BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF047M13

Length=506
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004232611.1|  PREDICTED: deSI-like protein At4g17486             229   1e-72   Solanum lycopersicum
ref|XP_006363155.1|  PREDICTED: uncharacterized protein LOC102588654    229   2e-72   Solanum tuberosum [potatoes]
ref|XP_009622250.1|  PREDICTED: uncharacterized protein LOC104113704    221   3e-68   Nicotiana tomentosiformis
ref|XP_009803660.1|  PREDICTED: uncharacterized protein LOC104248996    220   4e-68   Nicotiana sylvestris
ref|XP_010255243.1|  PREDICTED: deSI-like protein At4g17486             202   9e-62   Nelumbo nucifera [Indian lotus]
ref|XP_009629049.1|  PREDICTED: desumoylating isopeptidase 2-like       199   9e-62   Nicotiana tomentosiformis
ref|XP_008380101.1|  PREDICTED: deSI-like protein At4g17486             202   2e-61   Malus domestica [apple tree]
ref|XP_009375518.1|  PREDICTED: deSI-like protein At4g17486             201   5e-61   Pyrus x bretschneideri [bai li]
ref|XP_008376635.1|  PREDICTED: deSI-like protein At4g17486             200   7e-61   Malus domestica [apple tree]
gb|KHG28577.1|  hypothetical protein F383_12435                         200   1e-60   Gossypium arboreum [tree cotton]
ref|XP_009368740.1|  PREDICTED: deSI-like protein At4g17486             199   1e-60   Pyrus x bretschneideri [bai li]
gb|EYU19578.1|  hypothetical protein MIMGU_mgv1a012735mg                199   1e-60   Erythranthe guttata [common monkey flower]
ref|XP_007221005.1|  hypothetical protein PRUPE_ppa010466mg             199   2e-60   Prunus persica
ref|XP_002273259.1|  PREDICTED: deSI-like protein At4g17486             199   3e-60   Vitis vinifera
gb|KHN09305.1|  UPF0326 protein                                         198   4e-60   Glycine soja [wild soybean]
emb|CBI22663.3|  unnamed protein product                                198   4e-60   Vitis vinifera
ref|XP_008234843.1|  PREDICTED: deSI-like protein At4g17486             198   5e-60   Prunus mume [ume]
emb|CDP05149.1|  unnamed protein product                                198   5e-60   Coffea canephora [robusta coffee]
ref|XP_009377608.1|  PREDICTED: deSI-like protein At4g17486             197   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_004309182.1|  PREDICTED: deSI-like protein At4g17486             197   1e-59   Fragaria vesca subsp. vesca
ref|XP_011084455.1|  PREDICTED: deSI-like protein At4g17486             196   2e-59   Sesamum indicum [beniseed]
ref|XP_006829047.1|  hypothetical protein AMTR_s00001p00256510          196   3e-59   Amborella trichopoda
ref|XP_004140760.1|  PREDICTED: deSI-like protein At4g17486-like        196   3e-59   Cucumis sativus [cucumbers]
ref|XP_008439288.1|  PREDICTED: deSI-like protein At4g17486             196   4e-59   Cucumis melo [Oriental melon]
ref|XP_007038797.1|  PPPDE thiol peptidase family protein, putati...    196   5e-59   
ref|XP_002305910.1|  hypothetical protein POPTR_0004s07790g             196   6e-59   Populus trichocarpa [western balsam poplar]
ref|XP_010276907.1|  PREDICTED: desumoylating isopeptidase 2-like       194   1e-58   Nelumbo nucifera [Indian lotus]
ref|XP_011043866.1|  PREDICTED: uncharacterized protein LOC105139200    194   2e-58   Populus euphratica
gb|KJB34156.1|  hypothetical protein B456_006G050800                    193   4e-58   Gossypium raimondii
ref|XP_003533983.1|  PREDICTED: UPF0326 protein At4g17486-like          193   5e-58   Glycine max [soybeans]
ref|XP_010671635.1|  PREDICTED: deSI-like protein At4g17486             192   7e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007152194.1|  hypothetical protein PHAVU_004G109400g             192   8e-58   Phaseolus vulgaris [French bean]
gb|KJB37310.1|  hypothetical protein B456_006G199100                    193   9e-58   Gossypium raimondii
ref|XP_006422019.1|  hypothetical protein CICLE_v10005686mg             191   4e-57   Citrus clementina [clementine]
ref|XP_010105750.1|  hypothetical protein L484_014240                   191   5e-57   Morus notabilis
ref|XP_004234227.1|  PREDICTED: desumoylating isopeptidase 2            190   5e-57   Solanum lycopersicum
ref|XP_010555681.1|  PREDICTED: deSI-like protein At4g17486             191   5e-57   Tarenaya hassleriana [spider flower]
ref|XP_010448389.1|  PREDICTED: deSI-like protein At4g17486             191   5e-57   Camelina sativa [gold-of-pleasure]
gb|AFK44900.1|  unknown                                                 191   5e-57   Lotus japonicus
ref|XP_008796908.1|  PREDICTED: deSI-like protein At4g17486 isofo...    187   7e-57   
ref|XP_010433598.1|  PREDICTED: deSI-like protein At4g17486             190   9e-57   Camelina sativa [gold-of-pleasure]
gb|EPS61570.1|  hypothetical protein M569_13226                         189   1e-56   Genlisea aurea
ref|XP_010433604.1|  PREDICTED: uncharacterized protein LOC104717692    190   1e-56   Camelina sativa [gold-of-pleasure]
gb|KDP22234.1|  hypothetical protein JCGZ_26065                         190   1e-56   Jatropha curcas
ref|XP_006353912.1|  PREDICTED: deSI-like protein At4g17486-like        189   2e-56   Solanum tuberosum [potatoes]
ref|XP_003606789.1|  PPPDE peptidase domain-containing protein          189   2e-56   
ref|XP_010035174.1|  PREDICTED: deSI-like protein At4g17486             189   3e-56   Eucalyptus grandis [rose gum]
ref|XP_008796907.1|  PREDICTED: uncharacterized protein LOC103712...    189   3e-56   Phoenix dactylifera
ref|XP_011038376.1|  PREDICTED: uncharacterized protein LOC105135271    189   4e-56   Populus euphratica
ref|XP_009798709.1|  PREDICTED: deSI-like protein At4g17486             188   4e-56   Nicotiana sylvestris
ref|XP_010438844.1|  PREDICTED: uncharacterized protein LOC104722396    188   5e-56   Camelina sativa [gold-of-pleasure]
ref|XP_006372440.1|  hypothetical protein POPTR_0017s01650g             188   6e-56   
ref|XP_006284399.1|  hypothetical protein CARUB_v10005569mg             188   6e-56   Capsella rubella
emb|CDX89402.1|  BnaA01g14910D                                          187   6e-56   
ref|XP_009109194.1|  PREDICTED: deSI-like protein At4g17486             187   8e-56   Brassica rapa
ref|NP_194298.1|  PPPDE putative thiol peptidase family protein         187   9e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869660.1|  hypothetical protein ARALYDRAFT_492258             187   1e-55   Arabidopsis lyrata subsp. lyrata
emb|CDX94426.1|  BnaC01g17580D                                          187   1e-55   
ref|XP_010933984.1|  PREDICTED: desumoylating isopeptidase 2-like       186   2e-55   Elaeis guineensis
ref|XP_009139416.1|  PREDICTED: deSI-like protein At4g17486             186   2e-55   Brassica rapa
emb|CDX94429.1|  BnaC01g17550D                                          186   2e-55   
ref|XP_010448394.1|  PREDICTED: uncharacterized protein LOC104730857    187   2e-55   Camelina sativa [gold-of-pleasure]
emb|CDX89404.1|  BnaA01g14890D                                          186   2e-55   
ref|XP_006422020.1|  hypothetical protein CICLE_v10005686mg             186   2e-55   
ref|XP_011076114.1|  PREDICTED: uncharacterized protein LOC105160...    186   2e-55   
gb|KFK29064.1|  hypothetical protein AALP_AA7G083900                    186   3e-55   Arabis alpina [alpine rockcress]
ref|XP_004513185.1|  PREDICTED: uncharacterized protein LOC101510879    186   3e-55   Cicer arietinum [garbanzo]
ref|NP_194296.1|  PPPDE putative thiol peptidase family protein         186   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011076113.1|  PREDICTED: uncharacterized protein LOC105160...    186   4e-55   Sesamum indicum [beniseed]
ref|XP_009139388.1|  PREDICTED: deSI-like protein At4g17486             185   5e-55   Brassica rapa
ref|XP_006413284.1|  hypothetical protein EUTSA_v10026072mg             185   7e-55   Eutrema salsugineum [saltwater cress]
gb|KFK29065.1|  hypothetical protein AALP_AA7G084100                    185   8e-55   Arabis alpina [alpine rockcress]
ref|XP_006413282.1|  hypothetical protein EUTSA_v10026034mg             185   8e-55   Eutrema salsugineum [saltwater cress]
gb|KJB23840.1|  hypothetical protein B456_004G117500                    185   8e-55   Gossypium raimondii
ref|XP_006661997.1|  PREDICTED: desumoylating isopeptidase 2-like       184   9e-55   Oryza brachyantha
ref|XP_003574249.1|  PREDICTED: desumoylating isopeptidase 2-like       184   9e-55   Brachypodium distachyon [annual false brome]
tpg|DAA46059.1|  TPA: hypothetical protein ZEAMMB73_195984              182   1e-54   
ref|XP_006284384.1|  hypothetical protein CARUB_v10005552mg             184   1e-54   Capsella rubella
ref|XP_010537155.1|  PREDICTED: deSI-like protein At4g17486             184   2e-54   Tarenaya hassleriana [spider flower]
emb|CDY49480.1|  BnaCnng17460D                                          184   2e-54   Brassica napus [oilseed rape]
ref|XP_008807844.1|  PREDICTED: desumoylating isopeptidase 2-like       184   2e-54   Phoenix dactylifera
ref|XP_008794771.1|  PREDICTED: uncharacterized protein LOC103710694    184   2e-54   
ref|NP_001143918.1|  uncharacterized protein LOC100276728               183   3e-54   Zea mays [maize]
gb|AFK48534.1|  unknown                                                 184   3e-54   Medicago truncatula
ref|XP_010941159.1|  PREDICTED: uncharacterized protein LOC105059531    184   4e-54   
ref|NP_001065158.1|  Os10g0533900                                       183   4e-54   
ref|XP_004983828.1|  PREDICTED: deSI-like protein hag1-like             182   7e-54   Setaria italica
gb|EEC67357.1|  hypothetical protein OsI_34457                          182   7e-54   Oryza sativa Indica Group [Indian rice]
gb|KHG21774.1|  hypothetical protein F383_27627                         182   1e-53   Gossypium arboreum [tree cotton]
gb|KJB34157.1|  hypothetical protein B456_006G050800                    182   2e-53   Gossypium raimondii
ref|XP_002467590.1|  hypothetical protein SORBIDRAFT_01g030660          181   2e-53   Sorghum bicolor [broomcorn]
ref|XP_002436336.1|  hypothetical protein SORBIDRAFT_10g000670          181   4e-53   Sorghum bicolor [broomcorn]
ref|XP_002869661.1|  hypothetical protein ARALYDRAFT_914007             181   5e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_009382250.1|  PREDICTED: deSI-like protein At4g17486 isofo...    180   5e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004966587.1|  PREDICTED: uncharacterized protein LOC101773931    180   9e-53   Setaria italica
ref|XP_009382251.1|  PREDICTED: desumoylating isopeptidase 2-like...    179   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009411427.1|  PREDICTED: uncharacterized protein LOC103993183    179   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010228135.1|  PREDICTED: desumoylating isopeptidase 2-like...    176   4e-52   
ref|XP_009386602.1|  PREDICTED: uncharacterized protein LOC103973689    177   7e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006279084.1|  hypothetical protein CARUB_v10012715mg             186   7e-52   
ref|XP_004496529.1|  PREDICTED: deSI-like protein At4g17486-like        176   1e-51   Cicer arietinum [garbanzo]
ref|XP_008376975.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    183   2e-51   
gb|EPS69052.1|  hypothetical protein M569_05713                         175   3e-51   Genlisea aurea
ref|XP_003557265.2|  PREDICTED: uncharacterized protein LOC100845...    176   5e-51   Brachypodium distachyon [annual false brome]
gb|KJB23839.1|  hypothetical protein B456_004G117500                    175   1e-50   Gossypium raimondii
ref|XP_008659380.1|  PREDICTED: uncharacterized protein LOC103638177    174   1e-50   Zea mays [maize]
ref|XP_003592207.1|  PPPDE peptidase domain-containing protein          171   5e-50   
gb|AES62458.2|  PPPDE thiol peptidase family protein, putative          172   5e-50   Medicago truncatula
gb|EEE64952.1|  hypothetical protein OsJ_19839                          172   1e-49   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79844.1|  hypothetical protein OsI_21315                          172   1e-49   Oryza sativa Indica Group [Indian rice]
gb|EMT20329.1|  hypothetical protein F775_52552                         170   8e-49   
gb|EMS56568.1|  hypothetical protein TRIUR3_04780                       174   2e-48   Triticum urartu
ref|XP_008796906.1|  PREDICTED: deSI-like protein sdu1 isoform X1       168   6e-48   
ref|XP_001784588.1|  predicted protein                                  164   3e-47   
