRGSQFVVNGRPFYFNGFNSYWLMYMASDPSTRVKVSDTFVQAAKYGMNVA  82

Query  313  RTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            RTWAFSDGGYRALQ APGSYNED+FKGLDFV++EA+K+G+ +ILSL NN+E FGG
Sbjct  83   RTWAFSDGGYRALQTAPGSYNEDMFKGLDFVVSEAKKHGIYLILSLVNNWEGFGG  137



>ref|XP_011007449.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Populus euphratica]
Length=406

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GFI+T+G+ F++NG  FYANGFNAYWLMY A+D SQR KV+  F+ A  HGLT+ART
Sbjct  25   ADDGFIRTKGVQFLLNGSPFYANGFNAYWLMYFATDTSQRDKVTSVFQDAKQHGLTLART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DG  RALQ +PG YNE  F+GLDFVI+EA+K G+K+ILSL NNYE+FGG
Sbjct  85   WAFNDGQDRALQVSPGYYNEQTFQGLDFVISEAKKNGIKLILSLVNNYENFGG  137



>ref|XP_006841038.1| hypothetical protein AMTR_s00085p00132560 [Amborella trichopoda]
 gb|ERN02713.1| hypothetical protein AMTR_s00085p00132560 [Amborella trichopoda]
Length=162

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A  GF++TRG HF++NG  FY NGFN YW++ +AS+PS R KV+  F+ ASS+GLT ART
Sbjct  29   AQGGFVQTRGTHFIVNGSPFYVNGFNVYWMVQMASNPSTRGKVTSVFQQASSYGLTEART  88

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGGYR LQ +PGSYNED+ KGLDFVI+EAR+YG+ ++LS  NNY+  GG
Sbjct  89   WAFSDGGYRPLQISPGSYNEDMVKGLDFVISEARRYGVCLMLSFVNNYKDLGG  141



>ref|XP_008797528.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
1-like [Phoenix dactylifera]
Length=430

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+A G+ FI+T G+ F++NG  F+ANGFNAYWL Y+ASDPSQ YKVS AFR A+S GL+V
Sbjct  21   VEAKGS-FIRTNGLQFVLNGSPFFANGFNAYWLTYMASDPSQSYKVSNAFREATSRGLSV  79

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            ARTWAF+DGG  ALQY+PGSYNE +FK LDFV++EA KY +++ILSL NNY+SFGG
Sbjct  80   ARTWAFNDGGSAALQYSPGSYNEQMFKSLDFVVSEAGKYNIRLILSLVNNYDSFGG  135



>ref|XP_009416732.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Musa acuminata 
subsp. malaccensis]
Length=426

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+AAG  FI   G+HF++NG  F+ANGFNAYWLM +ASDPSQR KVS A   ASSH L+V
Sbjct  18   VEAAGGEFIGISGLHFVLNGNPFFANGFNAYWLMTLASDPSQRDKVSSALSDASSHELSV  77

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            ARTWAFSDGG  ALQY+PGSYNE  F+GLDFV++EA KYG+++ILSL N+Y+++GG
Sbjct  78   ARTWAFSDGGSNALQYSPGSYNEQTFQGLDFVVSEAGKYGIRLILSLVNSYDNYGG  133



>gb|ABF69949.1| (1-4)-beta-mannan endohydrolase (mannan endo-1,4-beta-mannosidase), 
putative [Musa acuminata]
Length=428

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V+AAG  FI   G+HF++NG  F+ANGFNAYWLM +ASDPSQR KVS A   ASSH L+V
Sbjct  18   VEAAGGEFIGISGLHFVLNGNPFFANGFNAYWLMTLASDPSQRDKVSSALSDASSHELSV  77

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            ARTWAFSDGG  ALQY+PGSYNE  F+GLDFV++EA KYG+++ILSL N+Y+++GG
Sbjct  78   ARTWAFSDGGSNALQYSPGSYNEQTFQGLDFVVSEAGKYGIRLILSLVNSYDNYGG  133



>ref|XP_002515142.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
 gb|EEF47126.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus 
communis]
Length=404

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F KT G HF++N  + Y NGFNAYW+MY+ASDPS R KV+ AF+ A+ +G+ +ARTWAFS
Sbjct  36   FAKTNGTHFVMNNKSLYLNGFNAYWMMYMASDPSTREKVTSAFQQAAKNGMNIARTWAFS  95

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            DGGYRALQ +PGSYN+D+FKGLDFVI+EARKYG+ VIL L NNY+ FGG
Sbjct  96   DGGYRALQISPGSYNQDMFKGLDFVISEARKYGIYVILCLVNNYKDFGG  144



>ref|XP_002306881.1| hypothetical protein POPTR_0005s25120g [Populus trichocarpa]
 gb|EEE93877.1| hypothetical protein POPTR_0005s25120g [Populus trichocarpa]
Length=420

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GFI+T+G+ F++NG  FYANGFN YWLMY A+D SQR KV+  F+ A  HGLT+ART
Sbjct  25   ADDGFIRTKGVQFLLNGSPFYANGFNGYWLMYFATDTSQRDKVTSVFQDAKQHGLTLART  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DG  RALQ +PG YNE  F+GLDFVI+EA+K G+K+ILSL NNYE+FGG
Sbjct  85   WAFNDGQDRALQVSPGHYNEQTFQGLDFVISEAKKNGIKLILSLVNNYENFGG  137



>ref|XP_009785219.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Nicotiana 
sylvestris]
Length=419

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +1

Query  145  NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWA  324
            +GFI T+ +HFM+N   FYANGFNAYWLMY+ASD SQR KVS A + A++HGLTV RTWA
Sbjct  24   DGFITTKDVHFMLNESPFYANGFNAYWLMYIASDSSQRDKVSSALQEAANHGLTVGRTWA  83

Query  325  FSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            FSDGGY  LQY PGSYNE +F+GLDF I+EA K G+K+ILSL NNY+ FGG
Sbjct  84   FSDGGYSPLQYYPGSYNEKMFQGLDFAISEAGKNGIKLILSLVNNYKDFGG  134



>ref|XP_006441716.1| hypothetical protein CICLE_v10023981mg, partial [Citrus clementina]
 gb|ESR54956.1| hypothetical protein CICLE_v10023981mg, partial [Citrus clementina]
Length=400

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  121  SGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHG  300
            S     A  GF++TRG  F++NG  F  NGFN+YW+M VAS PSQRYKVS+ FR A++ G
Sbjct  1    SAQTLPAQAGFVQTRGTQFVLNGSPFLFNGFNSYWMMNVASQPSQRYKVSDVFRQAAAAG  60

Query  301  LTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            L+V RTWAFSDGGY ALQ +PG YNE VF+GLDFVI+EARKYG+++ILSL+NNY  FGG
Sbjct  61   LSVCRTWAFSDGGYGALQQSPGVYNEPVFQGLDFVISEARKYGIRLILSLSNNYHDFGG  119



>gb|KDO45466.1| hypothetical protein CISIN_1g016140mg [Citrus sinensis]
Length=394

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +1

Query  121  SGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHG  300
            S     A  GF++TRG  F++NG  F  NGFN+YW+M VAS PSQRYKVS+ FR A++ G
Sbjct  22   SAQTLPAQAGFVQTRGTQFVLNGSPFLFNGFNSYWMMNVASQPSQRYKVSDVFRQAAAAG  81

Query  301  LTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            L+V RTWAFSDGGY ALQ +PG YNE VF+GLDFVI+EARKYG+++ILSL+NNY  FGG
Sbjct  82   LSVCRTWAFSDGGYGALQQSPGVYNEPVFQGLDFVISEARKYGIRLILSLSNNYHDFGG  140



>ref|XP_004147857.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cucumis sativus]
Length=424

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF+ T+G   ++NG  FYANGFNAYWLMY ASDPSQ  KVS AF+ A +HGL++ RTWAF
Sbjct  23   GFVSTKGQQLILNGSPFYANGFNAYWLMYFASDPSQAPKVSSAFQQAVNHGLSIGRTWAF  82

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            +DGGY  LQY+PG YNE +F+GLDFV+AEARKYG+K+ILSL NNY S GG
Sbjct  83   NDGGYSPLQYSPGQYNEKMFQGLDFVVAEARKYGIKLILSLVNNYASMGG  132



>ref|XP_004154850.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Cucumis sativus]
Length=425

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF+ T+G   ++NG  FYANGFNAYWLMY ASDPSQ  KVS AF+ A +HGL++ RTWAF
Sbjct  24   GFVSTKGQQLILNGSPFYANGFNAYWLMYFASDPSQAPKVSSAFQQAVNHGLSIGRTWAF  83

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            +DGGY  LQY+PG YNE +F+GLDFV+AEARKYG+K+ILSL NNY S GG
Sbjct  84   NDGGYSPLQYSPGQYNEKMFQGLDFVVAEARKYGIKLILSLVNNYASMGG  133



>gb|KGN59983.1| hypothetical protein Csa_3G859700 [Cucumis sativus]
Length=425

 Score =   166 bits (420),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF+ T+G   ++NG  FYANGFNAYWLMY ASDPSQ  KVS AF+ A +HGL++ RTWAF
Sbjct  24   GFVSTKGQQLILNGSPFYANGFNAYWLMYFASDPSQAPKVSSAFQQAVNHGLSIGRTWAF  83

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            +DGGY  LQY+PG YNE +F+GLDFV+AEARKYG+K+ILSL NNY S GG
Sbjct  84   NDGGYSPLQYSPGQYNEKMFQGLDFVVAEARKYGIKLILSLVNNYASMGG  133



>ref|XP_011083658.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Sesamum indicum]
Length=425

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
             A +GFI     HF++NG  +Y +GFN+YWLMYVASDPSQR+K+S AF+ A++HGL +AR
Sbjct  42   TAEDGFITVEREHFILNGSRYYGHGFNSYWLMYVASDPSQRFKISSAFQQAANHGLEIAR  101

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAF DGG+  LQY+PGSYNE +F+GLDFV++EA KYG+K+ILSL NNYE  GG
Sbjct  102  TWAFRDGGFSPLQYSPGSYNEHMFQGLDFVVSEAGKYGIKLILSLVNNYEDSGG  155



>ref|XP_009365529.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Pyrus x bretschneideri]
Length=429

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF+KTRG+  ++NG  +Y +GFNAYWLMY+ +DPS+R KVS A R A  HGLT+ART
Sbjct  23   AEDGFMKTRGVQLVLNGVPYYGHGFNAYWLMYMGTDPSERVKVSSALREAKEHGLTIART  82

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DGGYRALQ +PGSY+E  F+GLDFVI+EA+K G+K+ILSL NNY ++GG
Sbjct  83   WAFADGGYRALQTSPGSYDERTFRGLDFVISEAKKNGIKLILSLVNNYYNYGG  135



>ref|XP_009122559.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like [Brassica 
rapa]
 emb|CDY36280.1| BnaA01g31380D [Brassica napus]
Length=415

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G   A+GNGF++ +G+ F++NG  FYANGFNAYWL Y A+DP+ R+K++ AF+ A+SHGL
Sbjct  22   GVEAASGNGFVRRKGVQFILNGKPFYANGFNAYWLTYEATDPATRFKITYAFQNATSHGL  81

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TVARTW F DGGYRALQ APG Y+E  F+GLDF IAEA++ G+K+I++  NNY  FGG
Sbjct  82   TVARTWGFRDGGYRALQTAPGRYDELTFQGLDFAIAEAKRLGIKMIITFVNNYSDFGG  139



>ref|XP_006644473.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Oryza brachyantha]
Length=430

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 96/113 (85%), Gaps = 1/113 (1%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G+GF++ +G  F++NG  +YANGFNAYWLM +A+DPSQR KV+ A   A+ HGLTVARTW
Sbjct  34   GDGFVRAQGTRFVLNGSPYYANGFNAYWLMSMAADPSQRGKVTAALSEAAGHGLTVARTW  93

Query  322  AFSD-GGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            AFSD GG  ALQY+PG+YNE+ FKGLDFV++EARKYG+KVILSL N+Y+SFGG
Sbjct  94   AFSDGGGTNALQYSPGNYNENTFKGLDFVLSEARKYGIKVILSLVNSYDSFGG  146



>ref|XP_006342222.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Solanum tuberosum]
Length=413

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
             + FIKT+G+HFM+N   FYANGFNAYWLM + SDPSQR+KVS   + A+SHGLTV RTW
Sbjct  23   NDDFIKTKGVHFMLNESPFYANGFNAYWLMLIGSDPSQRHKVSSVLQDAASHGLTVGRTW  82

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            AFSD GY  LQ++PG YNE++F+GLD+ I EA K G+K+ILSL NNY  FGG
Sbjct  83   AFSDAGYSPLQFSPGVYNENMFQGLDYAIHEAGKNGIKLILSLVNNYNDFGG  134



>emb|CDP19235.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +1

Query  154  IKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFSD  333
            +KTRG  F++NG   Y NGFNAYWLMY+ASDPS R KVS  F+ AS +G+  ARTWAFSD
Sbjct  45   VKTRGTEFVMNGRPLYLNGFNAYWLMYMASDPSTRTKVSTTFQQASKYGMNAARTWAFSD  104

Query  334  GGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            GGYRALQ +PGSYNED+FKGLDFV++EA+KYG+ +IL+L NN+E +GG
Sbjct  105  GGYRALQQSPGSYNEDMFKGLDFVVSEAKKYGIHLILTLVNNWEGYGG  152