gb|EMS61224.1|  hypothetical protein TRIUR3_07091                       164   3e-46   Triticum urartu
ref|XP_001762496.1|  predicted protein                                  156   1e-44   
ref|XP_009385238.1|  PREDICTED: uncharacterized protein LOC103972614    155   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004987201.1|  PREDICTED: deSI-like protein At4g17486-like        155   4e-43   Setaria italica
ref|XP_002968463.1|  hypothetical protein SELMODRAFT_16111              151   1e-42   
gb|KDO56773.1|  hypothetical protein CISIN_1g025261mg                   144   7e-39   Citrus sinensis [apfelsine]
ref|XP_006422021.1|  hypothetical protein CICLE_v10005686mg             144   7e-39   
ref|XP_006490645.1|  PREDICTED: uncharacterized protein LOC102607...    141   2e-38   
ref|XP_002513658.1|  conserved hypothetical protein                     142   3e-38   
ref|XP_003535600.1|  PREDICTED: deSI-like protein At4g17486-like        139   3e-37   Glycine max [soybeans]
ref|XP_002509086.1|  predicted protein                                  134   4e-36   Micromonas commoda
ref|XP_001764813.1|  predicted protein                                  133   2e-35   
ref|XP_003061681.1|  predicted protein                                  132   4e-35   Micromonas pusilla CCMP1545
gb|KCW46466.1|  hypothetical protein EUGRSUZ_K002931                    131   2e-34   Eucalyptus grandis [rose gum]
ref|XP_009621011.1|  PREDICTED: uncharacterized protein LOC104112711    128   3e-33   Nicotiana tomentosiformis
emb|CDY54090.1|  BnaC08g47300D                                          133   1e-32   Brassica napus [oilseed rape]
gb|KCW46465.1|  hypothetical protein EUGRSUZ_K002931                    125   2e-32   Eucalyptus grandis [rose gum]
emb|CDY52367.1|  BnaA08g31020D                                          130   9e-32   Brassica napus [oilseed rape]
ref|XP_009109196.1|  PREDICTED: uncharacterized protein LOC103834...    128   1e-30   Brassica rapa
emb|CEF99575.1|  PPPDE putative peptidase domain                        121   1e-30   Ostreococcus tauri
ref|XP_007509551.1|  predicted protein                                  120   4e-30   Bathycoccus prasinos
ref|XP_003081907.1|  putative protein (ISS)                             122   2e-29   
ref|XP_001701830.1|  predicted protein                                  116   2e-27   Chlamydomonas reinhardtii
ref|XP_001420272.1|  predicted protein                                  103   2e-24   Ostreococcus lucimarinus CCE9901
gb|KDO56774.1|  hypothetical protein CISIN_1g025261mg                   102   1e-23   Citrus sinensis [apfelsine]
gb|ACU22856.1|  unknown                                               99.0    2e-22   Glycine max [soybeans]
ref|NP_001056566.2|  Os06g0107000                                     99.0    2e-22   
ref|XP_006655688.1|  PREDICTED: uncharacterized protein LOC102722...  97.8    6e-22   
gb|ACJ85321.1|  unknown                                               95.9    5e-21   Medicago truncatula
gb|AFW85568.1|  hypothetical protein ZEAMMB73_042236                  94.4    2e-20   
gb|EEC80134.1|  hypothetical protein OsI_21921                        94.7    3e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_008659205.1|  PREDICTED: deSI-like protein At4g17486           94.4    3e-20   Zea mays [maize]
emb|CDY62507.1|  BnaC04g56370D                                        92.0    2e-19   Brassica napus [oilseed rape]
emb|CDY35370.1|  BnaA04g14770D                                        91.7    3e-19   Brassica napus [oilseed rape]
ref|XP_009140629.1|  PREDICTED: deSI-like protein At4g17486           91.7    3e-19   Brassica rapa
ref|NP_565588.1|  PPPDE putative thiol peptidase-like protein         91.7    3e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32585.1|  hypothetical protein AALP_AA6G262400                  90.9    5e-19   Arabis alpina [alpine rockcress]
ref|XP_002878832.1|  hypothetical protein ARALYDRAFT_481377           90.5    7e-19   
ref|XP_003560998.1|  PREDICTED: deSI-like protein At4g17486           90.5    9e-19   Brachypodium distachyon [annual false brome]
ref|XP_002782648.1|  hypothetical protein Pmar_PMAR021197             92.4    9e-19   Perkinsus marinus ATCC 50983
ref|XP_006405117.1|  hypothetical protein EUTSA_v10000310mg           90.1    1e-18   Eutrema salsugineum [saltwater cress]
ref|XP_009117078.1|  PREDICTED: deSI-like protein At4g17486           90.1    1e-18   Brassica rapa
ref|XP_010472522.1|  PREDICTED: deSI-like protein At4g17486           89.7    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006294896.1|  hypothetical protein CARUB_v10023946mg           89.4    2e-18   Capsella rubella
ref|XP_010417284.1|  PREDICTED: deSI-like protein At4g17486           89.0    2e-18   Camelina sativa [gold-of-pleasure]
emb|CDX76766.1|  BnaC08g33520D                                        88.6    4e-18   
ref|XP_010429510.1|  PREDICTED: deSI-like protein At4g17486           88.6    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009039394.1|  hypothetical protein AURANDRAFT_7483             85.5    5e-18   Aureococcus anophagefferens
emb|CDY56277.1|  BnaA09g55810D                                        90.1    9e-18   Brassica napus [oilseed rape]
ref|XP_009383188.1|  PREDICTED: deSI-like protein At4g17486           87.0    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDJ26229.1|  hypothetical protein                                 87.0    1e-17   Brassica oleracea
ref|XP_008452873.1|  PREDICTED: deSI-like protein At4g17486           87.0    1e-17   Cucumis melo [Oriental melon]
ref|XP_010665872.1|  PREDICTED: deSI-like protein At4g17486           86.7    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009126505.1|  PREDICTED: deSI-like protein At4g17486           86.7    2e-17   Brassica rapa
emb|CDX68806.1|  BnaC01g06470D                                        87.0    2e-17   
ref|XP_004145512.1|  PREDICTED: deSI-like protein At4g17486-like      86.3    2e-17   Cucumis sativus [cucumbers]
ref|XP_011036649.1|  PREDICTED: deSI-like protein At4g17486           86.3    3e-17   Populus euphratica
ref|XP_010526233.1|  PREDICTED: deSI-like protein At4g17486           86.3    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_002437960.1|  hypothetical protein SORBIDRAFT_10g005540        86.3    3e-17   
emb|CBI21088.3|  unnamed protein product                              84.7    3e-17   Vitis vinifera
ref|XP_002324900.1|  hypothetical protein POPTR_0018s02300g           85.5    4e-17   Populus trichocarpa [western balsam poplar]
ref|XP_008445255.1|  PREDICTED: deSI-like protein At4g17486           85.1    6e-17   Cucumis melo [Oriental melon]
ref|XP_004138707.1|  PREDICTED: deSI-like protein At4g17486-like      85.1    6e-17   Cucumis sativus [cucumbers]
ref|XP_006285485.1|  hypothetical protein CARUB_v10006919mg           88.2    7e-17   
ref|NP_001174638.1|  Os06g0182100                                     85.1    8e-17   
ref|XP_010942141.1|  PREDICTED: deSI-like protein At4g17486           84.3    1e-16   
emb|CDP18789.1|  unnamed protein product                              84.3    1e-16   Coffea canephora [robusta coffee]
ref|XP_009035395.1|  hypothetical protein AURANDRAFT_7465             82.8    1e-16   Aureococcus anophagefferens
ref|XP_009032180.1|  hypothetical protein AURANDRAFT_19518            83.6    1e-16   Aureococcus anophagefferens
ref|XP_008808226.1|  PREDICTED: deSI-like protein At4g17486           84.0    1e-16   Phoenix dactylifera
gb|KFK29811.1|  hypothetical protein AALP_AA7G181900                  84.0    1e-16   Arabis alpina [alpine rockcress]
ref|XP_006412534.1|  hypothetical protein EUTSA_v10025954mg           84.3    1e-16   Eutrema salsugineum [saltwater cress]
ref|XP_010648702.1|  PREDICTED: deSI-like protein At4g17486           84.0    1e-16   Vitis vinifera
ref|XP_011039595.1|  PREDICTED: deSI-like protein At4g17486           84.0    2e-16   Populus euphratica
ref|XP_009394943.1|  PREDICTED: deSI-like protein At4g17486           83.6    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009794916.1|  PREDICTED: deSI-like protein At4g17486           82.4    2e-16   Nicotiana sylvestris
ref|XP_002309663.2|  hypothetical protein POPTR_0006s27740g           83.6    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_010929119.1|  PREDICTED: deSI-like protein At4g17486           83.6    2e-16   Elaeis guineensis
ref|XP_009037509.1|  hypothetical protein AURANDRAFT_6447             80.9    3e-16   Aureococcus anophagefferens
gb|AAL38722.1|  unknown protein                                       83.2    3e-16   Arabidopsis thaliana [mouse-ear cress]
gb|EYU32380.1|  hypothetical protein MIMGU_mgv1a013824mg              82.8    3e-16   Erythranthe guttata [common monkey flower]
ref|XP_004291942.1|  PREDICTED: deSI-like protein At4g17486           82.4    4e-16   Fragaria vesca subsp. vesca
ref|XP_002869301.1|  predicted protein                                85.9    4e-16   
gb|KJB56553.1|  hypothetical protein B456_009G124800                  81.6    5e-16   Gossypium raimondii
gb|ADE75652.1|  unknown                                               82.8    5e-16   Picea sitchensis
gb|KFK27777.1|  hypothetical protein AALP_AA8G427400                  82.0    6e-16   Arabis alpina [alpine rockcress]
ref|XP_010313710.1|  PREDICTED: deSI-like protein At4g17486 isofo...  82.0    6e-16   Solanum lycopersicum
ref|XP_004251588.1|  PREDICTED: deSI-like protein At4g17486 isofo...  82.0    6e-16   Solanum lycopersicum
gb|EXX77625.1|  hypothetical protein RirG_022140                      80.9    7e-16   Rhizophagus irregularis DAOM 197198w
ref|XP_006366865.1|  PREDICTED: deSI-like protein At4g17486-like      82.0    7e-16   Solanum tuberosum [potatoes]
emb|CDY65538.1|  BnaCnng47550D                                        81.6    9e-16   Brassica napus [oilseed rape]
ref|XP_009151042.1|  PREDICTED: deSI-like protein At4g17486           81.6    1e-15   Brassica rapa
ref|XP_002515452.1|  conserved hypothetical protein                   81.6    1e-15   Ricinus communis
emb|CDY07077.1|  BnaA04g22380D                                        81.3    1e-15   
gb|KDP33538.1|  hypothetical protein JCGZ_07109                       81.6    1e-15   Jatropha curcas
ref|XP_008377676.1|  PREDICTED: deSI-like protein At4g17486           81.3    1e-15   Malus domestica [apple tree]
ref|XP_008378831.1|  PREDICTED: deSI-like protein At4g17486           81.3    1e-15   Malus domestica [apple tree]
gb|EXX77624.1|  hypothetical protein RirG_022140                      80.9    1e-15   Rhizophagus irregularis DAOM 197198w
ref|XP_009390569.1|  PREDICTED: deSI-like protein At4g17486           81.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007223906.1|  hypothetical protein PRUPE_ppa010937mg           81.3    1e-15   Prunus persica
ref|NP_194926.1|  uncharacterized protein                             84.3    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006450315.1|  hypothetical protein CICLE_v10009362mg           81.3    1e-15   Citrus clementina [clementine]
ref|XP_006394766.1|  hypothetical protein EUTSA_v10004898mg           80.9    1e-15   Eutrema salsugineum [saltwater cress]
gb|KHG11379.1|  hypothetical protein F383_11015                       81.3    2e-15   Gossypium arboreum [tree cotton]
ref|XP_003603314.1|  hypothetical protein MTR_3g106240                80.9    2e-15   Medicago truncatula
gb|KHG02026.1|  hypothetical protein F383_26397                       80.9    2e-15   Gossypium arboreum [tree cotton]
ref|XP_010532094.1|  PREDICTED: deSI-like protein At4g17486 isofo...  80.9    2e-15   Tarenaya hassleriana [spider flower]
gb|AFK47902.1|  unknown                                               80.9    2e-15   Lotus japonicus
ref|XP_010532093.1|  PREDICTED: deSI-like protein At4g17486 isofo...  80.9    2e-15   Tarenaya hassleriana [spider flower]
ref|XP_006596080.1|  PREDICTED: deSI-like protein At4g17486-like ...  80.1    2e-15   Glycine max [soybeans]
ref|XP_003091095.1|  hypothetical protein CRE_24283                   82.0    2e-15   Caenorhabditis remanei
ref|XP_002951862.1|  hypothetical protein VOLCADRAFT_92471            82.4    2e-15   Volvox carteri f. nagariensis
ref|XP_007215933.1|  hypothetical protein PRUPE_ppa011077mg           80.5    2e-15   Prunus persica
ref|XP_010245553.1|  PREDICTED: deSI-like protein At4g17486           80.5    3e-15   Nelumbo nucifera [Indian lotus]