>emb|CAC08442.1| (1-4)-beta-mannan endohydrolase [Coffea arabica]
Length=416

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +1

Query  154  IKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFSD  333
            +KTRG  F++NG   Y NGFNAYWLMY+ASDPS R KVS  F+ AS +G+  ARTWAFSD
Sbjct  45   VKTRGTEFVMNGRPLYLNGFNAYWLMYMASDPSTRTKVSTTFQQASKYGMNAARTWAFSD  104

Query  334  GGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            GGYRALQ +PGSYNED+FKGLDFV++EA+KYG+ +IL+L NN+E +GG
Sbjct  105  GGYRALQQSPGSYNEDMFKGLDFVVSEAKKYGIHLILTLVNNWEGYGG  152



>ref|XP_009407087.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Musa 
acuminata subsp. malaccensis]
Length=395

 Score =   163 bits (412),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            AA + F KTRG HF+I+   FY+NGFN+YWLMY A+DP+++ KVS A   AS+ GL V R
Sbjct  12   AADDDFAKTRGTHFVIDDRPFYSNGFNSYWLMYTAADPAEKDKVSSALEQASTLGLRVIR  71

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAFSDGGYR LQY+PG YNE++FK LDFVI+EA+KYG+ +ILSL NN+E FGG
Sbjct  72   TWAFSDGGYRPLQYSPGVYNENMFKALDFVISEAKKYGVHLILSLVNNWEGFGG  125



>ref|XP_004238284.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Solanum lycopersicum]
Length=413

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 93/119 (78%), Gaps = 2/119 (2%)
 Frame = +1

Query  127  SVKA--AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHG  300
            +VKA    + FIKT+G+HFM+N   FYANGFNAYWLM + SDPSQR+KVS  F+ A++HG
Sbjct  16   NVKANVINDDFIKTKGVHFMLNDSPFYANGFNAYWLMLIGSDPSQRHKVSSVFQDAANHG  75

Query  301  LTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            LTV RTWAFSD GY  LQ++PG YNE +F+GLD+ I EA K G+K+ILSL NNY  FGG
Sbjct  76   LTVGRTWAFSDAGYSPLQFSPGFYNEIMFQGLDYAIHEAGKNGIKLILSLVNNYNDFGG  134



>ref|XP_004495835.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Cicer arietinum]
Length=401

 Score =   162 bits (411),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
               GF++ +GIHF++NG T Y NGFN+YWLMY+ASDPS R KV+  F+ AS HGL V RT
Sbjct  28   VATGFVERKGIHFILNGKTHYVNGFNSYWLMYMASDPSTRSKVTSTFQQASQHGLNVGRT  87

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             AF+DG YRALQ +PGSY+E+VF+GLDFVI+EARKY +++ILSL NN+ +FGG
Sbjct  88   MAFNDGCYRALQISPGSYDENVFRGLDFVISEARKYKIQLILSLVNNWNNFGG  140



>ref|XP_008805817.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Phoenix dactylifera]
Length=390

 Score =   162 bits (410),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +1

Query  118  LSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSH  297
            L G    AG+ F++T G HF+++G +FY+NGFNAYWLM +ASDP+QRYKVS   + AS +
Sbjct  18   LQGCSAYAGSSFVRTSGTHFVLDGRSFYSNGFNAYWLMLMASDPTQRYKVSSVLQQASDY  77

Query  298  GLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            G++V RTWAFSDGG   LQY+PG YNE++F+GLDFVI+EA+K+G+ +ILSL NNY  FGG
Sbjct  78   GMSVVRTWAFSDGGSNPLQYSPGYYNENMFQGLDFVISEAKKHGVFLILSLVNNYADFGG  137



>ref|XP_007051341.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007051342.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX95498.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX95499.1| Glycosyl hydrolase superfamily protein isoform 1 [Theobroma cacao]
Length=412

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F++TRG +F++NG  FY NGFNAYW+M  ASDPS R KV++ FR AS +G+ VAR WAF+
Sbjct  39   FVQTRGTNFVMNGKPFYLNGFNAYWMMMFASDPSTRIKVTDTFREASKYGMNVARVWAFN  98

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            DG Y+ LQ +PGSYNEDVFKGLDFV+AEA+KYG+ +ILSL NN++ FGG
Sbjct  99   DGDYKPLQNSPGSYNEDVFKGLDFVVAEAKKYGIHLILSLVNNFKDFGG  147



>ref|XP_010914840.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Elaeis 
guineensis]
Length=425

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F+ T G  F++NG  FY+NGFNAYWLMY+ASDP+ R KVS AF+ ASSHG+ V RTWAFS
Sbjct  32   FVTTNGTGFVMNGRPFYSNGFNAYWLMYMASDPAGRSKVSSAFQQASSHGMKVVRTWAFS  91

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            DGG++ALQ +PGSY+E++F+GLDFVI+EARKYG+ +ILSL NN+E FGG
Sbjct  92   DGGHKALQCSPGSYDENMFQGLDFVISEARKYGVYLILSLVNNHEDFGG  140



>gb|KJB41765.1| hypothetical protein B456_007G119100 [Gossypium raimondii]
Length=370

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G GF++T    F+ING  FY NGFNAYW+M  ASD S R KV++AFR AS +G+ +AR
Sbjct  33   AGGTGFVQTTATKFVINGKPFYLNGFNAYWMMMFASDNSTRSKVTDAFREASKYGMNIAR  92

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAF+DG Y+ LQ +PGSYNEDVFKGLDFV+AEA KYG+ +ILSLANN++ FGG
Sbjct  93   TWAFNDGDYKPLQNSPGSYNEDVFKGLDFVVAEANKYGIHLILSLANNFKDFGG  146



>gb|KJB41764.1| hypothetical protein B456_007G119100 [Gossypium raimondii]
Length=411

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G GF++T    F+ING  FY NGFNAYW+M  ASD S R KV++AFR AS +G+ +AR
Sbjct  33   AGGTGFVQTTATKFVINGKPFYLNGFNAYWMMMFASDNSTRSKVTDAFREASKYGMNIAR  92

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAF+DG Y+ LQ +PGSYNEDVFKGLDFV+AEA KYG+ +ILSLANN++ FGG
Sbjct  93   TWAFNDGDYKPLQNSPGSYNEDVFKGLDFVVAEANKYGIHLILSLANNFKDFGG  146



>ref|XP_008799989.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Phoenix 
dactylifera]
Length=424

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF+ T G  F++NG  FYANGFNAYWLM +AS+P+ R KVS AF+ ASSHG+TV RTWAF
Sbjct  28   GFVTTNGTGFVVNGRPFYANGFNAYWLMDMASEPAGRSKVSSAFQQASSHGMTVVRTWAF  87

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGG++ALQ +PGSY++D+F+GLDFVI+EARKYG+ +ILSL NN+E +GG
Sbjct  88   SDGGHQALQRSPGSYDDDMFEGLDFVISEARKYGVYLILSLVNNHEDYGG  137



>gb|KJB41766.1| hypothetical protein B456_007G119100 [Gossypium raimondii]
Length=411

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G GF++T    F+ING  FY NGFNAYW+M  ASD S R KV++AFR AS +G+ +AR
Sbjct  33   AGGTGFVQTTATKFVINGKPFYLNGFNAYWMMMFASDNSTRSKVTDAFREASKYGMNIAR  92

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAF+DG Y+ LQ +PGSYNEDVFKGLDFV+AEA KYG+ +ILSLANN++ FGG
Sbjct  93   TWAFNDGDYKPLQNSPGSYNEDVFKGLDFVVAEANKYGIHLILSLANNFKDFGG  146



>gb|EYU22710.1| hypothetical protein MIMGU_mgv1a023976mg, partial [Erythranthe 
guttata]
Length=383

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F++TRG HF+++G  F  NGFN+YW+M+VA+DP+QRYKVSE FR AS+ GL+V RTWAFS
Sbjct  12   FVRTRGSHFVLHGSPFLFNGFNSYWMMHVAADPNQRYKVSEVFREASAAGLSVCRTWAFS  71

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            DGG   LQ +PG+Y+E VF+GLDFV++EARKYG+++ILSL NNY  FGG
Sbjct  72   DGGDLPLQISPGTYDERVFQGLDFVVSEARKYGIRLILSLVNNYNDFGG  120



>gb|KCW46730.1| hypothetical protein EUGRSUZ_K00551 [Eucalyptus grandis]
Length=337

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G+GF +T GIHF+ NG   Y NGFNAYW+MY+ASDPS R KV+ A + A+ +G+ +ARTW
Sbjct  28   GSGFARTNGIHFVANGKPLYLNGFNAYWMMYMASDPSTRDKVTSALQEAAKNGMNIARTW  87

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            AFSDGGYRALQ +PG YN+D+FKGLDFVI+EA K G+ +ILSLANN+  FGG
Sbjct  88   AFSDGGYRALQTSPGVYNQDMFKGLDFVISEAGKNGVYLILSLANNWNDFGG  139



>gb|EYU45779.1| hypothetical protein MIMGU_mgv1a020287mg [Erythranthe guttata]
Length=392

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G  + A   FI TRG  F++NG +FY NGFN+YWLMY+ASDPS + KV++ F  AS +G+
Sbjct  5    GEAEVAREDFIGTRGSQFVMNGRSFYFNGFNSYWLMYMASDPSTKVKVTDTFAQASEYGM  64

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             +ARTWAFSDGGYRALQ +PG YNED+FKGLDFV++EA+K+G+ ++L+L NN+E FGG
Sbjct  65   NLARTWAFSDGGYRALQTSPGLYNEDMFKGLDFVVSEAKKHGIYLLLTLVNNWEGFGG  122



>gb|EYU45780.1| hypothetical protein MIMGU_mgv1a025011mg [Erythranthe guttata]
Length=394

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G  + A + FI TRG  F++NG  FY NGFN+YWLMY+ASDPS R KV++ F  AS +G+
Sbjct  5    GEAEGARDNFIGTRGSQFVMNGRPFYFNGFNSYWLMYMASDPSTRDKVTDTFAQASKYGM  64

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             +ARTWAFSDGGYRALQ +PG YN+D+FKGLDFV++EA+K+G+ ++LSL NN+E FGG
Sbjct  65   NLARTWAFSDGGYRALQTSPGVYNDDMFKGLDFVVSEAKKHGIYLLLSLVNNWEGFGG  122



>ref|XP_010911540.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Elaeis guineensis]
Length=390

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +1

Query  118  LSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSH  297
            L G     G+GF++T G HF+++G  FY+NGFNAYWLM +ASDP+QRYKVS   + AS +
Sbjct  18   LQGGGAYVGSGFVRTSGTHFVLDGRPFYSNGFNAYWLMLMASDPTQRYKVSSVLQQASDY  77

Query  298  GLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            G++V RTWAFSDGG   LQY+PG YNE++F+GLDFVI+EA+K+G+ +ILSL NNY  FGG
Sbjct  78   GMSVVRTWAFSDGGSNPLQYSPGYYNENMFQGLDFVISEAKKHGVFLILSLVNNYADFGG  137



>ref|XP_006478472.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Citrus sinensis]
Length=410

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            +  A   F++TRG  F++NG  F  NGFN+YW+M VAS PSQRYKVS+ FR A++ GL+V
Sbjct  14   ILPAQASFVQTRGTQFVLNGSPFLFNGFNSYWMMNVASQPSQRYKVSDVFRQAAAAGLSV  73

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             RTWAFSDGGY ALQ +PG YNE VF+GLDFV +EARKYG+++ILSL+NNY  FGG
Sbjct  74   CRTWAFSDGGYGALQQSPGVYNEPVFQGLDFVTSEARKYGIRLILSLSNNYHDFGG  129



>ref|XP_009601553.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Nicotiana 
tomentosiformis]
Length=416

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++T G HF++N   F  NGFN+YWLM+VASDPS+RYKVSE F+ AS+  L+V RTWAF
Sbjct  33   GFVRTNGAHFVLNRSPFLFNGFNSYWLMHVASDPSERYKVSEVFQEASAARLSVCRTWAF  92

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGG  ALQ +PG YNE VF+GLDFVIAEARKYG+++ILS  NNY  FGG
Sbjct  93   SDGGDTALQISPGVYNERVFQGLDFVIAEARKYGIRLILSFVNNYNDFGG  142



>ref|XP_006435034.1| hypothetical protein CICLE_v10001262mg [Citrus clementina]
 gb|ESR48274.1| hypothetical protein CICLE_v10001262mg [Citrus clementina]
Length=425

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GFI  +G+H M+NG  FYANGFNAYWLM   ++P  + KVS  F+ A  HGL++ART
Sbjct  19   ADDGFITAKGVHLMLNGSPFYANGFNAYWLMNTGANPYLKDKVSSVFQQAKEHGLSMART  78

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGG   LQY+PGSYNE +F+GLDFVI+EARKYG+K++LS+ NNY+ FGG
Sbjct  79   WAFSDGGDSPLQYSPGSYNEQMFQGLDFVISEARKYGIKLVLSMVNNYDQFGG  131



>ref|XP_006473535.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Citrus sinensis]
Length=425

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GFI  +G+H M+NG  FYANGFNAYWLM   ++P  + KVS  F+ A  HGL++ART
Sbjct  19   ADDGFITAKGVHLMLNGSPFYANGFNAYWLMNTGANPYLKDKVSSVFQQAKEHGLSMART  78

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGG   LQY+PGSYNE +F+GLDFVI+EARKYG+K++LS+ NNY+ FGG
Sbjct  79   WAFSDGGDSPLQYSPGSYNEQMFQGLDFVISEARKYGIKLVLSMVNNYDQFGG  131



>gb|KDO84614.1| hypothetical protein CISIN_1g014426mg [Citrus sinensis]
Length=425

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GFI  +G+H M+NG  FYANGFNAYWLM   ++P  + KVS  F+ A  HGL++ART
Sbjct  19   ADDGFITAKGVHLMLNGSPFYANGFNAYWLMNTGANPYLKDKVSSVFQQAKEHGLSMART  78

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGG   LQY+PGSYNE +F+GLDFVI+EARKYG+K++LS+ NNY+ FGG
Sbjct  79   WAFSDGGDSPLQYSPGSYNEQMFQGLDFVISEARKYGIKLVLSMVNNYDQFGG  131



>gb|KHG12601.1| Mannan endo-1,4-beta-mannosidase 4 [Gossypium arboreum]
Length=411

 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G GF++T    F+ING  FY NGFNAYW+M  ASD S R KV++AFR AS +G+ +AR
Sbjct  33   AGGTGFVQTTATKFVINGKPFYLNGFNAYWMMMFASDNSTRSKVTDAFREASKYGMNIAR  92

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAF+DG Y+ LQ +PGSYNEDVFKGLDFV+AEA KYG+ +ILSLANN++ +GG
Sbjct  93   TWAFNDGDYKPLQNSPGSYNEDVFKGLDFVVAEANKYGIHLILSLANNFKDYGG  146



>ref|NP_001234473.1| (1-4)-beta-mannan endohydrolase precursor [Solanum lycopersicum]
 sp|Q6YM50.1|MAN5_SOLLC RecName: Full=Mannan endo-1,4-beta-mannosidase 5; AltName: Full=Beta-mannanase 
5; AltName: Full=Endo-beta-1,4-mannanase 5; 
AltName: Full=LeMAN5; Flags: Precursor [Solanum lycopersicum]
 sp|Q9FZ03.2|MAN2_SOLLC RecName: Full=Mannan endo-1,4-beta-mannosidase 2; AltName: Full=Beta-mannanase 
2; AltName: Full=Endo-beta-1,4-mannanase 2; 
AltName: Full=LeMAN2; Flags: Precursor [Solanum lycopersicum]
 gb|AAG00315.2|AF184238_1 (1-4)-beta-mannan endohydrolase precursor [Solanum lycopersicum]
 gb|AAM26920.1| mannan endo-1,4-beta-mannanase precursor [Solanum lycopersicum]
Length=414

 Score =   160 bits (406),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A   GF++  G HF +NG  F  NGFN+YWLM+VA++PS+RYKVSE  R ASS GL+V R
Sbjct  34   ANDQGFVRVNGAHFELNGSPFLFNGFNSYWLMHVAAEPSERYKVSEVLREASSAGLSVCR  93

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAFSDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NNY  FGG
Sbjct  94   TWAFSDGGDRALQISPGVYDERVFQGLDFVISEAKKYGIRLILSFVNNYNDFGG  147



>ref|XP_010035363.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Eucalyptus 
grandis]
 gb|KCW46729.1| hypothetical protein EUGRSUZ_K00551 [Eucalyptus grandis]
Length=402

 Score =   160 bits (405),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G+GF +T GIHF+ NG   Y NGFNAYW+MY+ASDPS R KV+ A + A+ +G+ +ARTW
Sbjct  28   GSGFARTNGIHFVANGKPLYLNGFNAYWMMYMASDPSTRDKVTSALQEAAKNGMNIARTW  87

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            AFSDGGYRALQ +PG YN+D+FKGLDFVI+EA K G+ +ILSLANN+  FGG
Sbjct  88   AFSDGGYRALQTSPGVYNQDMFKGLDFVISEAGKNGVYLILSLANNWNDFGG  139



>emb|CDP07490.1| unnamed protein product [Coffea canephora]
Length=426

 Score =   160 bits (406),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            F+  +  + S  +A + FI+T G+ F+  G  FYANGFNAYWLM   SDPS++ KVS AF
Sbjct  14   FLIHNRRTSSEVSAQDEFIRTEGVQFLEEGSPFYANGFNAYWLMIFGSDPSKQNKVSTAF  73

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
              A SHGLTVARTWAF+DGG   LQ++PG+YNE +F+GLD VI+EARKYG+++ILSL NN
Sbjct  74   EEAVSHGLTVARTWAFNDGGDFPLQFSPGNYNEKMFQGLDLVISEARKYGIRLILSLVNN  133

Query  460  YESFGG  477
            Y++FGG
Sbjct  134  YDNFGG  139



>gb|KEH43148.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=403

 Score =   160 bits (405),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
             G GF++ +G HF++NG  +Y NGFN+YWLM +ASDPS R KV+  F+ AS HGL V RT
Sbjct  28   VGAGFVQRKGTHFILNGKPYYLNGFNSYWLMTMASDPSTRVKVTSNFQQASQHGLNVGRT  87

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DG  + LQ +PGSY+E+VFKGLDFVI+EARKYG+K+ILSL NN+  FGG
Sbjct  88   WAFNDGDSKPLQISPGSYDENVFKGLDFVISEARKYGVKLILSLVNNWNDFGG  140



>ref|XP_010112044.1| Mannan endo-1,4-beta-mannosidase 5 [Morus notabilis]
 gb|EXC32463.1| Mannan endo-1,4-beta-mannosidase 5 [Morus notabilis]
Length=403

 Score =   160 bits (405),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
               +GF++TRG  F+++G  F  NGFN+YW+M VAS PSQR K+S+ FR A++ GLTV R
Sbjct  26   VVSSGFVETRGTGFIVDGSPFLFNGFNSYWMMTVASQPSQRSKISDVFREAAAAGLTVCR  85

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAFSDGG RALQ +P  YNE VF+GLDFVI+EARKYG+K+ILSL+NNYE +GG
Sbjct  86   TWAFSDGGDRALQMSPRLYNEAVFQGLDFVISEARKYGVKLILSLSNNYEDYGG  139



>ref|XP_004303778.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Fragaria 
vesca subsp. vesca]
Length=418

 Score =   160 bits (405),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 94/119 (79%), Gaps = 1/119 (1%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G  +AA + F +T+G HF +NG +FY NGFNAYW+MY+ASDP  R KV+  F+ AS +G+
Sbjct  27   GETQAASSSFAQTQGNHFFMNGRSFYLNGFNAYWMMYMASDPYTRAKVTSVFQQASRYGM  86

Query  304  TVARTWAFSDG-GYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             +ARTWAFSDG  YR LQ +PGSYNED+FKGLDFVI+EAR YG+ VILSL NN++ +GG
Sbjct  87   NIARTWAFSDGVSYRPLQSSPGSYNEDMFKGLDFVISEARNYGVHVILSLVNNFDDYGG  145



>emb|CAC08208.1| (1-4)-beta-mannan endohydrolase [Coffea arabica]
Length=427

 Score =   160 bits (405),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V ++ + FI+TRG  F++ GY F+ NGFN+YW+M+VA++PS+R+K+S  FR A++ GLTV
Sbjct  31   VSSSASRFIQTRGTRFVLGGYPFFFNGFNSYWMMHVAAEPSERHKISNVFREAAATGLTV  90

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             RTWAFSDGG RALQ +PG Y+E VF+ LDFV++EARKYG+ +ILSL NNY+ FGG
Sbjct  91   CRTWAFSDGGDRALQMSPGVYDERVFQALDFVVSEARKYGVHLILSLTNNYKDFGG  146



>ref|XP_008805818.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Phoenix dactylifera]
Length=390

 Score =   159 bits (403),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +1

Query  118  LSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSH  297
            L G    AG+ F++T G HF+++G +FY+NGFNAYWLM +ASDP+QRYKVS   + AS +
Sbjct  18   LQGGSAYAGSSFVRTSGTHFVLDGRSFYSNGFNAYWLMLMASDPTQRYKVSSVLQQASDY  77

Query  298  GLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            G++V RTWAFSDGG   LQY+P  YNE++F+GLDFVI+EA+K+G+ +ILSL NNY  FGG
Sbjct  78   GMSVVRTWAFSDGGSNPLQYSPAYYNENMFQGLDFVISEAKKHGVFLILSLVNNYADFGG  137



>gb|KHN12693.1| Mannan endo-1,4-beta-mannosidase 7 [Glycine soja]
Length=389

 Score =   159 bits (403),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +1

Query  178  MINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFSDGGYRALQY  357
            M+NG  +YANG+NAYWLMY+ASDPSQR KVS  F+  ++HGL +ARTWAFSDGGY+ LQY
Sbjct  1    MLNGSPYYANGYNAYWLMYMASDPSQRNKVSSVFQKGTNHGLNIARTWAFSDGGYKPLQY  60

Query  358  APGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            +PG YNED+F GLDFVI+EAR+YG K++LSL NNY++FGG
Sbjct  61   SPGFYNEDLFLGLDFVISEARRYGTKLVLSLVNNYDNFGG  100



>gb|KHN14185.1| Putative mannan endo-1,4-beta-mannosidase 9 [Glycine soja]
Length=394

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++  G +F+++   FY NGFNAYWLMY+ASDP+ R KV+   + ASSHGLTVARTWAF
Sbjct  24   GFVQRSGTNFVLSNRHFYFNGFNAYWLMYMASDPATRPKVTAVLQQASSHGLTVARTWAF  83

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGGYRALQ +PGSY+E VF+GLDFV++EA KYG+++ILSL NN++ FGG
Sbjct  84   SDGGYRALQVSPGSYDEKVFRGLDFVVSEAGKYGVRLILSLVNNWKDFGG  133



>ref|XP_003554587.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Glycine max]
Length=410

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++    +F++N   FY NGFNAYWLMY+ASDPS R KV+   + AS+HGLTVARTWAF
Sbjct  40   GFVQRSSTNFVLNNKRFYFNGFNAYWLMYMASDPSTRPKVTAVLQQASNHGLTVARTWAF  99

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGGYRALQ +PGSY+E VF+GLDFV++EA KYG+++ILSL NN++ FGG
Sbjct  100  SDGGYRALQVSPGSYDEKVFRGLDFVVSEAGKYGVRLILSLVNNWKDFGG  149



>ref|XP_006356528.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Solanum tuberosum]
Length=413

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A   GF++  G HF +NG  F  NGFN+YWLM+VA++PS+RYKV+E  R ASS GL+V R
Sbjct  33   ANDQGFVRVNGAHFELNGSPFLFNGFNSYWLMHVAAEPSERYKVTEVLREASSAGLSVCR  92

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAFSDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NNY  FGG
Sbjct  93   TWAFSDGGDRALQISPGVYDERVFQGLDFVISEAKKYGVRLILSFVNNYNDFGG  146



>ref|XP_004969435.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Setaria italica]
Length=428

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G+GF++ +G  F++NG  F+ANGFNAYWLM + +DP+QR KV+ A   A+  GLTVAR
Sbjct  24   ARGDGFVRVQGTRFVLNGSPFFANGFNAYWLMSLGADPAQRGKVTSALSQAAGAGLTVAR  83

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAFSDGG  ALQY+PG YNE+ F+GLDFV++EARK+G+K+ILSL N+Y+SFGG
Sbjct  84   TWAFSDGGSNALQYSPGRYNENTFQGLDFVLSEARKHGIKMILSLVNSYDSFGG  137



>ref|XP_010486712.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like [Camelina 
sativa]
Length=407

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +1

Query  112  SSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGAS  291
            S L G   A+ NGF+  +GI F+ NG  FYANGFNAYWL Y A+DP+ R+K++ AF+ A+
Sbjct  19   SDLEGVEAASSNGFVSRKGIQFIFNGKPFYANGFNAYWLAYEATDPTTRFKITYAFQNAT  78

Query  292  SHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            SHGLT+ARTW F DG  YR LQ +PGSY+E  F+GLDFVIAEA++ G+K+I++  NNY  
Sbjct  79   SHGLTIARTWGFRDGAIYRGLQTSPGSYDEKTFQGLDFVIAEAKRLGIKMIITFVNNYSD  138

Query  469  FGG  477
            FGG
Sbjct  139  FGG  141



>ref|NP_001235608.1| endo-1,4-beta-mannanase precursor [Glycine max]
 ref|XP_006576270.1| PREDICTED: endo-1,4-beta-mannanase isoform X1 [Glycine max]
 ref|XP_006576271.1| PREDICTED: endo-1,4-beta-mannanase isoform X2 [Glycine max]
 gb|ABG88068.1| endo-1,4-beta-mannanase [Glycine max]
Length=410

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++  G +F+++   FY NGFNAYWLMY+ASDP+ R KV+   + ASSHGLTVARTWAF
Sbjct  40   GFVQRSGTNFVLSNRHFYFNGFNAYWLMYMASDPATRPKVTAVLQQASSHGLTVARTWAF  99

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGGYRALQ +PGSY+E VF+GLDFV++EA KYG+++ILSL NN++ FGG
Sbjct  100  SDGGYRALQVSPGSYDEKVFRGLDFVVSEAGKYGVRLILSLVNNWKDFGG  149