ref|XP_010537890.1|  PREDICTED: deSI-like protein At4g17486 isofo...  80.5    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_009797717.1|  PREDICTED: deSI-like protein At4g17486 isofo...  80.5    3e-15   Nicotiana sylvestris
ref|XP_010537889.1|  PREDICTED: deSI-like protein At4g17486 isofo...  80.5    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_009630833.1|  PREDICTED: deSI-like protein At4g17486           80.5    3e-15   Nicotiana tomentosiformis
ref|XP_006288624.1|  hypothetical protein CARUB_v10001926mg           80.1    3e-15   Capsella rubella
gb|AFK46726.1|  unknown                                               80.1    3e-15   Lotus japonicus
ref|XP_009593660.1|  PREDICTED: deSI-like protein At4g17486           80.5    3e-15   Nicotiana tomentosiformis
ref|XP_009797716.1|  PREDICTED: deSI-like protein At4g17486 isofo...  80.5    3e-15   Nicotiana sylvestris
ref|XP_003544599.1|  PREDICTED: deSI-like protein At4g17486-like ...  80.1    3e-15   Glycine max [soybeans]
ref|XP_010421363.1|  PREDICTED: deSI-like protein At4g17486           80.1    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_008228762.1|  PREDICTED: deSI-like protein At4g17486           80.1    3e-15   Prunus mume [ume]
ref|XP_010089948.1|  hypothetical protein L484_014459                 80.1    3e-15   Morus notabilis
ref|XP_006846873.1|  hypothetical protein AMTR_s00150p00063670        80.1    4e-15   Amborella trichopoda
ref|XP_005704609.1|  hypothetical protein Gasu_44260                  79.3    4e-15   Galdieria sulphuraria
ref|NP_568467.1|  PPPDE putative thiol peptidase family protein       79.7    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493765.1|  PREDICTED: deSI-like protein At4g17486           79.7    4e-15   Camelina sativa [gold-of-pleasure]
gb|KEH40779.1|  PPPDE thiol peptidase family protein, putative        80.1    4e-15   Medicago truncatula
ref|XP_007154966.1|  hypothetical protein PHAVU_003G161600g           79.7    4e-15   Phaseolus vulgaris [French bean]
ref|XP_009032864.1|  hypothetical protein AURANDRAFT_6216             78.2    5e-15   Aureococcus anophagefferens
ref|XP_006427585.1|  hypothetical protein CICLE_v10027044mg           79.7    5e-15   Citrus clementina [clementine]
ref|XP_006465205.1|  PREDICTED: deSI-like protein At4g17486-like      79.7    5e-15   Citrus sinensis [apfelsine]
gb|EPS65739.1|  hypothetical protein M569_09039                       79.7    6e-15   Genlisea aurea
ref|XP_010684633.1|  PREDICTED: deSI-like protein At4g17486 isofo...  79.7    6e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008806296.1|  PREDICTED: deSI-like protein At4g17486 isofo...  79.3    6e-15   Phoenix dactylifera
gb|KJB56555.1|  hypothetical protein B456_009G124800                  78.2    6e-15   Gossypium raimondii
gb|KEH28639.1|  PPPDE thiol peptidase family protein, putative        79.3    6e-15   Medicago truncatula
ref|XP_004238234.1|  PREDICTED: deSI-like protein At4g17486           79.3    6e-15   Solanum lycopersicum
gb|KHF98012.1|  hypothetical protein F383_11751                       79.3    7e-15   Gossypium arboreum [tree cotton]
ref|XP_011082192.1|  PREDICTED: deSI-like protein At4g17486           79.3    7e-15   Sesamum indicum [beniseed]
ref|XP_010914798.1|  PREDICTED: deSI-like protein At4g17486           79.0    7e-15   Elaeis guineensis
ref|XP_002140825.1|  hypothetical protein                             79.3    7e-15   Cryptosporidium muris RN66
ref|XP_007011755.1|  PPPDE thiol peptidase family protein, putative   78.6    8e-15   
gb|EPS60489.1|  hypothetical protein M569_14316                       79.0    9e-15   Genlisea aurea
ref|XP_003549929.1|  PREDICTED: deSI-like protein At4g17486-like ...  79.0    9e-15   Glycine max [soybeans]
emb|CDP10368.1|  unnamed protein product                              79.0    9e-15   Coffea canephora [robusta coffee]
ref|XP_008806295.1|  PREDICTED: deSI-like protein At4g17486 isofo...  79.0    9e-15   Phoenix dactylifera
ref|XP_004501368.1|  PREDICTED: deSI-like protein At4g17486-like      78.6    1e-14   Cicer arietinum [garbanzo]
ref|NP_565243.1|  PPPDE putative thiol peptidase family protein       78.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAF14657.1|AC011713_5  Contains similarity to gb|AF151904 CGI-...  78.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010688066.1|  PREDICTED: deSI-like protein At4g17486 isofo...  78.6    1e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010688067.1|  PREDICTED: deSI-like protein At4g17486 isofo...  78.6    1e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB68408.1|  hypothetical protein B456_010G243600                  78.6    1e-14   Gossypium raimondii
ref|XP_004498191.1|  PREDICTED: deSI-like protein At4g17486-like ...  78.6    1e-14   Cicer arietinum [garbanzo]
ref|XP_009106725.1|  PREDICTED: deSI-like protein At4g17486 isofo...  78.6    1e-14   Brassica rapa
ref|XP_009106726.1|  PREDICTED: deSI-like protein At4g17486 isofo...  78.2    1e-14   Brassica rapa
emb|CDY39951.1|  BnaC06g40290D                                        78.2    1e-14   Brassica napus [oilseed rape]
ref|NP_001240886.1|  uncharacterized protein LOC100777596             78.6    1e-14   Glycine max [soybeans]
gb|KJB14532.1|  hypothetical protein B456_002G129500                  77.4    1e-14   Gossypium raimondii
ref|XP_011073354.1|  PREDICTED: deSI-like protein At4g17486           78.2    2e-14   Sesamum indicum [beniseed]
gb|KHG29638.1|  hypothetical protein F383_14095                       78.2    2e-14   Gossypium arboreum [tree cotton]
ref|XP_004508531.1|  PREDICTED: deSI-like protein At4g17486-like ...  78.2    2e-14   Cicer arietinum [garbanzo]
gb|KDP41995.1|  hypothetical protein JCGZ_27013                       78.2    2e-14   
ref|XP_006367307.1|  PREDICTED: deSI-like protein At4g17486-like      78.6    2e-14   
ref|XP_003529195.1|  PREDICTED: deSI-like protein At4g17486-like ...  78.2    2e-14   
ref|XP_010474509.1|  PREDICTED: deSI-like protein At4g17486           78.2    2e-14   
ref|XP_008605728.1|  hypothetical protein SDRG_01949                  77.8    2e-14   
ref|XP_010429922.1|  PREDICTED: deSI-like protein At4g17486 isofo...  78.2    2e-14   
ref|NP_001136827.1|  uncharacterized protein LOC100216975             78.2    2e-14   
ref|XP_010429923.1|  PREDICTED: deSI-like protein At4g17486 isofo...  77.8    2e-14   
ref|XP_007136969.1|  hypothetical protein PHAVU_009G089100g           77.8    2e-14   
ref|XP_010417673.1|  PREDICTED: deSI-like protein At4g17486 isofo...  77.8    2e-14   
ref|XP_010417675.1|  PREDICTED: deSI-like protein At4g17486 isofo...  77.8    2e-14   
ref|XP_010092174.1|  hypothetical protein L484_013492                 77.8    2e-14   
gb|EYU45120.1|  hypothetical protein MIMGU_mgv1a012349mg              77.4    2e-14   
emb|CDY05376.1|  BnaC02g40840D                                        77.4    3e-14   
gb|KJB65896.1|  hypothetical protein B456_010G117900                  77.4    3e-14   
ref|XP_006389824.1|  hypothetical protein EUTSA_v10019085mg           77.4    3e-14   
ref|XP_006389825.1|  hypothetical protein EUTSA_v10019085mg           77.4    3e-14   
gb|KDO30954.1|  hypothetical protein SPRG_04142                       77.4    3e-14   
ref|XP_010265674.1|  PREDICTED: deSI-like protein At4g17486           77.0    3e-14   
ref|XP_009129982.1|  PREDICTED: deSI-like protein At4g17486           77.4    3e-14   
ref|XP_004498779.1|  PREDICTED: deSI-like protein At4g17486-like      77.4    3e-14   
ref|XP_009175460.1|  hypothetical protein T265_10736                  79.7    3e-14   
emb|CDO97080.1|  unnamed protein product                              77.0    3e-14   
gb|KJB20964.1|  hypothetical protein B456_003G176000                  77.4    3e-14   
ref|XP_002887815.1|  hypothetical protein ARALYDRAFT_477178           77.4    3e-14   
ref|XP_002872143.1|  hypothetical protein ARALYDRAFT_910561           77.4    3e-14   
gb|KDO17263.1|  hypothetical protein SPRG_17305                       77.0    3e-14   
gb|KJB14531.1|  hypothetical protein B456_002G129500                  77.4    3e-14   
gb|EYU21715.1|  hypothetical protein MIMGU_mgv1a024619mg              77.4    3e-14   
ref|XP_004515519.1|  PREDICTED: deSI-like protein At4g17486-like      77.0    4e-14   
ref|XP_004235927.1|  PREDICTED: deSI-like protein At4g17486           77.0    4e-14   
ref|NP_001241385.1|  uncharacterized protein LOC100778961             77.0    4e-14   
emb|CDX79359.1|  BnaC06g19440D                                        77.0    4e-14   
ref|XP_011074513.1|  PREDICTED: deSI-like protein At4g17486           77.4    4e-14   
gb|KJB25512.1|  hypothetical protein B456_004G195500                  76.3    4e-14   
ref|XP_006304132.1|  hypothetical protein CARUB_v10010094mg           77.0    4e-14   
ref|XP_010501867.1|  PREDICTED: deSI-like protein At4g17486           77.4    4e-14   
gb|AFK35683.1|  unknown                                               77.0    4e-14   
ref|XP_010479174.1|  PREDICTED: deSI-like protein At4g17486           77.4    4e-14   
gb|EYU45119.1|  hypothetical protein MIMGU_mgv1a012349mg              77.0    4e-14   
gb|KFH04834.1|  putative PPPDE peptidase domain protein               77.0    4e-14   
gb|EYU37765.1|  hypothetical protein MIMGU_mgv1a012328mg              77.0    4e-14   
gb|KFK42450.1|  hypothetical protein AALP_AA2G258500                  77.0    5e-14   
gb|ERZ99306.1|  hypothetical protein GLOINDRAFT_64218                 75.5    5e-14   
gb|KJB68410.1|  hypothetical protein B456_010G243600                  76.6    5e-14   
gb|KHG08805.1|  hypothetical protein F383_13118                       76.6    5e-14   
ref|XP_007013353.1|  PPPDE thiol peptidase family protein, putati...  76.6    5e-14   
ref|XP_011083723.1|  PREDICTED: deSI-like protein At4g17486           77.0    5e-14   
gb|KFK42451.1|  hypothetical protein AALP_AA2G258500                  76.6    5e-14   
ref|XP_007135801.1|  hypothetical protein PHAVU_010G159700g           76.6    5e-14   
ref|XP_006341367.1|  PREDICTED: deSI-like protein At4g17486-like ...  76.6    5e-14   
ref|XP_002970161.1|  hypothetical protein SELMODRAFT_68072            75.5    5e-14   
ref|XP_009797371.1|  PREDICTED: deSI-like protein At4g17486 isofo...  76.6    5e-14   
ref|XP_004245799.1|  PREDICTED: deSI-like protein At4g17486 isofo...  76.6    5e-14   
ref|XP_011088352.1|  PREDICTED: deSI-like protein At4g17486           76.6    5e-14   
ref|XP_008375463.1|  PREDICTED: deSI-like protein At4g17486           76.6    5e-14   
ref|XP_003550204.1|  PREDICTED: deSI-like protein At4g17486-like      76.6    6e-14   
ref|XP_010939637.1|  PREDICTED: deSI-like protein At4g17486 isofo...  76.6    6e-14   
gb|KCW64251.1|  hypothetical protein EUGRSUZ_G01894                   77.0    6e-14   
ref|XP_004303257.1|  PREDICTED: deSI-like protein At4g17486           76.6    6e-14   
gb|EMT10608.1|  hypothetical protein F775_22117                       76.6    6e-14   
ref|XP_010461570.1|  PREDICTED: deSI-like protein At4g17486           77.0    6e-14   
ref|XP_009774099.1|  PREDICTED: deSI-like protein At4g17486           76.6    6e-14   
ref|XP_006359243.1|  PREDICTED: deSI-like protein At4g17486-like ...  76.6    6e-14   
gb|AAM65611.1|  unknown                                               76.6    6e-14   
gb|EJW77487.1|  hypothetical protein WUBG_11601                       76.6    6e-14   
ref|XP_003559047.1|  PREDICTED: deSI-like protein At4g17486           76.3    7e-14   
tpg|DAA42783.1|  TPA: EREBP-4 like protein                            77.0    7e-14   
ref|XP_007161150.1|  hypothetical protein PHAVU_001G046700g           76.3    7e-14   
ref|XP_009593866.1|  PREDICTED: deSI-like protein At4g17486           76.6    7e-14   
ref|XP_009797369.1|  PREDICTED: deSI-like protein At4g17486 isofo...  76.6    7e-14   
ref|XP_010690923.1|  PREDICTED: deSI-like protein At4g17486           76.6    7e-14   
ref|XP_010066376.1|  PREDICTED: deSI-like protein At4g17486           76.6    7e-14   
ref|XP_010454838.1|  PREDICTED: deSI-like protein At4g17486           76.3    7e-14   
gb|EYU19272.1|  hypothetical protein MIMGU_mgv1a013313mg              76.3    7e-14   
ref|XP_006302777.1|  hypothetical protein CARUB_v10020909mg           76.3    7e-14   
tpg|DAA42784.1|  TPA: hypothetical protein ZEAMMB73_870848            76.6    7e-14   
gb|ACU14336.1|  unknown                                               75.5    7e-14   
ref|XP_004508944.1|  PREDICTED: deSI-like protein At4g17486-like      76.3    8e-14   
gb|KJB51815.1|  hypothetical protein B456_008G232900                  75.9    8e-14   
ref|XP_006302776.1|  hypothetical protein CARUB_v10020909mg           76.3    8e-14   
ref|XP_006650944.1|  PREDICTED: deSI-like protein At4g17486-like      76.3    8e-14   
gb|ACR35423.1|  unknown                                               76.6    8e-14   
ref|XP_002297801.1|  hypothetical protein POPTR_0001s14750g           76.3    8e-14   
tpg|DAA42785.1|  TPA: hypothetical protein ZEAMMB73_870848            76.3    8e-14   
ref|XP_010033686.1|  PREDICTED: deSI-like protein At4g17486           76.3    8e-14   
gb|KHJ87619.1|  hypothetical protein OESDEN_12604                     76.3    8e-14   
ref|XP_008461171.1|  PREDICTED: deSI-like protein At4g17486           76.3    8e-14   
ref|XP_010325511.1|  PREDICTED: deSI-like protein At4g17486 isofo...  75.9    9e-14   
ref|XP_011034507.1|  PREDICTED: deSI-like protein At4g17486           75.9    9e-14   
ref|XP_010048906.1|  PREDICTED: deSI-like protein At4g17486           75.9    9e-14   
ref|XP_002468708.1|  hypothetical protein SORBIDRAFT_01g050610        75.9    9e-14   
ref|NP_564513.1|  PPPDE putative thiol peptidase family protein       76.3    9e-14   
gb|KJB79500.1|  hypothetical protein B456_013G052800                  75.9    1e-13   
ref|XP_002891381.1|  hypothetical protein ARALYDRAFT_473914           76.3    1e-13   
ref|XP_002948920.1|  hypothetical protein VOLCADRAFT_73996            75.5    1e-13   
gb|KFG50460.1|  putative PPPDE peptidase domain protein               76.6    1e-13   
ref|XP_008242728.1|  PREDICTED: deSI-like protein At4g17486 isofo...  76.3    1e-13   
ref|XP_004252784.1|  PREDICTED: deSI-like protein At4g17486           75.9    1e-13   
ref|XP_011081298.1|  PREDICTED: deSI-like protein At4g17486           75.9    1e-13   
ref|XP_003608667.1|  EREBP-4 like protein                             75.9    1e-13   
ref|XP_006342596.1|  PREDICTED: deSI-like protein At4g17486-like ...  75.9    1e-13   
ref|XP_003526223.1|  PREDICTED: uncharacterized LOC100306675          75.9    1e-13   
ref|XP_003523969.1|  PREDICTED: deSI-like protein At4g17486-like      75.9    1e-13   
ref|XP_008786120.1|  PREDICTED: deSI-like protein At4g17486 isofo...  75.9    1e-13   
ref|XP_008786123.1|  PREDICTED: deSI-like protein At4g17486 isofo...  75.5    1e-13   
ref|XP_008242727.1|  PREDICTED: deSI-like protein At4g17486 isofo...  76.3    1e-13   
ref|XP_009782759.1|  PREDICTED: deSI-like protein At4g17486 isofo...  75.5    1e-13   
gb|KHN35524.1|  UPF0326 protein                                       75.9    1e-13   
ref|XP_010063553.1|  PREDICTED: deSI-like protein At4g17486           75.5    1e-13   
ref|XP_004169614.1|  PREDICTED: deSI-like protein At4g17486-like      75.9    1e-13   
ref|XP_006284490.1|  hypothetical protein CARUB_v10005683mg           75.1    1e-13   
ref|XP_002527317.1|  conserved hypothetical protein                   75.5    1e-13   
ref|XP_009104477.1|  PREDICTED: deSI-like protein At4g17486 isofo...  75.5    1e-13   
ref|XP_010322656.1|  PREDICTED: deSI-like protein At4g17486 isofo...  75.9    1e-13   
gb|AFK36138.1|  unknown                                               75.5    1e-13   
ref|XP_009104478.1|  PREDICTED: deSI-like protein At4g17486 isofo...  75.5    1e-13   
gb|KJB51816.1|  hypothetical protein B456_008G232900                  75.5    1e-13   
ref|XP_008454170.1|  PREDICTED: deSI-like protein At4g17486           75.5    1e-13   
ref|XP_953566.1|  hypothetical protein                                77.0    1e-13   
ref|XP_004833685.1|  hypothetical protein BEWA_042710                 76.3    1e-13   
ref|XP_007138318.1|  hypothetical protein PHAVU_009G198600g           75.5    1e-13   
ref|XP_009614901.1|  PREDICTED: deSI-like protein At4g17486           75.5    1e-13   
gb|KDP32364.1|  hypothetical protein JCGZ_13289                       75.5    1e-13   
ref|XP_002304720.2|  hypothetical protein POPTR_0003s17880g           75.5    1e-13   
ref|XP_004152173.1|  PREDICTED: deSI-like protein At4g17486-like      75.5    1e-13   
ref|XP_008447052.1|  PREDICTED: deSI-like protein At4g17486           75.9    1e-13   
gb|KEH39865.1|  PPPDE thiol peptidase family protein, putative        75.5    1e-13   
ref|XP_003524060.1|  PREDICTED: uncharacterized LOC100306242 isof...  75.5    1e-13   
ref|XP_009363938.1|  PREDICTED: LOW QUALITY PROTEIN: deSI-like pr...  75.5    1e-13   
ref|NP_001148832.1|  EREBP-4 like protein                             75.1    2e-13   
ref|XP_008337328.1|  PREDICTED: deSI-like protein At4g17486           75.5    2e-13   
emb|CDP07553.1|  unnamed protein product                              75.5    2e-13   
ref|XP_008786121.1|  PREDICTED: deSI-like protein At4g17486 isofo...  75.5    2e-13   
ref|XP_008474133.1|  PREDICTED: desumoylating isopeptidase 2 isof...  74.7    2e-13   
gb|ABR16395.1|  unknown                                               75.1    2e-13   
ref|XP_006647624.1|  PREDICTED: deSI-like protein At4g17486-like      75.1    2e-13   
ref|XP_009613798.1|  PREDICTED: deSI-like protein At4g17486 isofo...  75.1    2e-13   
ref|XP_009613792.1|  PREDICTED: deSI-like protein At4g17486 isofo...  75.1    2e-13   
gb|KHN06115.1|  UPF0326 protein                                       75.1    2e-13   
ref|XP_006356237.1|  PREDICTED: deSI-like protein At4g17486-like      75.9    2e-13   
ref|XP_007202644.1|  hypothetical protein PRUPE_ppa012132mg           74.7    2e-13   
gb|KJB83142.1|  hypothetical protein B456_013G233100                  75.1    2e-13   
gb|ACJ85570.1|  unknown                                               74.7    2e-13   
ref|NP_001241211.1|  uncharacterized protein LOC100797619             75.1    2e-13   
gb|KHN44096.1|  UPF0326 protein                                       75.1    2e-13   
ref|XP_008883291.1|  hypothetical protein HHA_256780                  77.0    2e-13   
ref|XP_004953329.1|  PREDICTED: deSI-like protein At4g17486-like      74.7    2e-13   
ref|NP_001048648.1|  Os03g0100900                                     75.1    2e-13   
ref|XP_010275412.1|  PREDICTED: deSI-like protein At4g17486           74.7    2e-13   
gb|KHG03781.1|  hypothetical protein F383_26901                       74.7    2e-13   
ref|XP_010539054.1|  PREDICTED: deSI-like protein At4g17486           75.1    2e-13   
ref|XP_001691631.1|  predicted protein                                73.6    2e-13   
ref|XP_002364925.1|  hypothetical protein, conserved                  76.3    3e-13   
ref|XP_010049967.1|  PREDICTED: deSI-like protein At4g17486           74.3    3e-13   
gb|AES91453.2|  PPPDE thiol peptidase family protein, putative        74.7    3e-13   
gb|EPR63050.1|  hypothetical protein TGGT1_256780                     76.6    3e-13   
dbj|BAJ99847.1|  predicted protein                                    74.3    3e-13   
gb|KJB79502.1|  hypothetical protein B456_013G052800                  74.7    3e-13   
gb|AFK49245.1|  unknown                                               74.7    3e-13   
ref|XP_009399806.1|  PREDICTED: deSI-like protein At4g17486           74.3    3e-13   
ref|NP_001242588.1|  uncharacterized protein LOC100788399             74.7    3e-13   
ref|XP_001977781.1|  GG18051                                          74.3    3e-13   
ref|XP_003531729.1|  PREDICTED: deSI-like protein At4g17486-like      74.3    3e-13   
gb|EPT29210.1|  hypothetical protein TGME49_256780                    76.6    3e-13   
ref|XP_003563754.1|  PREDICTED: deSI-like protein At4g17486           74.3    3e-13   
gb|KCW88086.1|  hypothetical protein EUGRSUZ_A00497                   74.7    3e-13   
gb|KIZ00541.1|  hypothetical protein MNEG_7426                        76.3    3e-13   
ref|XP_007153141.1|  hypothetical protein PHAVU_003G010300g           74.7    3e-13   
gb|KFG64955.1|  putative PPPDE peptidase domain protein               76.6    3e-13   
gb|KHN38023.1|  UPF0326 protein                                       74.3    3e-13   
gb|ACJ85718.1|  unknown                                               74.3    3e-13   
ref|NP_001149450.1|  EREBP-4 like protein                             74.3    3e-13   
ref|XP_010325507.1|  PREDICTED: deSI-like protein At4g17486 isofo...  74.3    3e-13   
ref|XP_002285036.1|  PREDICTED: deSI-like protein At4g17486           74.3    3e-13   
ref|XP_001760401.1|  predicted protein                                73.6    3e-13   
ref|XP_002531470.1|  conserved hypothetical protein                   74.3    3e-13   
ref|XP_007157262.1|  hypothetical protein PHAVU_002G056000g           74.3    3e-13   
ref|XP_004152389.1|  PREDICTED: deSI-like protein At4g17486-like      74.3    3e-13   
ref|XP_007013354.1|  PPPDE thiol peptidase family protein, putati...  74.7    3e-13   
ref|XP_006393524.1|  hypothetical protein EUTSA_v10011705mg           74.7    3e-13   
ref|XP_010027281.1|  PREDICTED: deSI-like protein At4g17486           74.3    3e-13   
ref|XP_009109197.1|  PREDICTED: uncharacterized protein LOC103834...  77.4    3e-13   
gb|EGT35336.1|  hypothetical protein CAEBREN_20584                    75.1    3e-13   
ref|XP_002524445.1|  conserved hypothetical protein                   74.3    3e-13   
ref|XP_009613773.1|  PREDICTED: deSI-like protein At4g17486 isofo...  74.3    4e-13   
gb|ABF94476.1|  UPF0326 protein hag1, putative, expressed             73.6    4e-13   
ref|XP_010240207.1|  PREDICTED: deSI-like protein At4g17486 isofo...  73.6    4e-13   
ref|XP_003609256.1|  hypothetical protein MTR_4g113720                74.7    4e-13   
ref|XP_001758280.1|  predicted protein                                73.2    4e-13   
tpg|DAA43959.1|  TPA: hypothetical protein ZEAMMB73_059254            73.6    4e-13   
ref|XP_008790840.1|  PREDICTED: deSI-like protein At4g17486           73.9    4e-13   
gb|ACU18229.1|  unknown                                               73.9    4e-13   
ref|XP_006423211.1|  hypothetical protein CICLE_v10029154mg           74.3    4e-13   
ref|XP_008474132.1|  PREDICTED: desumoylating isopeptidase 2 isof...  73.9    4e-13   
ref|XP_008354379.1|  PREDICTED: deSI-like protein At4g17486 isofo...  73.9    4e-13   
ref|XP_010691618.1|  PREDICTED: deSI-like protein At4g17486 isofo...  74.3    4e-13   
ref|XP_008354380.1|  PREDICTED: deSI-like protein At4g17486 isofo...  73.9    4e-13   
gb|KJB25514.1|  hypothetical protein B456_004G195500                  73.6    4e-13   
ref|XP_009768218.1|  PREDICTED: deSI-like protein At4g17486           74.3    4e-13   
ref|XP_009364666.1|  PREDICTED: deSI-like protein At4g17486           74.3    4e-13   
ref|XP_010325510.1|  PREDICTED: deSI-like protein At4g17486 isofo...  73.9    4e-13   
ref|XP_009606009.1|  PREDICTED: deSI-like protein At4g17486           74.3    4e-13   
ref|XP_004148301.1|  PREDICTED: deSI-like protein At4g17486-like      73.9    4e-13   
ref|XP_006600172.1|  PREDICTED: uncharacterized protein LOC100788...  73.9    5e-13   
ref|XP_010677100.1|  PREDICTED: deSI-like protein At4g17486 isofo...  73.9    5e-13   
gb|KHN29613.1|  UPF0326 protein                                       73.9    5e-13   
ref|XP_006284491.1|  hypothetical protein CARUB_v10005683mg           73.9    5e-13   
ref|XP_003081736.1|  unnamed protein product                          73.9    5e-13   
emb|CEF99458.1|  PPPDE putative peptidase domain                      73.9    5e-13   
ref|XP_007017472.1|  PPPDE thiol peptidase family protein, putative   73.9    5e-13   
ref|XP_003523676.1|  PREDICTED: deSI-like protein At4g17486-like      73.9    5e-13   
ref|NP_001047618.1|  Os02g0655500                                     73.6    5e-13   
gb|ACN25150.1|  unknown                                               73.6    5e-13   
ref|XP_010936961.1|  PREDICTED: deSI-like protein At4g17486 isofo...  73.9    5e-13   
ref|XP_007160775.1|  hypothetical protein PHAVU_001G015700g           73.9    5e-13   
ref|XP_009771952.1|  PREDICTED: deSI-like protein At4g17486 isofo...  73.9    5e-13   
gb|ACG25871.1|  EREBP-4 like protein                                  73.6    5e-13   
ref|XP_009594644.1|  PREDICTED: deSI-like protein At4g17486 isofo...  73.9    5e-13   
ref|XP_008220770.1|  PREDICTED: deSI-like protein At4g17486 isofo...  73.9    5e-13   
ref|XP_010089496.1|  hypothetical protein L484_006047                 73.9    5e-13   