>ref|XP_002272344.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Vitis vinifera]
 emb|CBI17040.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++TR   F++NG  F+ NGFN+YWLM+++++PSQR KVS+ FR AS+ GL+V RTWAF
Sbjct  30   GFVQTRNTQFILNGSPFFFNGFNSYWLMHISAEPSQRNKVSDVFRQASAAGLSVCRTWAF  89

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGGY+ALQ +PG Y+E VF+GLDFVI+EARK G++++L+L+NNY+ FGG
Sbjct  90   SDGGYQALQISPGVYDERVFQGLDFVISEARKNGIRLVLTLSNNYQDFGG  139



>ref|XP_002884818.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61077.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=415

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +1

Query  106  QQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRG  285
            Q SS  G    + +GF+  +G+ F++NG  FYANGFNAYWL Y A+DP+ R+K++  F+ 
Sbjct  16   QNSSYLGVKAVSSDGFVSRKGVQFILNGKPFYANGFNAYWLAYEATDPTTRFKITYVFQN  75

Query  286  ASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            A+ HGLT+ARTW F DGGYRALQ APG Y+E  F+GLDF IAEA++ G+K+I++  NNY 
Sbjct  76   ATIHGLTIARTWGFRDGGYRALQIAPGVYDEKTFQGLDFAIAEAKRLGIKMIITFVNNYS  135

Query  466  SFGG  477
             FGG
Sbjct  136  DFGG  139



>gb|AES61540.2| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=387

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
             G GF++ +GIHF++NG T Y NGFN++WLM +A+D S R KV+ AF+ AS HGL V RT
Sbjct  27   VGVGFVQRKGIHFLMNGKTHYVNGFNSHWLMIMAADLSTRPKVTSAFQQASQHGLNVGRT  86

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DGGY+ALQ +PG Y+E VF+GLDFVI+EA KYG+K+ILSLANN+ +FGG
Sbjct  87   WAFNDGGYKALQISPGFYDETVFQGLDFVISEASKYGVKLILSLANNWNNFGG  139



>ref|XP_003591288.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES61539.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=402

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++ +G HF++NG T Y NGFN+YWL  +ASDPS   KV+  F+ AS HGL V RTWAF
Sbjct  28   GFVQRKGTHFILNGKTHYVNGFNSYWLTTMASDPSTSSKVTSTFQQASQHGLNVGRTWAF  87

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            +DGGY+ALQ +PGSY+E+VFK LDFVI+EA KYG+K+ILSL NN+  FGG
Sbjct  88   NDGGYKALQISPGSYDENVFKALDFVISEASKYGVKLILSLVNNWNDFGG  137



>gb|KFK38477.1| hypothetical protein AALP_AA3G118100 [Arabis alpina]
Length=413

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
             +GF+  +G+ F++NG  F+ANGFNAYWLMY A+DP+ R+K++ AF+ A+ HGLT+ARTW
Sbjct  25   ADGFVSRKGVQFILNGKPFHANGFNAYWLMYEATDPATRFKITYAFQNATMHGLTIARTW  84

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             F DGGYRALQ APG Y+E  FKGLDF IAEA++ G+K+I++  NNY  FGG
Sbjct  85   GFHDGGYRALQIAPGIYDELTFKGLDFAIAEAKRLGIKMIITFVNNYSDFGG  136



>ref|XP_009785847.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Nicotiana 
sylvestris]
Length=443

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++T+G HF++NG  F  NGFN+YWLM+VA+DP++RYKVSE F+ AS+  L+V RTWAF
Sbjct  31   GFVRTKGAHFVLNGSPFLFNGFNSYWLMHVAADPTERYKVSEVFQEASAASLSVCRTWAF  90

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGG  ALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NNY+ FGG
Sbjct  91   SDGGDTALQISPGVYDERVFQGLDFVISEAKKYGIRLILSFVNNYKDFGG  140



>ref|XP_003569504.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 [Brachypodium distachyon]
Length=417

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            +AAG GF++ +G  F+ING  +YANGFNAYWLM +A+DP+QR KV+     A++ GL+VA
Sbjct  20   EAAGGGFVRAQGTRFVINGSPYYANGFNAYWLMTMAADPAQRGKVTSTLSQAAARGLSVA  79

Query  313  RTWAFSDGGY-RALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            RTWAFSDGG   ALQY+PG+YNE+ FKGLDFV++E RK+ +KVILSL NNY+SFGG
Sbjct  80   RTWAFSDGGSNNALQYSPGNYNENTFKGLDFVLSEVRKHEVKVILSLVNNYDSFGG  135



>ref|XP_009616037.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Nicotiana 
tomentosiformis]
Length=440

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++T+G HF++NG  F  NGFN+YWLM+VA+DP++RYKVSE F+ AS+  L+V RTWAF
Sbjct  33   GFVRTKGAHFVLNGSPFLFNGFNSYWLMHVAADPTERYKVSEVFQEASAASLSVCRTWAF  92

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGG  ALQ +PG Y+E VF GLDFVI+EARKYG+++ILS  NNY+ FGG
Sbjct  93   SDGGDTALQISPGVYDERVFLGLDFVISEARKYGIRLILSFVNNYKDFGG  142



>gb|EYU45794.1| hypothetical protein MIMGU_mgv1a011066mg [Erythranthe guttata]
Length=293

 Score =   155 bits (392),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G  + A   F+ TRG  F++NG  FY NGFN+YWLMY+ASDP  + KV+E F  AS +G+
Sbjct  21   GEARLARESFVGTRGTQFVVNGRPFYFNGFNSYWLMYMASDPLTKEKVTETFAQASEYGM  80

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             +ARTWAFSDGG R LQ +PG YNED+FKGLDFV++EA+K+G+ +ILSL NN+E +GG
Sbjct  81   NLARTWAFSDGGNRPLQKSPGLYNEDMFKGLDFVVSEAKKHGIYLILSLVNNWEGYGG  138



>ref|XP_009621242.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009621243.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 isoform X2 [Nicotiana 
tomentosiformis]
Length=411

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            + A  GFI  +G HF +NG  F  NGFN+YWLM+VA++PS+RYKV+E F+ AS+ GL+V 
Sbjct  27   RNANVGFIAVKGAHFELNGSPFLFNGFNSYWLMHVAAEPSERYKVTEVFKDASAAGLSVC  86

Query  313  RTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            RTWAFSDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NN+  FGG
Sbjct  87   RTWAFSDGGDRALQISPGIYDERVFQGLDFVISEAKKYGVRLILSFVNNWNDFGG  141



>ref|XP_010490985.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like isoform X2 
[Camelina sativa]
Length=417

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +1

Query  112  SSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGAS  291
            S L G   A+ NGF+  +G+ F+ NG  FYANGFNAYWL Y A+DP+ R+K++ AF+ A+
Sbjct  19   SDLGGVEAASSNGFVTRKGVQFIFNGKPFYANGFNAYWLAYEATDPTTRFKITYAFQNAT  78

Query  292  SHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            SHGLT+ARTW F DG  YR LQ +PGSY+E  F+GLDFVIAEA++ G+K+I++  NNY  
Sbjct  79   SHGLTIARTWGFRDGAIYRGLQTSPGSYDEKTFQGLDFVIAEAKRLGIKMIITFVNNYSD  138

Query  469  FGG  477
            FGG
Sbjct  139  FGG  141



>ref|XP_010464779.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like [Camelina 
sativa]
Length=417

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +1

Query  112  SSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGAS  291
            S L G   A+ NGF+  +G+ F+ NG  FYANGFNAYWL Y A+DP+ R+K++ AF+ A+
Sbjct  19   SDLGGVEAASSNGFVTRKGVQFIFNGKPFYANGFNAYWLTYEATDPTTRFKITYAFQNAT  78

Query  292  SHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            SHGLT+ARTW F DG  YR LQ +PGSY+E  F+GLDFVIAEA++ G+K+I++  NNY  
Sbjct  79   SHGLTIARTWGFRDGAIYRGLQTSPGSYHEKTFQGLDFVIAEAKRLGIKMIITFVNNYSD  138

Query  469  FGG  477
            FGG
Sbjct  139  FGG  141



>ref|XP_010490811.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like [Camelina 
sativa]
Length=417

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +1

Query  112  SSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGAS  291
            S L G   A+ NGF+  +G+ F+ NG  FYANGFNAYWL Y A+DP+ R+K++ AF+ A+
Sbjct  19   SDLGGVEAASSNGFVTRKGVQFIFNGKPFYANGFNAYWLTYEATDPTTRFKITYAFQNAT  78

Query  292  SHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            SHGLT+ARTW F DG  YR LQ +PGSY+E  F+GLDFVIAEA++ G+K+I++  NNY  
Sbjct  79   SHGLTIARTWGFRDGAIYRGLQTSPGSYHEKTFQGLDFVIAEAKRLGIKMIITFVNNYSD  138

Query  469  FGG  477
            FGG
Sbjct  139  FGG  141



>ref|XP_010490914.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like isoform X1 
[Camelina sativa]
Length=417

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +1

Query  112  SSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGAS  291
            S L G   A+ NGF+  +G+ F+ NG  FYANGFNAYWL Y A+DP+ R+K++ AF+ A+
Sbjct  19   SDLGGVEAASSNGFVTRKGVQFIFNGKPFYANGFNAYWLAYEATDPTTRFKITYAFQNAT  78

Query  292  SHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            SHGLT+ARTW F DG  YR LQ +PGSY+E  F+GLDFVIAEA++ G+K+I++  NNY  
Sbjct  79   SHGLTIARTWGFRDGAIYRGLQTSPGSYDEKTFQGLDFVIAEAKRLGIKMIITFVNNYAD  138

Query  469  FGG  477
            FGG
Sbjct  139  FGG  141



>ref|XP_009763332.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Nicotiana 
sylvestris]
Length=409

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++T G HF++N   F  NGFN+YWLM+VASDPS+RYKVSE F+ AS+  L+V RTWAF
Sbjct  33   GFVRTNGAHFVLNRSPFLFNGFNSYWLMHVASDPSERYKVSEVFQEASAARLSVCRTWAF  92

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGG  ALQ +PG Y+E VF+GLDFVI EARKYG+++ILS  NNY  FGG
Sbjct  93   SDGGDTALQISPGVYDERVFQGLDFVITEARKYGIRLILSFVNNYNDFGG  142



>ref|XP_009593808.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            + A  GFI   G HF +NG  F  NGFN+YWLM+VA+DP++RYKV+E  R AS+ GL++ 
Sbjct  27   RNANAGFIAVNGAHFELNGSPFLFNGFNSYWLMHVAADPTERYKVTEVLRDASAAGLSIC  86

Query  313  RTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            RTWAFSDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NN+  FGG
Sbjct  87   RTWAFSDGGDRALQISPGVYDEHVFQGLDFVISEAKKYGVRLILSFVNNWNDFGG  141



>ref|XP_003591289.1| NADH dehydrogenase subunit F [Medicago truncatula]
Length=560

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
             G GF++ +GIHF++NG T Y NGFN++WLM +A+D S R KV+ AF+ AS HGL V RT
Sbjct  27   VGVGFVQRKGIHFLMNGKTHYVNGFNSHWLMIMAADLSTRPKVTSAFQQASQHGLNVGRT  86

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAF+DGGY+ALQ +PG Y+E VF+GLDFVI+EA KYG+K+ILSLANN+ +FGG
Sbjct  87   WAFNDGGYKALQISPGFYDETVFQGLDFVISEASKYGVKLILSLANNWNNFGG  139



>ref|XP_006407494.1| hypothetical protein EUTSA_v10020842mg [Eutrema salsugineum]
 gb|ESQ48947.1| hypothetical protein EUTSA_v10020842mg [Eutrema salsugineum]
Length=408

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +1

Query  106  QQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRG  285
            Q  S  G   A+ + F+  +G+ F++NG  FYANGFNAYWL Y A+DP+ R+KV+ A + 
Sbjct  16   QSYSDLGVESASSDAFVSRKGLQFILNGKPFYANGFNAYWLTYEATDPATRFKVTFALQN  75

Query  286  ASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            A+ HGLT+ARTW F DGGYRALQ APGSYNE  F+GLDF IAEA++ G+K+I++  NNY 
Sbjct  76   ATIHGLTIARTWGFHDGGYRALQTAPGSYNELAFQGLDFAIAEAKRLGIKMIITFVNNYS  135

Query  466  SFGG  477
             FGG
Sbjct  136  DFGG  139



>emb|CDP20125.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V ++ + FI+TRG  F++ G  F+ NGFN+YW+M+VA++PS+R+K+S  FR A++ GLTV
Sbjct  31   VSSSASRFIQTRGTRFVLGGSPFFFNGFNSYWMMHVAAEPSERHKISNVFREAAAAGLTV  90

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             RTWAFSDGG RALQ +PG Y+E VF+ LDFV++EARKYG+ +ILSL NNY+ FGG
Sbjct  91   CRTWAFSDGGDRALQMSPGVYDERVFQALDFVVSEARKYGVHLILSLTNNYKDFGG  146



>ref|XP_009789471.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like isoform X1 
[Nicotiana sylvestris]
Length=407

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            K A  GFI   G HF +NG +F  NGFN+YWLM+VA++PS+RYKV+E  + AS+ GL+V 
Sbjct  27   KNANVGFIAVNGAHFELNGSSFLFNGFNSYWLMHVAAEPSERYKVTEVLKDASAAGLSVC  86

Query  313  RTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            RTWAFSDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NN+  FGG
Sbjct  87   RTWAFSDGGDRALQISPGVYDERVFQGLDFVISEAKKYGVRLILSFVNNWNDFGG  141



>gb|KEH43147.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=403

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
             G GF++ +G HF++NG T Y NGFN+YWLM +ASDPS R KV+  F+ AS HGL V RT
Sbjct  28   VGGGFVQRKGTHFILNGKTHYVNGFNSYWLMTMASDPSTRVKVTSNFQQASQHGLNVGRT  87

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             AF+DG Y+ LQ +PG Y+E+VFKGLDFVI+EA KYG+K+ILSL NN+  FGG
Sbjct  88   LAFNDGDYKPLQISPGKYDENVFKGLDFVISEANKYGVKLILSLVNNWNDFGG  140



>emb|CAC51690.3| endo-beta-1,4-mannanase [Lactuca sativa]
Length=410

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +1

Query  145  NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWA  324
            + F++TR  HFM+NG   Y NGFNAYWLM +ASDPS R KV++AF+ +S  G+ + RTWA
Sbjct  24   DSFVETRTHHFMVNGKPLYFNGFNAYWLMCMASDPSTRVKVTDAFQESSKIGMNLVRTWA  83

Query  325  FSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            FSDGG + LQ +PG YNED+FKGLDFVI+EA+KYG+ +ILSL NN++ FGG
Sbjct  84   FSDGGNKPLQTSPGFYNEDMFKGLDFVISEAKKYGIHLILSLVNNWDDFGG  134



>ref|XP_009760858.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1 [Nicotiana sylvestris]
Length=411

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GFI  +G HF +NG  F  NGFN+YWLM+VA++PS+RYKV+E  + AS+ GL+V RTWAF
Sbjct  32   GFIAVKGAHFELNGLPFLFNGFNSYWLMHVAAEPSERYKVTEVLKDASAAGLSVCRTWAF  91

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NN+  FGG
Sbjct  92   SDGGDRALQISPGVYDERVFQGLDFVISEAKKYGVRLILSFVNNWNDFGG  141



>ref|NP_001043785.1| Os01g0663300 [Oryza sativa Japonica Group]
 dbj|BAF05699.1| Os01g0663300 [Oryza sativa Japonica Group]
Length=403

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F++ +G  F+++G  +YANGFNAYWLM +A+DPSQR KVS A   A+ HGLTVARTWAFS
Sbjct  37   FVRAQGTRFVLDGNPYYANGFNAYWLMLLAADPSQRGKVSAALGEAAGHGLTVARTWAFS  96

Query  331  D-GGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            D GG  ALQ +PG+YNE+ FKGLDFV++EARKYG+KVILSL +NY+SFGG
Sbjct  97   DGGGGNALQLSPGNYNENTFKGLDFVLSEARKYGIKVILSLVDNYDSFGG  146



>ref|XP_006356570.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Solanum tuberosum]
Length=435

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F++TRG HF++NG  F  NGFN+YWLM+VA++P++RYK+SE F+ AS+  L+V RTWAFS
Sbjct  34   FVRTRGAHFVLNGSPFLFNGFNSYWLMHVAAEPTERYKISEVFKEASAASLSVCRTWAFS  93

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            DGG  ALQ +PG Y+E V +GLDFVI+EARKYG+++ILS  NNY+ FGG
Sbjct  94   DGGDAALQISPGVYDERVLQGLDFVISEARKYGIRLILSFVNNYKDFGG  142



>sp|Q0JKM9.2|MAN1_ORYSJ RecName: Full=Mannan endo-1,4-beta-mannosidase 1; AltName: Full=Beta-mannanase 
1; AltName: Full=Endo-beta-1,4-mannanase 1; 
AltName: Full=OsMAN1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB91747.1| putative (1-4)-beta-mannan endohydrolase [Oryza sativa Japonica 
Group]
 gb|EAZ12991.1| hypothetical protein OsJ_02911 [Oryza sativa Japonica Group]
Length=432

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F++ +G  F+++G  +YANGFNAYWLM +A+DPSQR KVS A   A+ HGLTVARTWAFS
Sbjct  37   FVRAQGTRFVLDGNPYYANGFNAYWLMLLAADPSQRGKVSAALGEAAGHGLTVARTWAFS  96

Query  331  D-GGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            D GG  ALQ +PG+YNE+ FKGLDFV++EARKYG+KVILSL +NY+SFGG
Sbjct  97   DGGGGNALQLSPGNYNENTFKGLDFVLSEARKYGIKVILSLVDNYDSFGG  146



>ref|XP_010490578.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 4 [Camelina 
sativa]
Length=408

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G   A+ NGF+  +G+ F++NG  FYANGFNAYWL Y A+DP+ RYK++ AF+ A SHGL
Sbjct  23   GVEAASNNGFVTRKGVQFILNGKPFYANGFNAYWLTYEATDPTARYKITHAFQDAISHGL  82

Query  304  TVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            T+ARTW F DG  YRALQ +PG Y+E  F+GLDFVIAEA++ G+K+I+ L NN+  +GG
Sbjct  83   TIARTWGFHDGAIYRALQTSPGIYDEKTFQGLDFVIAEAKRLGIKLIIPLVNNWSDYGG  141



>emb|CDP11079.1| unnamed protein product [Coffea canephora]
Length=391

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = +1

Query  127  SVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLT  306
            +V   G GF++T+G  F++NG  F  NGFN+YWLM+VA+DP +RYKVSE  R AS+ GL+
Sbjct  34   TVPRNGAGFVRTQGPRFVLNGSPFLFNGFNSYWLMHVAADPKERYKVSEVLRDASAAGLS  93

Query  307  VARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            V RTWAF DGG RALQ +PG Y+E VF+ LDFVI+EA K+G+++ILS  NNY  FGG
Sbjct  94   VCRTWAFGDGGDRALQISPGIYDERVFQALDFVISEANKHGIRLILSFVNNYNDFGG  150



>gb|KCW46728.1| hypothetical protein EUGRSUZ_K00551 [Eucalyptus grandis]
Length=387

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G+GF +T GIHF+ NG   Y NGFNAYW+MY+ASDPS R KV+ A + A+ +G+ +ARTW
Sbjct  28   GSGFARTNGIHFVANGKPLYLNGFNAYWMMYMASDPSTRDKVTSALQEAAKNGMNIARTW  87

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFG  474
            AFSDGGYRALQ +PG YN+D+FKGLDFVI+EA K G+ +ILSL NN++ +G
Sbjct  88   AFSDGGYRALQTSPGVYNQDMFKGLDFVISEAGKNGVYLILSLVNNWKVYG  138



>ref|XP_007163264.1| hypothetical protein PHAVU_001G219800g [Phaseolus vulgaris]
 gb|ESW35258.1| hypothetical protein PHAVU_001G219800g [Phaseolus vulgaris]
Length=415

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++  G +F++N   FY NGFNAYWLM++ASDPS R KV+   + ASSHGLTVARTWAF
Sbjct  47   GFVRRSGTNFVLNNKRFYFNGFNAYWLMFMASDPSTRPKVASILQEASSHGLTVARTWAF  106

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            +DG YRALQ +PGSY+E VF+GLDFVI+EA K G+++ILSL NN++ FGG
Sbjct  107  NDGAYRALQVSPGSYDEKVFRGLDFVISEAGKNGVRLILSLVNNWKDFGG  156



>ref|XP_010468110.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 4 [Camelina 
sativa]
Length=182

 Score =   149 bits (377),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 88/119 (74%), Gaps = 1/119 (1%)
 Frame = +1

Query  124  GSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            G      +GF+   G+ F++NG  FYANGFNAYWL Y A+DP+ RYK++ AF+ A SHGL
Sbjct  23   GVEAVPNDGFVTRNGLQFILNGKPFYANGFNAYWLTYEATDPTARYKITNAFQDAISHGL  82

Query  304  TVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            T+ARTW F DG  YRALQ +PG Y+E  F+GLDFVIAEA++ G+K+I+ L NN+  +GG
Sbjct  83   TIARTWGFHDGAIYRALQTSPGIYDEQTFQGLDFVIAEAKRLGIKMIMPLVNNWSDYGG  141



>gb|AHA84179.1| endo-1,4-beta-mannanase [Phaseolus vulgaris]
Length=415

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++  G +F++N   FY NGFNAYWLM++ASDPS R KV+   + ASSHGLTVARTWAF
Sbjct  47   GFVRRSGTNFVLNNKRFYFNGFNAYWLMFMASDPSTRPKVASILQEASSHGLTVARTWAF  106

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            +DG YRALQ +PGSY+E VF+GLDFVI+EA K G+++ILSL NN++ FGG
Sbjct  107  NDGAYRALQVSPGSYDEKVFRGLDFVISEAGKNGVRLILSLVNNWKDFGG  156



>emb|CDX73899.1| BnaA03g31480D [Brassica napus]
Length=285

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A+ +GF+  +G+ F++NG  FYANGFNAYWLMY A+DP+ RYKV+ A   A+  GLT+AR
Sbjct  26   ASSDGFVSRKGVQFILNGEPFYANGFNAYWLMYEATDPNTRYKVTHALENAAGQGLTIAR  85

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TW F DGGYRALQ   GSY+E  F+GLDF IAEA++ G+K+I++  NN+  FGG
Sbjct  86   TWGFRDGGYRALQTNLGSYDEQTFQGLDFSIAEAKRVGIKMIIAFVNNFPDFGG  139



>ref|XP_011468408.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
4-like [Fragaria vesca subsp. vesca]
Length=381

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            AG+ F  T G  F++NG  FY NGFNAYW+MY+ASDPS +  V+ AF+ AS + + VART
Sbjct  6    AGSSFGGTTGTRFVMNGKPFYMNGFNAYWMMYMASDPSTQLMVTSAFQQASKYKMNVART  65

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            W FSDGG R LQ +PGSYNE++FKGLDFVI+EA+KYG+ +ILSL NNYE+FGG
Sbjct  66   WGFSDGGDRPLQISPGSYNENMFKGLDFVISEAKKYGVYLILSLVNNYEAFGG  118



>ref|XP_006491440.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Citrus sinensis]
Length=412

 Score =   155 bits (391),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F +T G HF +NG   Y NGFNAYW++Y A DPS + KV+ AF+ A+ +G+ +ARTWAFS
Sbjct  36   FAQTNGSHFAVNGKPLYLNGFNAYWMLYYAGDPSTKAKVTAAFQQATKYGMNIARTWAFS  95

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            DGGYRALQ +PGSYNED FK LDFV+AEAR+YG+ VILSL NN++ +GG
Sbjct  96   DGGYRALQVSPGSYNEDTFKALDFVVAEAREYGVYVILSLVNNFKEYGG  144



>ref|XP_006444660.1| hypothetical protein CICLE_v10020376mg [Citrus clementina]
 gb|ESR57900.1| hypothetical protein CICLE_v10020376mg [Citrus clementina]
 gb|KDO86723.1| hypothetical protein CISIN_1g015179mg [Citrus sinensis]
Length=412

 Score =   155 bits (391),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F +T G HF +NG   Y NGFNAYW++Y A DPS + KV+ AF+ A+ +G+ +ARTWAFS
Sbjct  36   FAQTNGSHFAVNGKPLYLNGFNAYWMLYYAGDPSTKAKVTAAFQQATKYGMNIARTWAFS  95

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            DGGYRALQ +PGSYNED FK LDFV+AEAR+YG+ VILSL NN++ +GG
Sbjct  96   DGGYRALQVSPGSYNEDTFKALDFVVAEAREYGVYVILSLVNNFKEYGG  144



>ref|XP_008245064.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Prunus mume]
Length=429

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNG--FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSE  273
            F+Q     G    A NG  F +T G  F++NG  FY NGFNAYW+MY+ASDPS R KV+ 
Sbjct  27   FIQHGDCKGEANHASNGGAFARTEGTRFVMNGRPFYINGFNAYWMMYMASDPSSRAKVTS  86

Query  274  AFRGASSHGLTVARTWAFSDGG--YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILS  447
            AF+ AS +G+ VARTWAF+DG    R LQ +PGSYNED FKGLDFVI+EA+K+G+ +ILS
Sbjct  87   AFQQASRYGMNVARTWAFNDGSGTDRPLQPSPGSYNEDTFKGLDFVISEAKKFGVHLILS  146

Query  448  LANNYESFGG  477
              NN+  FGG
Sbjct  147  FVNNFSDFGG  156



>ref|XP_006356569.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Solanum tuberosum]
Length=438

 Score =   155 bits (392),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F++TRG HF++NG  F  NGFN+YWLM+VA++P++RYKVSE F+ AS   L+V RTWAFS
Sbjct  37   FVRTRGAHFVLNGSPFLFNGFNSYWLMHVAAEPTERYKVSEVFKEASGASLSVCRTWAFS  96

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            DGG  ALQ +PG Y+E + +GLDFVI+EARKYG+++ILS  NNY+ FGG
Sbjct  97   DGGDAALQISPGVYDERILQGLDFVISEARKYGIRLILSFVNNYKDFGG  145



>gb|EEC71222.1| hypothetical protein OsI_03157 [Oryza sativa Indica Group]
Length=432

 Score =   155 bits (392),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F++ +G  F+++G  +YANGFNAYWLM +A+DPSQR KV+ A   A+ HGLTVARTWAFS
Sbjct  37   FVRAQGTRFVLDGNPYYANGFNAYWLMLLAADPSQRGKVTAALGEAAGHGLTVARTWAFS  96