>ref|XP_004232611.1| PREDICTED: deSI-like protein At4g17486 [Solanum lycopersicum]
Length=213

 Score =   229 bits (584),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 120/149 (81%), Gaps = 1/149 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EVILH+YDLT S  G D VN+ VVQMN+LLKD I+ GG+FH AVQ+Y  VEWAYG   
Sbjct  1    MAEVILHVYDLTKS-DGQDAVNFGVVQMNRLLKDTISFGGMFHTAVQVYDNVEWAYGSCV  59

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCPATKNPNYTYRE I  GRT CS+ KVN ILK+LRD WPG +Y++VSRNSKHF
Sbjct  60   IGSGVFSCPATKNPNYTYREKIVLGRTECSAHKVNQILKDLRDAWPGSKYNMVSRNSKHF  119

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKD  503
            C E LEKLGVPKLP WA+R AN+GD AKD
Sbjct  120  CDEFLEKLGVPKLPNWANRFANIGDLAKD  148



>ref|XP_006363155.1| PREDICTED: uncharacterized protein LOC102588654 [Solanum tuberosum]
Length=212

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 123/149 (83%), Gaps = 1/149 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EVILH+YD+T S  G+D VN+ VVQMN+LLKD I  GG+FH AVQ+Y  VEWAYG  +
Sbjct  1    MAEVILHVYDITKSD-GHDAVNFGVVQMNRLLKDTIYFGGIFHTAVQVYDNVEWAYGSCE  59

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            KGSG+FSCPATKNPNYT+RE I  GRT CS+ KVN ILK+LRD WPG++Y++VSRNSKHF
Sbjct  60   KGSGVFSCPATKNPNYTHREKIVLGRTECSAHKVNQILKDLRDAWPGNKYNMVSRNSKHF  119

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKD  503
            C E LEKLGVPKLP WA+R AN+GD AK+
Sbjct  120  CDEFLEKLGVPKLPNWANRFANIGDIAKE  148



>ref|XP_009622250.1| PREDICTED: uncharacterized protein LOC104113704 [Nicotiana tomentosiformis]
Length=292

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+L++YD+  SG G+D  N+ VVQMN LLKDGIN GG+FH AVQ+YG  EWAYGH +
Sbjct  1    MAEVVLYVYDMNKSG-GHDAHNFAVVQMNNLLKDGINFGGLFHTAVQVYGNDEWAYGHTN  59

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            KGSG+F+CPA KNP+YT RE I  GRT CS SKVN ILKEL D WPG++Y+ VSRNSKHF
Sbjct  60   KGSGVFTCPAGKNPSYTIREKIILGRTECSPSKVNKILKELSDSWPGNKYNFVSRNSKHF  119

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKD  503
              ELLE+LGVPKLP W +R+ N+ DAAKD
Sbjct  120  SNELLERLGVPKLPGWVNRVTNIADAAKD  148