Query  331  D-GGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            D GG  ALQ +PG+YNE+ FKGLDFV++EARKYG+KVILSL +NY+SFGG
Sbjct  97   DGGGGNALQLSPGNYNENTFKGLDFVLSEARKYGIKVILSLVDNYDSFGG  146



>ref|XP_009779875.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Nicotiana 
sylvestris]
Length=411

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GFI   G HF +NG  F  NGFN+YWLM+VA++PS+RYKV+E  + AS+ GL+V RTWAF
Sbjct  32   GFIAVNGAHFELNGSPFLFNGFNSYWLMHVAAEPSERYKVTEVLKDASAAGLSVCRTWAF  91

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NN+  FGG
Sbjct  92   SDGGDRALQISPGVYDERVFQGLDFVISEAKKYGVRLILSFVNNWNDFGG  141



>ref|NP_001234575.1| mannan endo-1,4-beta-mannosidase 1 precursor [Solanum lycopersicum]
 sp|O48540.2|MAN1_SOLLC RecName: Full=Mannan endo-1,4-beta-mannosidase 1; AltName: Full=Beta-mannanase 
1; AltName: Full=Endo-beta-1,4-mannanase 1; 
AltName: Full=LeMAN1; Flags: Precursor [Solanum lycopersicum]
 gb|AAB87859.2| (1-4)-beta-mannan endohydrolase [Solanum lycopersicum]
Length=397

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V  A +GFI  +  HF +NG  F  NGFN+YWLM+VA+DP++RYKV+E  + AS  GL+V
Sbjct  20   VCEANSGFIGVKDSHFELNGSPFLFNGFNSYWLMHVAADPTERYKVTEVLKDASVAGLSV  79

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             RTWAFSDGG RALQ +PG Y+E VF+GLDFVIAEA+KYG+++ILS  N +  FGG
Sbjct  80   CRTWAFSDGGDRALQISPGIYDERVFQGLDFVIAEAKKYGIRLILSFVNQWNDFGG  135



>ref|XP_009391931.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Musa 
acuminata subsp. malaccensis]
Length=446

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +1

Query  133  KAAGN-GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQ-RYKVSEAFRGASSHGLT  306
            +A G+ GF++T   HF++N   F  NGFNAYWLMYVAS P + R  VS AF+ AS+HGLT
Sbjct  22   RAHGDTGFVRTNMTHFLVNRRPFSLNGFNAYWLMYVASFPEEGRSMVSSAFQEASTHGLT  81

Query  307  VARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            +ARTWAF DGGY+ LQ +PG Y+ED+F+GLDFVI+EA+KYG+ ++LSL NN+ESFGG
Sbjct  82   LARTWAFRDGGYKPLQRSPGVYDEDMFQGLDFVISEAKKYGIYLVLSLVNNFESFGG  138



>ref|XP_010943133.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Elaeis 
guineensis]
Length=411

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G GFIK  GIHF+I+   FY+NGFNAYWLMY+ASDP+ R KVS   + A+S GL V RTW
Sbjct  26   GMGFIKPSGIHFIIDSQPFYSNGFNAYWLMYMASDPNDRTKVSPTLQKAASLGLKVIRTW  85

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            AF+DGGYRALQ +PG YNE  F+GLD+VI+EA+K G+ +IL+L NN+  FGG
Sbjct  86   AFNDGGYRALQESPGQYNEATFQGLDYVISEAKKNGVYLILTLVNNWGDFGG  137



>ref|XP_006300225.1| hypothetical protein CARUB_v10016461mg [Capsella rubella]
 gb|EOA33123.1| hypothetical protein CARUB_v10016461mg [Capsella rubella]
Length=434

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = +1

Query  109  QSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGA  288
             + L G   A+ +GF+  +G+ F++NG  FYANGFNAYWL Y A+DP+ R+K++ AF+ A
Sbjct  18   HTDLGGVEAASSDGFVGRKGVQFILNGKPFYANGFNAYWLTYEATDPTARFKITYAFQNA  77

Query  289  SSHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            +SHGL +ARTW F DG  YR LQ APG+Y+E  F+GLDFVIAEA++ GLK+I++  NNY 
Sbjct  78   TSHGLAIARTWGFRDGAIYRGLQTAPGTYDEKSFQGLDFVIAEAKRLGLKMIITFVNNYS  137

Query  466  SFGG  477
             FGG
Sbjct  138  DFGG  141



>gb|EYU22711.1| hypothetical protein MIMGU_mgv1a025294mg [Erythranthe guttata]
Length=406

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F++TRG  FM++   F  NGFNAYW+M+VASDP+QRYKVS   R +++ GL+V RTWAF+
Sbjct  29   FVQTRGTQFMLDNSPFLFNGFNAYWMMHVASDPTQRYKVSNVLRESAAAGLSVCRTWAFN  88

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            DGG +ALQ +PG Y+E+VF+ LDFV++EARKY +++I+SL+NNY+ FGG
Sbjct  89   DGGSQALQISPGVYDENVFQALDFVVSEARKYKIRLIMSLSNNYQDFGG  137



>ref|XP_009616057.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Nicotiana tomentosiformis]
Length=411

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A   GF+   G HF +NG  F  NGFN+YWLM+ A++PS+RYKV+E  + ASS GL+V R
Sbjct  31   ANNEGFVGVNGAHFELNGSPFLFNGFNSYWLMHAAAEPSERYKVTEVLQEASSSGLSVCR  90

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAFSDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NNY  FGG
Sbjct  91   TWAFSDGGDRALQISPGVYDERVFQGLDFVISEAKKYGVRLILSFVNNYNDFGG  144



>ref|XP_009785881.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Nicotiana sylvestris]
Length=405

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GFI   G HF +NG  F  NGFN+YWLM+ A++PS+RYKV+E  + ASS GL+V RTWAF
Sbjct  29   GFIGVNGAHFELNGSPFLFNGFNSYWLMHAAAEPSERYKVTEVLQEASSSGLSVCRTWAF  88

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NNY +FGG
Sbjct  89   SDGGDRALQISPGIYDERVFQGLDFVISEAKKYGVRLILSFVNNYNNFGG  138



>sp|Q9FUQ6.1|MAN3_SOLLC RecName: Full=Mannan endo-1,4-beta-mannosidase 3; AltName: Full=Beta-mannanase 
3; AltName: Full=Endo-beta-1,4-mannanase 3; 
AltName: Full=LeMAN3; Flags: Precursor [Solanum lycopersicum]
 gb|AAG14352.1| endo-beta-mannanase [Solanum lycopersicum]
Length=401

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GFI  +  HF +NG  F  NGFN+YWLM+VA+DP++RYKV+E  + AS+ GL+V RT
Sbjct  24   ANSGFIGVKDSHFELNGSPFLFNGFNSYWLMHVAADPAERYKVTEVLKDASTAGLSVCRT  83

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGG RALQ +PG Y+E VF+GLDFVIAEA+KYG+++ILS  N +  FGG
Sbjct  84   WAFSDGGDRALQISPGVYDERVFQGLDFVIAEAKKYGVRLILSFVNQWNDFGG  136



>ref|XP_010313893.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
3-like [Solanum lycopersicum]
Length=400

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GFI  +  HF +NG  F  NGFN+YWLM+VA+DP++RYKV+E  + AS+ GL+V RT
Sbjct  24   ANSGFIGVKDSHFELNGSPFLFNGFNSYWLMHVAADPAERYKVTEVLKDASTAGLSVCRT  83

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGG RALQ +PG Y+E VF+GLDFVIAEA+KYG+++ILS  N +  FGG
Sbjct  84   WAFSDGGDRALQISPGVYDERVFQGLDFVIAEAKKYGVRLILSFVNQWNDFGG  136



>ref|XP_002884819.1| hypothetical protein ARALYDRAFT_478424 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61078.1| hypothetical protein ARALYDRAFT_478424 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 92/127 (72%), Gaps = 1/127 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V   S  G   A+ NGF+   G+ F++NG  FYANGFNAYWL Y A+DP+ R+ ++  F
Sbjct  12   IVTAQSYVGVEAASSNGFVSRNGVQFILNGKPFYANGFNAYWLAYEATDPATRFMITNVF  71

Query  280  RGASSHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLAN  456
            + A+SHGLT+ARTW F DG  YRALQ APGSY+E  F+ LDFVIAEA++ G+K+I+ L N
Sbjct  72   QNATSHGLTIARTWGFRDGALYRALQTAPGSYDEQTFQVLDFVIAEAKRVGIKLIIPLVN  131

Query  457  NYESFGG  477
            N++ +GG
Sbjct  132  NWDDYGG  138



>ref|XP_003553696.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7-like [Glycine max]
Length=419

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            F   S  + + K    GFI+    HF +NG   Y NGFN+YWLM VASDPS   KVS  F
Sbjct  32   FHHHSHKNLTTKKLHGGFIERSNTHFYLNGKPHYLNGFNSYWLMNVASDPSTSSKVSITF  91

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
            + AS HGL VARTWAF+DGGY ALQ +PGSYNE+VFKGLDFVI+EA K G+++ILSL NN
Sbjct  92   QEASQHGLNVARTWAFNDGGYNALQISPGSYNENVFKGLDFVISEAGKNGVRLILSLVNN  151

Query  460  YESFGG  477
            +  +GG
Sbjct  152  WNDYGG  157



>ref|XP_006296763.1| hypothetical protein CARUB_v10015594mg [Capsella rubella]
 gb|EOA29661.1| hypothetical protein CARUB_v10015594mg [Capsella rubella]
Length=416

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 93/125 (74%), Gaps = 1/125 (1%)
 Frame = +1

Query  106  QQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRG  285
            Q  S  G   A+  GF+  +G+ F++NG  FYANGFNAYWL Y A+DP+ RYK++  F  
Sbjct  16   QNYSDLGVEAASSGGFVSRKGVQFILNGKPFYANGFNAYWLTYEATDPTARYKITHGFEN  75

Query  286  ASSHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNY  462
            A+S GLT+ARTW F+DG  YRALQ APGSY+E+ F+GLDFVI+EA++ GLK+I+ L NN+
Sbjct  76   ATSRGLTIARTWGFNDGASYRALQTAPGSYDENTFQGLDFVISEAKRVGLKMIIPLVNNW  135

Query  463  ESFGG  477
              +GG
Sbjct  136  SDYGG  140



>ref|XP_008800333.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Phoenix 
dactylifera]
Length=398

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A + F +T G HF++NG  F++NGFNAYWLM  ASDP+QR  VS  F+ AS +G++V RT
Sbjct  25   ASSSFARTSGTHFVVNGGPFFSNGFNAYWLMLKASDPTQRDTVSSTFQQASGYGMSVIRT  84

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGG  ALQY+PGSYNE++FKGLDFVI+EA+ +G+ +ILS  NNY  FGG
Sbjct  85   WAFSDGGDSALQYSPGSYNEEMFKGLDFVISEAKNHGVYLILSFVNNYADFGG  137



>ref|NP_187700.1| mannan endo-1,4-beta-mannosidase 3 [Arabidopsis thaliana]
 sp|Q9SG94.1|MAN3_ARATH RecName: Full=Mannan endo-1,4-beta-mannosidase 3; AltName: Full=Beta-mannanase 
3; AltName: Full=Endo-beta-1,4-mannanase 3; 
Short=AtMAN3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF19560.1|AC011708_3 putative (1-4)-beta-mannan endohydrolase [Arabidopsis thaliana]
 gb|AEE74967.1| mannan endo-1,4-beta-mannosidase 3 [Arabidopsis thaliana]
Length=414

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = +1

Query  106  QQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRG  285
            Q SS  G   A+ +GF+  +G+ F++NG  FYANGFNAYWL Y A+D + R+K++  F+ 
Sbjct  16   QNSSDLGVKSASSDGFVSRKGVQFILNGKPFYANGFNAYWLAYEATDSTTRFKITYVFQN  75

Query  286  ASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYE  465
            A+ H LT+ RTW F DGGYRALQ APG Y+E  F+GLDF IAEA++ G+K+I++  NNY 
Sbjct  76   ATIHDLTIVRTWGFRDGGYRALQIAPGVYDEKTFQGLDFAIAEAKRLGIKMIITFVNNYS  135

Query  466  SFGG  477
             FGG
Sbjct  136  DFGG  139



>pdb|1RH9|A Chain A, Family Gh5 Endo-Beta-Mannanase From Lycopersicon Esculentum 
(Tomato)
Length=373

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            + N F+ T G HF +NG + Y NGFNAYWLMY+A DPS R KV+  F+ AS + + VART
Sbjct  2    SNNNFVYTDGTHFALNGKSLYINGFNAYWLMYIAYDPSTRIKVTNTFQQASKYKMNVART  61

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFS GG R LQ APG YNE +F+GLDFVI+EA+KYG+ +I+SL NN+++FGG
Sbjct  62   WAFSHGGSRPLQSAPGVYNEQMFQGLDFVISEAKKYGIHLIMSLVNNWDAFGG  114



>ref|NP_001234131.1| mannan endo-1,4-beta-mannosidase 4 precursor [Solanum lycopersicum]
 ref|XP_010323731.1| PREDICTED: mannan endo-1,4-beta-mannosidase isoform X1 [Solanum 
lycopersicum]
 sp|Q8L5J1.2|MAN4_SOLLC RecName: Full=Mannan endo-1,4-beta-mannosidase 4; AltName: Full=Beta-mannanase 
4; AltName: Full=Endo-beta-1,4-mannanase 4; 
AltName: Full=LeMAN4a; AltName: Full=LeMAN4i; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAK97760.1| endo-beta-mannanase [Solanum lycopersicum]
Length=399

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            + N F+ T G HF +NG + Y NGFNAYWLMY+A DPS R KV+  F+ AS + + VART
Sbjct  28   SNNNFVYTDGTHFALNGKSLYINGFNAYWLMYIAYDPSTRIKVTNTFQQASKYKMNVART  87

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFS GG R LQ APG YNE +F+GLDFVI+EA+KYG+ +I+SL NN+++FGG
Sbjct  88   WAFSHGGSRPLQSAPGVYNEQMFQGLDFVISEAKKYGIHLIMSLVNNWDAFGG  140



>ref|NP_001234114.1| mannan endo-1,4-beta-mannosidase precursor [Solanum lycopersicum]
 gb|AAK56557.1| mannan endo-1,4-beta-mannosidase [Solanum lycopersicum]
Length=395

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            + N F+ T G HF +NG + Y NGFNAYWLMY+A DPS R KV+  F+ AS + + VART
Sbjct  28   SNNNFVYTDGTHFALNGKSLYINGFNAYWLMYIAYDPSTRIKVTNTFQQASKYKMNVART  87

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFS GG R LQ APG YNE +F+GLDFVI+EA+KYG+ +I+SL NN+++FGG
Sbjct  88   WAFSHGGSRPLQSAPGVYNEQMFQGLDFVISEAKKYGIHLIMSLVNNWDAFGG  140



>ref|NP_001234874.1| inactive endo-beta-mannanase precursor [Solanum lycopersicum]
 gb|AAK97759.2| inactive endo-beta-mannanase [Solanum lycopersicum]
Length=395

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            + N F+ T G HF +NG + Y NGFNAYWLMY+A DPS R KV+  F+ AS + + VART
Sbjct  28   SNNNFVYTDGTHFALNGKSLYINGFNAYWLMYIAYDPSTRIKVTNTFQQASKYKMNVART  87

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFS GG R LQ APG YNE +F+GLDFVI+EA+KYG+ +I+SL NN+++FGG
Sbjct  88   WAFSHGGSRPLQSAPGVYNEQMFQGLDFVISEAKKYGIHLIMSLVNNWDAFGG  140



>ref|XP_003591290.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES61541.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=458

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
             G GF++ +G HF++NG T Y NGFN+YWLM +ASDPS   KV+  F+ AS HGL V RT
Sbjct  85   VGGGFVQRKGTHFILNGKTHYVNGFNSYWLMIMASDPSTSSKVTSNFQQASRHGLNVGRT  144

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WA +DGGY+ALQ +PG Y+E+VF+GLDFVI+E++KYG+++IL L NN+ + GG
Sbjct  145  WACNDGGYKALQISPGKYDENVFRGLDFVISESKKYGVQLILGLVNNWNALGG  197



>ref|XP_006588317.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Glycine max]
 gb|KHN11733.1| Mannan endo-1,4-beta-mannosidase 5 [Glycine soja]
Length=407

 Score =   152 bits (384),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++T+G   ++N   F  NGFN+YW+M VA+DP+QRYKVS  FR AS+ GLTV RTWAF
Sbjct  33   GFVETKGTELVLNDSPFLFNGFNSYWMMNVAADPNQRYKVSNVFREASAIGLTVCRTWAF  92

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGG ++LQ +PG YNE +F+ LDFV+AEARKY +++ILSL NNY  FGG
Sbjct  93   SDGGNQSLQISPGLYNEAMFQALDFVVAEARKYRVRLILSLVNNYNDFGG  142



>ref|XP_010038519.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Eucalyptus 
grandis]
Length=403

 Score =   152 bits (384),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF+ T GIHF+ NG   Y NGFNAYW+MY+ASDPS R KV+  F+ A+ +G+ +ARTWAF
Sbjct  30   GFVGTNGIHFVANGKPLYLNGFNAYWMMYMASDPSTRDKVASVFQEAAKNGMNMARTWAF  89

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDG  RALQ +PG YNED+FKGLDFVI+EAR+ G+ +I+SL NN+  FGG
Sbjct  90   SDGVNRALQISPGIYNEDMFKGLDFVISEARRNGVYLIVSLVNNWNEFGG  139



>gb|KCW46726.1| hypothetical protein EUGRSUZ_K00548, partial [Eucalyptus grandis]
Length=380

 Score =   152 bits (383),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF+ T GIHF+ NG   Y NGFNAYW+MY+ASDPS R KV+  F+ A+ +G+ +ARTWAF
Sbjct  7    GFVGTNGIHFVANGKPLYLNGFNAYWMMYMASDPSTRDKVASVFQEAAKNGMNMARTWAF  66

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDG  RALQ +PG YNED+FKGLDFVI+EAR+ G+ +I+SL NN+  FGG
Sbjct  67   SDGVNRALQISPGIYNEDMFKGLDFVISEARRNGVYLIVSLVNNWNEFGG  116



>ref|XP_002456093.1| hypothetical protein SORBIDRAFT_03g030340 [Sorghum bicolor]
 gb|EES01213.1| hypothetical protein SORBIDRAFT_03g030340 [Sorghum bicolor]
Length=432

 Score =   152 bits (385),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 92/116 (79%), Gaps = 2/116 (2%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
            A G+ F++ +G  F+ NG  F+ANGFNAYWLM + +DP+QR KV+ A   A+  GL+VAR
Sbjct  28   AGGDAFVRVQGTRFVHNGKPFFANGFNAYWLMTLGADPAQRGKVTSALSQAAGAGLSVAR  87

Query  316  TWAFSDGGYR--ALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TWAF+DGG    ALQY+PG YNE+ F+GLDFV+AEARKYG+K+ILSL NNY+SFGG
Sbjct  88   TWAFNDGGGSSGALQYSPGRYNENTFQGLDFVLAEARKYGIKMILSLVNNYDSFGG  143



>ref|XP_009621619.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like, partial [Nicotiana 
tomentosiformis]
Length=336

 Score =   150 bits (379),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = +1

Query  133  KAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVA  312
            + A  GFI  +G HF +NG  F  NGFN+YWLM+VA++ S+RYKV+E  +  S+ GL+V 
Sbjct  27   RNANVGFIAVKGAHFELNGSPFLFNGFNSYWLMHVAAESSERYKVTEVLKDGSAAGLSVC  86

Query  313  RTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            RTWAFSDGG RALQ +PG Y+E VF+GLDFVI+EA+KYG+++ILS  NN+  FGG
Sbjct  87   RTWAFSDGGDRALQISPGVYDERVFQGLDFVISEAKKYGVRLILSFVNNWNDFGG  141



>ref|XP_009135138.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like isoform X1 
[Brassica rapa]
Length=415

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
             + +GF+  +G+ F++NG  FYANGFNAYWLMY A+DP+ RYKV+ A   A+  GLT+AR
Sbjct  26   VSSDGFVSRKGVQFILNGEPFYANGFNAYWLMYEATDPNTRYKVTHALENAAGQGLTIAR  85

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TW F DGGYRALQ   GSY+E  F+GLDF IAEA++ G+K+I++  NN+  FGG
Sbjct  86   TWGFRDGGYRALQTNLGSYDEQTFQGLDFAIAEAKRVGIKMIIAFVNNFPDFGG  139



>gb|EPS69785.1| endo-beta-mannanase [Genlisea aurea]
Length=565

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 85/105 (81%), Gaps = 0/105 (0%)
 Frame = +1

Query  163  RGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFSDGGY  342
             G+ F+++G  FYANGFNAYWLM VASDP+QRY+VS AF+ A +HGL V+RTWAFSDGGY
Sbjct  32   EGLSFVLDGIPFYANGFNAYWLMIVASDPAQRYRVSTAFQEAKAHGLNVSRTWAFSDGGY  91

Query  343  RALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             ALQ +PG Y E  F+GLDFV+ EA K+G+K+ILSL NNY  FGG
Sbjct  92   FALQASPGCYIEKTFQGLDFVVQEAGKHGIKLILSLVNNYNDFGG  136



>ref|XP_008459570.1| PREDICTED: mannan endo-1,4-beta-mannosidase 1-like [Cucumis melo]
Length=417

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF+     HF +NG  F  NGFN+YW+M VA+DP+QR+KVS+ FR A++ GLTV RTWAF
Sbjct  32   GFVGVEDGHFQLNGSPFLFNGFNSYWMMSVAADPNQRHKVSQVFRDAATAGLTVCRTWAF  91

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            +DGG+ ALQ +PG Y+E VF+GLDFVI EARKYG+++ILSL NN++ +GG
Sbjct  92   NDGGFHALQISPGVYDESVFQGLDFVIFEARKYGIRMILSLVNNFKDYGG  141



>ref|XP_009135139.1| PREDICTED: mannan endo-1,4-beta-mannosidase 3-like isoform X2 
[Brassica rapa]
Length=414

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  136  AAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVAR  315
             + +GF+  +G+ F++NG  FYANGFNAYWLMY A+DP+ RYKV+ A   A+  GLT+AR
Sbjct  25   VSSDGFVSRKGVQFILNGEPFYANGFNAYWLMYEATDPNTRYKVTHALENAAGQGLTIAR  84

Query  316  TWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            TW F DGGYRALQ   GSY+E  F+GLDF IAEA++ G+K+I++  NN+  FGG
Sbjct  85   TWGFRDGGYRALQTNLGSYDEQTFQGLDFAIAEAKRVGIKMIIAFVNNFPDFGG  138



>ref|XP_004494942.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Cicer arietinum]
Length=422

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++  GIHF++NG + Y NGFN+Y+LM +A+DPS + KV+  F+  S HGL +ARTWAF
Sbjct  53   GFVQRSGIHFILNGKSLYLNGFNSYFLMNIATDPSTKSKVTTIFQETSKHGLNLARTWAF  112

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            +DG Y+ LQ +PG+Y+EDVFKGLDFV++EA KYG+K+ILSL NN+  +GG
Sbjct  113  NDGDYKPLQISPGTYDEDVFKGLDFVVSEAGKYGVKLILSLVNNWNDYGG  162



>emb|CBI17041.3| unnamed protein product [Vitis vinifera]
Length=339

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V    +GF++TR   F +NG  F+ NGFN+YW+M VA+DPSQR KVS+ F  A++  L+V
Sbjct  25   VLLQSSGFVQTRNTQFTLNGSPFFFNGFNSYWMMNVAADPSQRSKVSDVFSQAAAVRLSV  84

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             RTWAF+DGG +ALQ +PG Y+E VF+GLDFVI+EARK G+++ILSL+NNY+ FGG
Sbjct  85   CRTWAFNDGGTQALQISPGVYDERVFQGLDFVISEARKNGVRLILSLSNNYKDFGG  140



>ref|XP_010064850.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Eucalyptus 
grandis]
 gb|KCW69494.1| hypothetical protein EUGRSUZ_F02943 [Eucalyptus grandis]
Length=405

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = +1

Query  139  AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVART  318
            A +GF++ RG  F++N   F  NGFN+YW+M VA++PS R KVS  FR A++ GL+V RT
Sbjct  27   APSGFVQVRGTQFILNSSPFLFNGFNSYWMMNVATEPSDRIKVSNVFREATAAGLSVCRT  86

Query  319  WAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            WAFSDGG RALQ +PG Y+E VF+ LDF+I+EAR+YG+++ILSL+NNY +FGG
Sbjct  87   WAFSDGGDRALQTSPGVYDEHVFQALDFMISEARRYGVRLILSLSNNYHNFGG  139



>ref|XP_009631900.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = +1

Query  127  SVKAAGN-GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGL  303
            S+KA  N  ++ T G HF + G  FY NGFNAYWLMY+ASDPS R KV+  F+ AS +G+
Sbjct  24   SIKAFSNPSYVYTDGTHFALEGKPFYLNGFNAYWLMYMASDPSTRNKVTTTFQQASKYGM  83

Query  304  TVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             VARTWAF+DGG R LQ +PG YNE +F+GLDFVI+EA+KYG+++IL L NN++  GG
Sbjct  84   NVARTWAFTDGGSRPLQSSPGVYNEQMFEGLDFVISEAQKYGIRLILGLVNNWDILGG  141



>ref|NP_187701.1| putative mannan endo-1,4-beta-mannosidase 4 [Arabidopsis thaliana]
 sp|Q9SG95.1|MAN4_ARATH RecName: Full=Putative mannan endo-1,4-beta-mannosidase 4; AltName: 
Full=Beta-mannanase 4; AltName: Full=Endo-beta-1,4-mannanase 
4; Short=AtMAN4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF19559.1|AC011708_2 putative (1-4)-beta-mannan endohydrolase [Arabidopsis thaliana]
 gb|AEE74968.1| putative mannan endo-1,4-beta-mannosidase 4 [Arabidopsis thaliana]
Length=408

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 92/127 (72%), Gaps = 1/127 (1%)
 Frame = +1

Query  100  FVQQSSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
             V   S  G   A  +GF+   G+ F++NG  FYANGFNAYWL Y A+DP+ R+K++  F
Sbjct  12   IVIAQSYVGVEAAPSDGFVSRNGVQFILNGKPFYANGFNAYWLAYEATDPTTRFKITNVF  71