>ref|XP_009803660.1| PREDICTED: uncharacterized protein LOC104248996 [Nicotiana sylvestris]
Length=292

 Score =   220 bits (561),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 120/149 (81%), Gaps = 1/149 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+L++YD+  SG G+D  N+ VVQMN LLKDGIN GG+FH AVQIYG  EWAYGH +
Sbjct  1    MAEVVLYVYDMNKSG-GHDAHNFAVVQMNNLLKDGINFGGLFHTAVQIYGNDEWAYGHTN  59

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            KGSG+FSCPA KNP+YT RE I  GRTH S SKVN ILKEL D WPG++Y+ VSRNSKHF
Sbjct  60   KGSGVFSCPAGKNPSYTLREKIIMGRTHGSPSKVNKILKELIDSWPGNKYNFVSRNSKHF  119

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKD  503
              ELLE+LGVPKLP W +R++N+ DAAKD
Sbjct  120  SNELLERLGVPKLPGWVNRVSNIADAAKD  148



>ref|XP_010255243.1| PREDICTED: deSI-like protein At4g17486 [Nelumbo nucifera]
Length=246

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEVILH+YD+T SG      N  +VQ+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTEVILHVYDVTNSGSAK--TNNTIVQINKIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP++KNP YTYRE I  G T+ S  KVN IL+EL  EWPGD Y L+S+N  HF
Sbjct  59   QGSGVFSCPSSKNPMYTYRECIVLGNTNFSIFKVNQILRELSREWPGDSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGVPKLPAW +R AN GDAA +V
Sbjct  119  CDEFCERLGVPKLPAWVNRFANAGDAAMEV  148



>ref|XP_009629049.1| PREDICTED: desumoylating isopeptidase 2-like [Nicotiana tomentosiformis]
Length=138

 Score =   199 bits (505),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 107/137 (78%), Gaps = 1/137 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+L++YD+  SG G+D  N  VVQMN LLKDGIN GG+FH AVQIYG  EWAYGH +
Sbjct  1    MAEVVLYVYDMNKSG-GHDAHNLAVVQMNNLLKDGINFGGLFHTAVQIYGNDEWAYGHTN  59

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            KGSG+FSCP  KNP+YT RE I  GRT  SSSKVN ILKEL D WPG++Y+ VSRNSKHF
Sbjct  60   KGSGVFSCPVGKNPSYTIREKIILGRTEYSSSKVNKILKELSDSWPGNKYNFVSRNSKHF  119

Query  417  CQELLEKLGVPKLPAWA  467
              ELLE+LGVPKLP W 
Sbjct  120  SNELLERLGVPKLPGWT  136



>ref|XP_008380101.1| PREDICTED: deSI-like protein At4g17486 [Malus domestica]
Length=248

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MAEVVLHIYDVTNSG--SDKTNSTILQINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP+ KNP YTYRESI  G THCS  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESIVLGTTHCSIFKVNQILRELSREWPGYSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C EL E+LGVPKLP W +R A+ GDAA +V
Sbjct  119  CDELCERLGVPKLPGWVNRFAHAGDAAMEV  148



>ref|XP_009375518.1| PREDICTED: deSI-like protein At4g17486 [Pyrus x bretschneideri]
 ref|XP_009377548.1| PREDICTED: deSI-like protein At4g17486 [Pyrus x bretschneideri]
Length=249

 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MAEVVLHIYDVTNSG--SDKTNSTILQINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP+ KNP YTYRESI  G THCS  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESIVLGTTHCSIFKVNQILRELSREWPGYSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C EL E+LGVP+LP W +R A+ GDAA +V
Sbjct  119  CDELCERLGVPRLPGWVNRFAHAGDAAMEV  148



>ref|XP_008376635.1| PREDICTED: deSI-like protein At4g17486 [Malus domestica]
Length=249

 Score =   200 bits (509),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MAEVVLHIYDVTNSG--SDKTNSTILQINKIFKDGIGLGGIFHSAVQVYGEDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP+ KNP YTYRESI  G T CS  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESIVLGTTDCSIFKVNQILRELSREWPGYSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C EL E+LGVPKLP W +R A+ GDAA +V
Sbjct  119  CDELCERLGVPKLPGWVNRFAHAGDAAMEV  148



>gb|KHG28577.1| hypothetical protein F383_12435 [Gossypium arboreum]
Length=250

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 112/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV LHIYD+T SG  +D  N  +VQ+NK+ KDGI LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MTEVRLHIYDVTNSG--SDKTNSTIVQINKIFKDGIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP+ KNP YTYRES+  GRT+ S  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESMVLGRTNFSKLKVNQILQELSREWPGSSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  EKLGV KLP W +R AN GDAA ++
Sbjct  119  CDEFCEKLGVQKLPGWVNRFANAGDAAIEI  148



>ref|XP_009368740.1| PREDICTED: deSI-like protein At4g17486 [Pyrus x bretschneideri]
Length=249

 Score =   199 bits (507),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH AVQ+YGE EW++G+ +
Sbjct  1    MAEVVLHIYDVTNSG--SDKTNSTILQINKIFKDGIGLGGIFHSAVQVYGEDEWSFGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP+ KNP YTYRESI  G T CS  KVN IL+EL  EWPG  Y L+++N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESIVLGTTDCSIFKVNQILRELSREWPGYSYDLLAKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C EL E+LGVPKLP W +R A+ GDAA +V
Sbjct  119  CDELCERLGVPKLPGWVNRFAHAGDAAMEV  148



>gb|EYU19578.1| hypothetical protein MIMGU_mgv1a012735mg [Erythranthe guttata]
Length=241

 Score =   199 bits (507),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 115/150 (77%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EVILH+YD+T SG  N+  N  ++Q+NK+ KDGI+LGG+FH AVQ+YG+ EW++G+ +
Sbjct  1    MMEVILHVYDVTNSG--NEKTNNTIMQINKIFKDGISLGGIFHSAVQVYGDDEWSFGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+TKNP YTYRESI  G+T  S  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSTKNPMYTYRESIKLGQTSFSIFKVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGVPKLP W +R AN+GD A ++
Sbjct  119  CDEFCERLGVPKLPGWVNRFANIGDTATEI  148



>ref|XP_007221005.1| hypothetical protein PRUPE_ppa010466mg [Prunus persica]
 gb|EMJ22204.1| hypothetical protein PRUPE_ppa010466mg [Prunus persica]
Length=249

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH A+Q+YGE EW++G  +
Sbjct  1    MTEVVLHIYDVTNSG--SDKTNSTILQINKIFKDGIGLGGIFHSAIQVYGEDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP+ KNP YTYRE I  G T+CS  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRECITLGTTNCSIFKVNQILRELSREWPGYSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGVPKLP W +R A+ GDAA +V
Sbjct  119  CDEFSERLGVPKLPGWVNRFAHAGDAAMEV  148



>ref|XP_002273259.1| PREDICTED: deSI-like protein At4g17486 [Vitis vinifera]
Length=247

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 115/153 (75%), Gaps = 2/153 (1%)
 Frame = +3

Query  48   ISKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYG  227
            ++   EV+LHIYD+T SG  ++  N  +VQ+NK+ KDGI LGG+FH AVQ+YG+ EW++G
Sbjct  1    MTTTMEVVLHIYDVTNSG--SEKTNNTIVQINKIFKDGIGLGGIFHSAVQVYGDDEWSFG  58

Query  228  HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  407
              ++G+G+FSCPA+KNP YTYRE I  GRT+ S  KVN IL+EL  EWPG  Y L+++N 
Sbjct  59   FCEQGTGVFSCPASKNPMYTYRECIVLGRTNFSIFKVNQILRELSREWPGSSYDLLAKNC  118

Query  408  KHFCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
             HFC EL EKLGVPKLP W +R AN GDAA +V
Sbjct  119  NHFCDELCEKLGVPKLPGWVNRFANAGDAAMEV  151



>gb|KHN09305.1| UPF0326 protein [Glycine soja]
Length=245

 Score =   198 bits (504),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MT+V+LHIYD+T SG  ++  N  +VQ+NK+ KDGI LGG+FH AVQ++G+ EW++G  +
Sbjct  1    MTDVVLHIYDVTNSG--SEKTNNTIVQINKIFKDGIGLGGIFHSAVQVFGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRESI  G+T+CS  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYRESIVLGKTNCSIFKVNQILRELSREWPGSSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGVPKLP W +R AN GD A +V
Sbjct  119  CDEFCERLGVPKLPGWVNRFANAGDTAMEV  148



>emb|CBI22663.3| unnamed protein product [Vitis vinifera]
Length=243

 Score =   198 bits (503),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 113/148 (76%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  242
            EV+LHIYD+T SG  ++  N  +VQ+NK+ KDGI LGG+FH AVQ+YG+ EW++G  ++G
Sbjct  2    EVVLHIYDVTNSG--SEKTNNTIVQINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCEQG  59

Query  243  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  422
            +G+FSCPA+KNP YTYRE I  GRT+ S  KVN IL+EL  EWPG  Y L+++N  HFC 
Sbjct  60   TGVFSCPASKNPMYTYRECIVLGRTNFSIFKVNQILRELSREWPGSSYDLLAKNCNHFCD  119

Query  423  ELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            EL EKLGVPKLP W +R AN GDAA +V
Sbjct  120  ELCEKLGVPKLPGWVNRFANAGDAAMEV  147



>ref|XP_008234843.1| PREDICTED: deSI-like protein At4g17486 [Prunus mume]
Length=249

 Score =   198 bits (504),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 112/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH A+Q+YGE EW++G  +
Sbjct  1    MTEVVLHIYDVTNSG--SDKTNSTILQINKIFKDGIGLGGIFHSAIQVYGEDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP+ KNP YTYRE I  G T CS  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRECITLGTTDCSIFKVNQILRELSREWPGYSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGVPKLP W +R A+ GDAA +V
Sbjct  119  CDEFSERLGVPKLPGWVNRFAHAGDAAMEV  148



>emb|CDP05149.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   198 bits (503),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEVILHIYD+T SG  +D  N  +VQ+NK+ KDGI LGG+FH AVQIYG+ EW++G  +
Sbjct  1    MTEVILHIYDVTNSG--SDKTNNTIVQINKIFKDGIGLGGIFHSAVQIYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCPA KNP YTYRE I  G T+ S  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPAAKNPMYTYREPIILGTTNSSIFKVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C EL E+LGVPKLP W +R A+ GDAA ++
Sbjct  119  CDELCERLGVPKLPGWVNRFAHAGDAAVEI  148



>ref|XP_009377608.1| PREDICTED: deSI-like protein At4g17486 [Pyrus x bretschneideri]
Length=249

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MAEVVLHIYDVTNSG--SDKTNSTILQINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP+ KNP YTYRESI  G THCS  KVN IL+EL  EW G  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESIVLGTTHCSIFKVNQILRELSREWSGYSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C EL E+LGVP+LP W +R A+ GDAA +V
Sbjct  119  CDELCERLGVPRLPGWVNRFAHAGDAAMEV  148



>ref|XP_004309182.1| PREDICTED: deSI-like protein At4g17486 [Fragaria vesca subsp. 
vesca]
Length=247

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG  ++  N  ++Q+NK+ KDGI LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MAEVVLHIYDVTNSG--SEKTNSTIMQINKIFKDGIGLGGIFHSAVQVYGEDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP+ KNP YTYRESI  G T CS  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESIVLGTTDCSIFKVNQILRELSREWPGYTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C EL E+LGVPKLP W +R A+ GDAA +V
Sbjct  119  CDELCERLGVPKLPGWVNRFAHAGDAAMEV  148



>ref|XP_011084455.1| PREDICTED: deSI-like protein At4g17486 [Sesamum indicum]
Length=248

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV LH+YD+T SG  ++  N  ++Q+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTEVTLHVYDVTNSG--SEKTNNTIMQINKIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+TKNP YTYRESI  GRT  S  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSTKNPMYTYRESIKLGRTSFSIYKVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGVPKLP W +R A+ GDAA ++
Sbjct  119  CDEFCERLGVPKLPGWVNRFAHAGDAAAEI  148



>ref|XP_006829047.1| hypothetical protein AMTR_s00001p00256510 [Amborella trichopoda]
 gb|ERM96463.1| hypothetical protein AMTR_s00001p00256510 [Amborella trichopoda]
Length=252

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EVILHIYD+T SG      N  +V +NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MPEVILHIYDVTNSGSA--KTNNTIVNINKIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP  KNP Y YRESI  G T  S SKVN IL+EL  EWPG+ Y L+SRN  HF
Sbjct  59   NGSGVFSCPPCKNPMYAYRESIALGETGFSISKVNQILRELSREWPGNSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C +L E+LGVPKLPAW +R AN GDAA +V
Sbjct  119  CDQLCERLGVPKLPAWVNRFANAGDAAMEV  148



>ref|XP_004140760.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus]
 ref|XP_004157182.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus]
 gb|KGN57407.1| hypothetical protein Csa_3G183900 [Cucumis sativus]
Length=251

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MT+VILHIYD+T SG   D  N  +V +NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTDVILHIYDVTNSGS--DKTNNTIVNINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ +NP YTYRESI  GRT+CS  KVN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   QGTGVFSCPSGQNPMYTYRESINLGRTNCSIFKVNQILRELSREWPGSSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C +  E L V KLP W +R AN GDAA +V
Sbjct  119  CDQFCEMLNVSKLPGWVNRFANAGDAALEV  148



>ref|XP_008439288.1| PREDICTED: deSI-like protein At4g17486 [Cucumis melo]
Length=253

 Score =   196 bits (498),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MT+VILHIYD+T SG   D  N  +V +NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTDVILHIYDVTNSGS--DKTNNTIVNINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ +NP YTYRESI  GRT+CS  KVN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   QGTGVFSCPSGQNPMYTYRESINLGRTNCSIFKVNQILRELSREWPGSSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C +  E L V KLP W +R AN GDAA +V
Sbjct  119  CDQFCEMLNVSKLPGWVNRFANAGDAALEV  148



>ref|XP_007038797.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007038798.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007038799.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23298.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23299.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23300.1| PPPDE thiol peptidase family protein, putative isoform 1 [Theobroma 
cacao]
Length=280

 Score =   196 bits (499),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV+LHIYD+T SG  +D  N  +VQ+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTEVVLHIYDVTNSG--SDKTNSTIVQINKIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP++KNP YTYRE +  GRT+ S  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSSKNPMYTYREFMVLGRTNFSIFKVNQILRELSREWPGSSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  ++LGV KLP W +R AN GDAA ++
Sbjct  119  CDEFCKRLGVQKLPGWVNRFANAGDAAIEI  148



>ref|XP_002305910.1| hypothetical protein POPTR_0004s07790g [Populus trichocarpa]
 gb|EEE86421.1| hypothetical protein POPTR_0004s07790g [Populus trichocarpa]
Length=268

 Score =   196 bits (498),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEVILH+YD+T SG  ++  N  ++ +NK+ KD I LGG+FH AVQI+G+ EW++G  +
Sbjct  1    MTEVILHVYDVTNSG--SEKTNNTILNINKIFKDAIGLGGIFHSAVQIHGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP++KNP YTYRE I  G+T CS  KVN IL+EL  EWPGD Y L+++N  HF
Sbjct  59   QGTGVFSCPSSKNPMYTYREKIVLGKTSCSIFKVNQILRELSREWPGDAYDLLAKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGVPKLP W +R AN GDAA +V
Sbjct  119  CDEFCERLGVPKLPGWVNRFANAGDAAMEV  148



>ref|XP_010276907.1| PREDICTED: desumoylating isopeptidase 2-like [Nelumbo nucifera]
Length=230

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EVILHIYD+T SG      N  +VQ+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MAEVILHIYDITNSGSA--KTNNTIVQINKIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP++KNP YT+RE I  G+T+    KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSSKNPMYTHREHIVLGKTNFPIFKVNQILRELSREWPGSSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGVPKLPAW +R AN GDAA +V
Sbjct  119  CDEFCERLGVPKLPAWVNRFANAGDAAMEV  148



>ref|XP_011043866.1| PREDICTED: uncharacterized protein LOC105139200 [Populus euphratica]
Length=268

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEVILH+YD+T SG  ++  N  ++ +NK+ KD I LGG+FH AVQI+G+ EW++G  +
Sbjct  1    MTEVILHVYDVTNSG--SEKTNNTILNINKIFKDAIGLGGIFHSAVQIHGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP++KNP YTYRE I  G+T CS  KVN IL+EL  EWPG +Y L+++N  HF
Sbjct  59   QGTGVFSCPSSKNPMYTYREKIVLGKTSCSIFKVNQILRELSREWPGSDYDLLAKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGVPKLP W +R AN GDAA +V
Sbjct  119  CDEFCERLGVPKLPGWVNRFANAGDAAMEV  148



>gb|KJB34156.1| hypothetical protein B456_006G050800 [Gossypium raimondii]
Length=250

 Score =   193 bits (491),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV LHIYD+T SG  +D  N  +VQ+NK+ KDGI LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MTEVRLHIYDVTNSG--SDKTNSTIVQINKIFKDGIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP+ KNP YTYRES+  G T+ S   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGKNPMYTYRESMVLGITNFSKLNVNQILQELSREWPGSSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGV KLP W +R AN GDAA ++
Sbjct  119  CDEFCERLGVQKLPGWVNRFANAGDAAIEI  148



>ref|XP_003533983.1| PREDICTED: UPF0326 protein At4g17486-like [Glycine max]
 gb|KHN03676.1| UPF0326 protein [Glycine soja]
Length=248

 Score =   193 bits (490),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MT+V+LHIYD+T SG  ++  N  +VQ+NK+ KDGI LGG+FH AVQ++G+ EW++G  +
Sbjct  1    MTDVVLHIYDVTNSG--SEKTNSTIVQINKIFKDGIGLGGIFHSAVQVFGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRESI  G+T+ S  K+N IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYRESIVLGKTNFSIFKLNQILRELSREWPGSSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGVPKLP W +R AN GD A +V
Sbjct  119  CDEFCERLGVPKLPGWVNRFANAGDTAMEV  148



>ref|XP_010671635.1| PREDICTED: deSI-like protein At4g17486 [Beta vulgaris subsp. 
vulgaris]
Length=247

 Score =   192 bits (489),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 113/148 (76%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  242
            +V+LHIYD+T SG  +D  N  ++Q+NK+ KDGI LGG+FH AVQ+YG+ EW++G  ++G
Sbjct  2    DVVLHIYDVTNSG--SDKTNNTIMQINKIFKDGIGLGGIFHSAVQVYGDDEWSFGFCEQG  59

Query  243  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  422
            +G+FSCP TKNP YTYRE I  G+T+ S+SKVN IL+EL  EWPG  Y L+SRN  HFC 
Sbjct  60   TGVFSCPITKNPMYTYREKIVLGQTNLSNSKVNQILRELSREWPGFSYDLLSRNCNHFCD  119

Query  423  ELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            EL E+L VPKLP W +R A+ GDAA ++
Sbjct  120  ELCERLDVPKLPGWVNRFAHAGDAAAEI  147



>ref|XP_007152194.1| hypothetical protein PHAVU_004G109400g [Phaseolus vulgaris]
 gb|ESW24188.1| hypothetical protein PHAVU_004G109400g [Phaseolus vulgaris]
Length=253

 Score =   192 bits (489),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MT+V+LHIYD+T SG  ++  N  +VQ+NK+ KDGI LGG+FH AVQ+Y E EW++G  D
Sbjct  1    MTDVVLHIYDVTNSG--SEKTNNTIVQINKIFKDGIGLGGIFHSAVQVYDEDEWSFGFCD  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRESI  G+T+    KVN IL+EL  EWPG  Y L+++N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYRESIVLGKTNFPCLKVNQILRELSREWPGSSYDLLAKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGVPKLP W +R AN GD A +V
Sbjct  119  CDEFCERLGVPKLPGWVNRFANAGDTAMEV  148



>gb|KJB37310.1| hypothetical protein B456_006G199100 [Gossypium raimondii]
Length=283

 Score =   193 bits (491),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 111/151 (74%), Gaps = 2/151 (1%)
 Frame = +3

Query  54   KMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHR  233
            KM EVILH+YD+T S   +D  N  +VQ+NK+ KDGI LGG+FH AVQ+YGE EW++G  
Sbjct  3    KMMEVILHVYDVTNSE--SDKTNSTIVQINKIFKDGIGLGGIFHSAVQVYGEDEWSFGFC  60

Query  234  DKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKH  413
            ++GSG+FSCP+ KNP YTYRES+  GRT+ S  KVN IL+EL  EWPG  Y L+S+N  H
Sbjct  61   EQGSGVFSCPSGKNPMYTYRESVVLGRTNFSIFKVNQILRELSREWPGSSYDLLSKNCNH  120

Query  414  FCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            FC +  E+LGV KLP W +R AN GD A ++
Sbjct  121  FCDDFCERLGVQKLPGWVNRFANAGDTAIEI  151



>ref|XP_006422019.1| hypothetical protein CICLE_v10005686mg [Citrus clementina]
 ref|XP_006490644.1| PREDICTED: uncharacterized protein LOC102607017 isoform X1 [Citrus 
sinensis]
 gb|ESR35259.1| hypothetical protein CICLE_v10005686mg [Citrus clementina]
 gb|KDO56772.1| hypothetical protein CISIN_1g025261mg [Citrus sinensis]
Length=255

 Score =   191 bits (485),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MT+V LHIYD+T SG   +  N  ++ +NK+ KDGI +GG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTDVRLHIYDVTNSGS--EKTNNTILNINKIFKDGIGVGGIFHSAVQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP+ +NP YTYRESI  G+T+ S  KVN IL+EL  EWPG+ Y L+ RN  HF
Sbjct  59   QGSGVFSCPSGRNPMYTYRESIVLGKTNFSIFKVNQILRELSREWPGNSYDLLGRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  ++LGVPKLP W +R AN GDAA +V
Sbjct  119  CDEFCDRLGVPKLPGWVNRFANAGDAAMEV  148



>ref|XP_010105750.1| hypothetical protein L484_014240 [Morus notabilis]
 gb|EXC05970.1| hypothetical protein L484_014240 [Morus notabilis]
Length=251

 Score =   191 bits (484),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV LHIYD+T SG  ++  N  ++Q+NK+ KDGI LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MAEVKLHIYDVTNSG--SEKTNNTILQINKIFKDGIGLGGIFHSAVQVYGEDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRESI  G T+C++ K N IL+EL  EWPG+ Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYRESIVLGTTNCTNLKANQILRELSREWPGNSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C    E+LGVPKLP W +R A+ GD A +V
Sbjct  119  CDVFCERLGVPKLPGWVNRFAHAGDTAMEV  148



>ref|XP_004234227.1| PREDICTED: desumoylating isopeptidase 2 [Solanum lycopersicum]
Length=237

 Score =   190 bits (483),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV+LHIYD+T SG  +D  N  +VQ+NK  KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTEVVLHIYDVTNSG--SDKTNNTIVQINKFFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCPA KNP Y+YRE I  G T+ S  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPAGKNPMYSYRECIVLGNTNHSIFKVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C EL E+LGV KLP W +R A+ GDAA ++
Sbjct  119  CDELCERLGVQKLPGWVNRFAHAGDAAVEI  148