Query  280  RGASSHGLTVARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLAN  456
            + A+S GLT+ARTW F DG  YRALQ APGSY+E  F+GLDFVIAEA++ G+K+I+ L N
Sbjct  72   QNATSLGLTIARTWGFRDGAIYRALQTAPGSYDEQTFQGLDFVIAEAKRIGIKLIILLVN  131

Query  457  NYESFGG  477
            N++ +GG
Sbjct  132  NWDDYGG  138



>ref|XP_010464782.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 4 [Camelina 
sativa]
Length=406

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 90/118 (76%), Gaps = 2/118 (2%)
 Frame = +1

Query  130  VKAAGN-GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLT  306
            V+A  N GF+   G+ F++NG  FYANGFNAYWL Y A+DP+ RYK++ AF+ A SHGLT
Sbjct  24   VEAVPNDGFVTRNGLQFILNGKPFYANGFNAYWLTYEATDPTARYKITNAFQDAISHGLT  83

Query  307  VARTWAFSDGG-YRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            +ARTW F DG  YRALQ +PG Y+E  F+GLDFVIAEA++ G+K+I+ L NN+  +GG
Sbjct  84   IARTWGFHDGAIYRALQTSPGIYDEQTFQGLDFVIAEAKRLGIKMIMPLVNNWSDYGG  141



>ref|XP_003605853.1| Mannan endo-1,4-beta-mannosidase [Medicago truncatula]
 gb|AES88050.1| mannan endo-1,4-beta-mannosidase-like protein [Medicago truncatula]
Length=411

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 91/117 (78%), Gaps = 1/117 (1%)
 Frame = +1

Query  127  SVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLT  306
            S++   N F++ +G  FM+NG  F  NGFN+YW+M VASDP+QRY+VS  F+ AS+ GLT
Sbjct  27   SLRVTPN-FVQRKGTEFMLNGSPFLFNGFNSYWMMNVASDPNQRYRVSNVFQKASAAGLT  85

Query  307  VARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            + RTWAFSDGG ++LQ +PG YNE +F+ LDFVI EA+K G+++ILSL NNY+ FGG
Sbjct  86   ICRTWAFSDGGNQSLQISPGLYNEQMFQALDFVIGEAKKNGVRLILSLVNNYKDFGG  142



>ref|XP_008778491.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Phoenix 
dactylifera]
Length=451

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G GF+K  G HF+I+G  FY+NGFNAYWLMY+ASDP+ R KVS   + ASS GL V RTW
Sbjct  66   GTGFVKPNGNHFVIDGQPFYSNGFNAYWLMYMASDPNDRAKVSPTLQQASSLGLKVIRTW  125

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            AF+DGG RALQ +PG YNE  F+GLD+VI+EA+K G+ +IL+L NN+  FGG
Sbjct  126  AFNDGGSRALQESPGQYNEATFQGLDYVISEAKKNGVYLILTLVNNWGDFGG  177



>ref|XP_008778492.1| PREDICTED: putative mannan endo-1,4-beta-mannosidase 9 [Phoenix 
dactylifera]
Length=411

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
            G GF+K  G HF+I+G  FY+NGFNAYWLMY+ASDP+ R KVS   + ASS GL V RTW
Sbjct  26   GTGFVKPNGNHFVIDGQPFYSNGFNAYWLMYMASDPNDRAKVSPTLQQASSLGLKVIRTW  85

Query  322  AFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            AF+DGG RALQ +PG YNE  F+GLD+VI+EA+K G+ +IL+L NN+  FGG
Sbjct  86   AFNDGGSRALQESPGQYNEATFQGLDYVISEAKKNGVYLILTLVNNWGDFGG  137



>ref|XP_002269954.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Vitis vinifera]
Length=414

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++T G  F++ G +   NGFN+YW+M+VA++PS+RYKVS  FR A+  GL+V RTWAF
Sbjct  30   GFVRTEGTRFVLGGSSSLFNGFNSYWMMHVATEPSERYKVSNTFREAADAGLSVCRTWAF  89

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGG RALQ +PG+Y+E VF+ LDFVI+EAR+YG+++ILS  NNY+ +GG
Sbjct  90   SDGGDRALQISPGTYDERVFQALDFVISEARRYGIRLILSFVNNYKDYGG  139



>ref|XP_002270023.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5 [Vitis vinifera]
 emb|CBI17043.3| unnamed protein product [Vitis vinifera]
Length=403

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V    +GF++TR   F++NG  F+ NGFN+YW+M VA+DPSQR KVS+ F  A++  L+V
Sbjct  25   VLLQSSGFVQTRNTQFILNGSPFFFNGFNSYWMMNVAADPSQRSKVSDVFSQATAARLSV  84

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             RTWAF+DGG +ALQ +PG Y+E VF+GLDFVI+EARK G+ +ILSL+NNY+ FGG
Sbjct  85   CRTWAFNDGGSQALQISPGVYDERVFQGLDFVISEARKNGVHLILSLSNNYKDFGG  140



>ref|XP_003634618.1| PREDICTED: LOW QUALITY PROTEIN: mannan endo-1,4-beta-mannosidase 
5-like [Vitis vinifera]
Length=403

 Score =   149 bits (377),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  130  VKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTV  309
            V    +GF++TR   F +NG  F+ NGFN+YW+M VA+DPSQR KVS+ F  A++  L+V
Sbjct  25   VLLQSSGFVQTRNTQFTLNGSPFFFNGFNSYWMMNVAADPSQRSKVSDVFSQAAAVRLSV  84

Query  310  ARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
             RTWAF+DGG +ALQ +PG Y+E VF+GLDFVI+EARK G+++ILSL+NNY+ FGG
Sbjct  85   CRTWAFNDGGTQALQISPGVYDERVFQGLDFVISEARKNGVRLILSLSNNYKDFGG  140



>emb|CBI17039.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++T G  F++ G +   NGFN+YW+M+VA++PS+RYKVS  FR A+  GL+V RTWAF
Sbjct  30   GFVRTEGTRFVLGGSSSLFNGFNSYWMMHVATEPSERYKVSNTFREAADAGLSVCRTWAF  89

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGG RALQ +PG+Y+E VF+ LDFVI+EAR+YG+++ILS  NNY+ +GG
Sbjct  90   SDGGDRALQISPGTYDERVFQALDFVISEARRYGIRLILSFVNNYKDYGG  139



>ref|XP_003540598.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Glycine max]
Length=407

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++T+    ++NG  F  NGFN+YW+M VA+DP+QRYKVS  FR AS+ GLTV RTWAF
Sbjct  33   GFVQTKDTELVLNGSPFLFNGFNSYWMMNVAADPNQRYKVSNVFREASAIGLTVCRTWAF  92

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGG ++LQ +PG YNE +F+ LDFV+AEA+KY +++I SL NNY  FGG
Sbjct  93   SDGGNQSLQISPGLYNEAMFQALDFVVAEAKKYRVRLIFSLVNNYNDFGG  142



>ref|XP_011025293.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Populus euphratica]
Length=404

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%), Gaps = 1/110 (1%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
            F +T G HF++N    Y NGFNA+W+MY++SDPS R KV+ AF+ AS +G+ +ARTWAFS
Sbjct  36   FARTNGTHFVVNNKPLYLNGFNAFWMMYMSSDPSTRSKVTSAFQQASKYGMNIARTWAFS  95

Query  331  DGGY-RALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            DGG  + LQ +PG YNED+FKGLDFV++EARKYG+ +ILSL NN++ +GG
Sbjct  96   DGGNDKPLQISPGIYNEDMFKGLDFVVSEARKYGIYLILSLVNNFKDYGG  145



>ref|XP_004228885.1| PREDICTED: mannan endo-1,4-beta-mannosidase 4-like [Solanum lycopersicum]
Length=401

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +1

Query  112  SSLSGSVKAA-GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGA  288
            +  S  +KA+  + F+   G HF + G  FY NGFN+YWLMY+ASDPS R KV+  F+ A
Sbjct  20   NEFSNPIKASLDSNFVYIDGTHFALEGKPFYLNGFNSYWLMYMASDPSTRNKVTNIFQQA  79

Query  289  SSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYES  468
            S + + VARTWAF+DGG R LQ APG YNE +F+GLDFVI+EA+ YG+ +ILSL +N+E+
Sbjct  80   SKYKMNVARTWAFADGGSRPLQSAPGVYNEQMFQGLDFVISEAKNYGIHLILSLVDNFEA  139

Query  469  FGG  477
            FGG
Sbjct  140  FGG  142



>gb|KFK24691.1| hypothetical protein AALP_AA8G012100 [Arabis alpina]
Length=181

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +1

Query  151  FIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAFS  330
             ++ +G+ F +NG  FY NGFN YW+M +A+D S R KV+E F+ AS+ GLTV RTWAF+
Sbjct  1    MVQRKGMQFTLNGQPFYVNGFNTYWMMTLAADNSTRGKVTEVFQQASAVGLTVGRTWAFN  60

Query  331  DGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            DG +RALQ +P  Y+EDVFK LDFV++EARKY +++ILSL NN+  FGG
Sbjct  61   DGQWRALQKSPSVYDEDVFKALDFVVSEARKYKIRLILSLVNNWNDFGG  109



>emb|CBI17044.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 97/126 (77%), Gaps = 4/126 (3%)
 Frame = +1

Query  112  SSLSGSVKA----AGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAF  279
            SS S + +A      +GF++TR   F++NG  F+ NGFN+YW+M VA+DPSQR KVS+ F
Sbjct  78   SSCSPTCEARVLLQSSGFVQTRNTQFILNGSPFFFNGFNSYWMMNVAADPSQRSKVSDVF  137

Query  280  RGASSHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANN  459
              A++  L+V RTWAF+DGG +ALQ +PG Y+E VF+GLDFVI+EA+K G+++ILSL+NN
Sbjct  138  SQAAAARLSVCRTWAFNDGGTQALQISPGVYDERVFQGLDFVISEAKKNGVRLILSLSNN  197

Query  460  YESFGG  477
            Y+ FGG
Sbjct  198  YKDFGG  203



>ref|XP_004141631.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Cucumis sativus]
Length=417

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +1

Query  112  SSLSGSVKAAGNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGAS  291
            S+LS S   A   F+  +  HF +NG  F  NGFN+YW+M VA+DP+QR+KV++ FR A+
Sbjct  20   STLSSSSSPAPAAFVGVQDDHFQLNGSPFLFNGFNSYWMMSVAADPNQRHKVTQVFRDAA  79

Query  292  SHGLTVARTWAFSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESF  471
            + GLTV RTWAF+DGG+ ALQ +PG Y+E VF+ LDFVI EARKYG++++LSL NN+E +
Sbjct  80   AAGLTVCRTWAFNDGGFHALQISPGVYDESVFQALDFVIFEARKYGIRMLLSLVNNFEEY  139

Query  472  GG  477
            GG
Sbjct  140  GG  141



>ref|XP_011069567.1| PREDICTED: mannan endo-1,4-beta-mannosidase 5-like [Sesamum indicum]
Length=412

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = +1

Query  142  GNGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTW  321
             +GF++TRG HF+++   F  NGFNAYW+M VA+ PSQRYKVS  FR A++ GLTV RTW
Sbjct  33   ASGFVQTRGTHFVLDNSLFLFNGFNAYWMMQVAAQPSQRYKVSNVFREAAAAGLTVCRTW  92

Query  322  AFSDGGYR-ALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            AFSDGG + ALQ +PG Y+E+VF+ LDFV++EA K  +++ILSL NNY+ FGG
Sbjct  93   AFSDGGNKLALQISPGVYDENVFQALDFVVSEAAKNKVRLILSLVNNYQDFGG  145



>gb|AFK43830.1| unknown [Lotus japonicus]
Length=405

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  145  NGFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWA  324
            N FI+ +G  F++NG   Y NGFNA+W +Y+ASDPS + KV+  F+ AS HGL +ART A
Sbjct  32   NNFIQRKGTQFILNGKPHYVNGFNAFWFLYMASDPSTKSKVTSTFQQASQHGLNLARTNA  91

Query  325  FSDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            FSDG YRALQ +PGSY E VF+GLDFV++EARKYG+K+IL L N++  FGG
Sbjct  92   FSDGVYRALQKSPGSYEESVFRGLDFVVSEARKYGVKLILCLVNSWNDFGG  142



>emb|CAN71995.1| hypothetical protein VITISV_023484 [Vitis vinifera]
Length=414

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  148  GFIKTRGIHFMINGYTFYANGFNAYWLMYVASDPSQRYKVSEAFRGASSHGLTVARTWAF  327
            GF++T G  F++ G +   NGFN+YW+M+VA++PS+RYKVS  F+ A+  GL+V RTWAF
Sbjct  30   GFVRTEGTRFVLGGSSSLFNGFNSYWMMHVATEPSERYKVSNTFQEAADAGLSVCRTWAF  89

Query  328  SDGGYRALQYAPGSYNEDVFKGLDFVIAEARKYGLKVILSLANNYESFGG  477
            SDGG RALQ +PG+Y+E VF+ LDFVI+EAR+YG+++ILS  NNY+ +GG
Sbjct  90   SDGGDRALQISPGTYDERVFQALDFVISEARRYGIRLILSFVNNYKDYGG  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 567171140730