>ref|XP_010555681.1| PREDICTED: deSI-like protein At4g17486 [Tarenaya hassleriana]
Length=248

 Score =   191 bits (484),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG  ++  N  +VQ+N++ KDGI LGG+FH A+Q+YG+ EW++G  +
Sbjct  1    MAEVVLHIYDVTNSG--SEKTNNTIVQINRIFKDGIGLGGIFHSAIQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP++KNP Y+YRE I  GRT CS   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSSKNPMYSYREKIVLGRTECSIFMVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGV KLP W +R A+ GDAA +V
Sbjct  119  CDEFCERLGVQKLPGWVNRFAHAGDAALEV  148



>ref|XP_010448389.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
Length=251

 Score =   191 bits (484),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV+LHIYD+T SG  ++  N  +VQ+N+  KDGI LGG+FH A+Q+YG+ EW+YG+ +
Sbjct  1    MTEVVLHIYDVTNSG--SEKTNNTIVQINRFFKDGIGLGGIFHSALQVYGDDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGKTECTKFIVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L +KLGVPK+P W +R AN GD A +V
Sbjct  119  CDLLCDKLGVPKIPGWVNRFANAGDTALEV  148



>gb|AFK44900.1| unknown [Lotus japonicus]
Length=251

 Score =   191 bits (484),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MT+V+LHIYD+T SG  ++  N  +VQ+NK+ KDGI LGG+FH AVQ+YGE EW++G+ +
Sbjct  1    MTDVMLHIYDVTNSG--SEKTNSTIVQINKIFKDGIGLGGIFHSAVQVYGEEEWSFGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRE I  G+T  S  KVN IL+EL  E PG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYRECIILGKTSFSIFKVNQILRELSRERPGSSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGVPKLP W +R AN GD A +V
Sbjct  119  CDEFCERLGVPKLPGWVNRFANAGDTAMEV  148



>ref|XP_008796908.1| PREDICTED: deSI-like protein At4g17486 isoform X3 [Phoenix dactylifera]
Length=177

 Score =   187 bits (476),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV++HIYD+T SG  ++  N  ++Q+N++ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MEEVVVHIYDVTNSG--SEKTNNTILQINRIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP  +NP YTYRESI  G+T+CS   VN IL+EL   WPG  Y L+SRN  HF
Sbjct  59   YGSGVFSCPPRRNPMYTYRESIVLGKTNCSVFMVNQILRELSRAWPGSSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C    E LGVPKLP W +R AN GDAA +V
Sbjct  119  CDSFCELLGVPKLPGWVNRFANAGDAAMEV  148



>ref|XP_010433598.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
 ref|XP_010438841.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
Length=251

 Score =   190 bits (482),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV+LHIYD+T SG  ++  N  +VQ+N+  KDGI LGG+FH A+Q+YG+ EW+YG+ +
Sbjct  1    MTEVVLHIYDVTNSG--SEKTNNTIVQINRFFKDGIGLGGIFHSALQVYGDDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGKTDCTIFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L +KLGVPK+P W +R AN GD A +V
Sbjct  119  CDLLCDKLGVPKIPGWVNRFANAGDTALEV  148



>gb|EPS61570.1| hypothetical protein M569_13226, partial [Genlisea aurea]
Length=224

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  242
            EVILH+YD+T SG  ND  +  +V +NK  KDGI LGG+FH AVQIYG  EW++G   +G
Sbjct  2    EVILHVYDVTNSG--NDKTDNTIVNINKFFKDGIGLGGIFHSAVQIYGADEWSFGFCGQG  59

Query  243  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  422
            SG+FSCP  KNP YTYRESI  GRT  S SKVN IL+EL  EWPG  Y L+S+N  HFC 
Sbjct  60   SGVFSCPCKKNPMYTYRESISLGRTEFSISKVNQILRELSREWPGYSYDLLSKNCNHFCD  119

Query  423  ELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            +L E+LGV KLP W +R AN GD A ++
Sbjct  120  KLCERLGVLKLPGWVNRFANAGDTAVEI  147



>ref|XP_010433604.1| PREDICTED: uncharacterized protein LOC104717692 [Camelina sativa]
Length=255

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG   +  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSGS--EKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRE I  GRT C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGRTDCTPFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L +KLGVPK+P W +R AN GD A +V
Sbjct  119  CDLLCDKLGVPKIPGWVNRFANAGDTALEV  148



>gb|KDP22234.1| hypothetical protein JCGZ_26065 [Jatropha curcas]
Length=260

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MT+VILHIYD+T SG  ++  N  ++ +NK+ KDGI LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MTDVILHIYDVTNSG--SEKTNNTIMHINKIFKDGIGLGGIFHSAVQVYGEDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             G+G+FSCP+ KNP YTYRESI  GRT+    KVN IL+EL  EWPG  Y L+++N  HF
Sbjct  59   HGTGVFSCPSGKNPMYTYRESIVLGRTNFPIYKVNQILRELSREWPGSAYDLLAKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGVPKLP W +R AN GD A +V
Sbjct  119  CDEFCERLGVPKLPGWVNRFANAGDTALEV  148



>ref|XP_006353912.1| PREDICTED: deSI-like protein At4g17486-like [Solanum tuberosum]
Length=237

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV+LHIYD+T SG  +D  N  +VQ+NK  KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTEVVLHIYDVTNSG--SDKTNNTIVQINKFFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCPA KNP Y+YRE I  G T+ S  KVN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPAGKNPMYSYRECIVLGNTNHSIFKVNEILRELSREWPGHSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGV KLP W +R A+ GDAA ++
Sbjct  119  CDEFCERLGVQKLPGWVNRFAHAGDAAVEI  148



>ref|XP_003606789.1| PPPDE peptidase domain-containing protein [Medicago truncatula]
 gb|KEH26242.1| PPPDE thiol peptidase family protein, putative [Medicago truncatula]
Length=258

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 112/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MT+VILHIYD+T SG  ++  N  ++Q+NK+ KDGI LGG+FH AVQ++GE EW++G+ +
Sbjct  1    MTDVILHIYDVTNSG--SEKANNTILQINKIFKDGIGLGGIFHSAVQVFGEDEWSFGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP+ +NP YTYRESI  G+T+    KVN I++EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPSGQNPMYTYRESIVLGKTNFPIFKVNQIIRELSREWPGTAYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+L VPKLP W +R AN GD A +V
Sbjct  119  CDEFCERLDVPKLPGWVNRFANAGDTAMEV  148



>ref|XP_010035174.1| PREDICTED: deSI-like protein At4g17486 [Eucalyptus grandis]
Length=249

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV+LHIYD+T SG  ++  N  ++Q+NK+ KDG+ LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTEVVLHIYDVTNSG--SEKTNNTIMQINKIFKDGMGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRE +  G T+ S  KVN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   QGTGVFSCPSAKNPMYTYRERVVLGSTNFSIFKVNQILRELSREWPGHAYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGV KLP W +R AN GD A +V
Sbjct  119  CDEFCERLGVQKLPGWVNRFANAGDTAVEV  148



>ref|XP_008796907.1| PREDICTED: uncharacterized protein LOC103712218 isoform X2 [Phoenix 
dactylifera]
Length=258

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV++HIYD+T SG  ++  N  ++Q+N++ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MEEVVVHIYDVTNSG--SEKTNNTILQINRIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP  +NP YTYRESI  G+T+CS   VN IL+EL   WPG  Y L+SRN  HF
Sbjct  59   YGSGVFSCPPRRNPMYTYRESIVLGKTNCSVFMVNQILRELSRAWPGSSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C    E LGVPKLP W +R AN GDAA +V
Sbjct  119  CDSFCELLGVPKLPGWVNRFANAGDAAMEV  148



>ref|XP_011038376.1| PREDICTED: uncharacterized protein LOC105135271 [Populus euphratica]
Length=262

 Score =   189 bits (479),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEVILH+YD+T SG  ++  N  ++ +NK+ KD I LGG+FH A+Q+YGE EW++G  +
Sbjct  1    MTEVILHVYDVTNSG--SEKTNNTILNINKIFKDTIGLGGIFHSAIQVYGEDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             G+G+FSCP+ KNP YTYRE I  G+T  S  KVN IL+EL  EWPG +Y L+++N  HF
Sbjct  59   HGTGVFSCPSGKNPMYTYRERIVLGKTSFSIFKVNQILRELSREWPGSDYDLLAKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGVPKLP W +R AN GDAA ++
Sbjct  119  CDEFCERLGVPKLPGWVNRFANAGDAAMEI  148



>ref|XP_009798709.1| PREDICTED: deSI-like protein At4g17486 [Nicotiana sylvestris]
Length=246

 Score =   188 bits (477),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV++HIYD+T SG  +D  N  +VQ+NK  KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MTEVVVHIYDVTNSG--SDKTNNTIVQINKFFKDGIGLGGIFHSAVQVYGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCPA KNP YTYRE I  G T+ S  KVN IL+EL  EWPG  Y L+++N  HF
Sbjct  59   QGTGVFSCPAGKNPMYTYRECIVLGTTNHSIFKVNQILRELSREWPGHSYDLLAKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+LGV KLP W +R A+ GDAA ++
Sbjct  119  CDEFCERLGVQKLPGWVNRFAHAGDAAVEI  148



>ref|XP_010438844.1| PREDICTED: uncharacterized protein LOC104722396 [Camelina sativa]
Length=255

 Score =   188 bits (478),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG   +  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSGS--EKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGKTDCTPFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L +KLGVPK+P W +R AN GD A +V
Sbjct  119  CDLLCDKLGVPKIPGWVNRFANAGDTALEV  148



>ref|XP_006372440.1| hypothetical protein POPTR_0017s01650g [Populus trichocarpa]
 gb|ERP50237.1| hypothetical protein POPTR_0017s01650g [Populus trichocarpa]
Length=262

 Score =   188 bits (477),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEVILH+YD+T SG  ++  N  ++ +NK+ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MTEVILHVYDVTNSG--SEKTNNTILNINKIFKDTIGLGGIFHSAVQVYGEDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             G+G+FSCP+ KNP YTYRE I  G+T  S  KVN IL+EL  EWPG +Y L+++N  HF
Sbjct  59   HGTGVFSCPSGKNPMYTYRERIVLGKTSFSIFKVNQILRELSREWPGSDYDLLAKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E++GVPKLP W +R AN GDAA ++
Sbjct  119  CDEFCERIGVPKLPGWVNRFANAGDAAMEI  148



>ref|XP_006284399.1| hypothetical protein CARUB_v10005569mg [Capsella rubella]
 gb|EOA17297.1| hypothetical protein CARUB_v10005569mg [Capsella rubella]
Length=252

 Score =   188 bits (477),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG  ++  N  +VQ+N+  KDGI LGG+FH A+Q+YG+ EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSG--SEKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGDDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGKTDCTIFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVPK+P W +R AN GD A +V
Sbjct  119  CDILCDRLGVPKIPGWVNRFANAGDTALEV  148



>emb|CDX89402.1| BnaA01g14910D [Brassica napus]
Length=251

 Score =   187 bits (476),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV+LHIYD+T SG  ++  N  ++Q+N+  KDGI LGG+FH A+Q+YG+ EW+YG  +
Sbjct  1    MTEVVLHIYDVTNSG--SEKTNNTILQINRFFKDGIRLGGIFHSAIQVYGDEEWSYGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP++KNP YTYRE I  G+T C+   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSSKNPMYTYREKIVLGKTECTIFMVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L + LGVPKLP W +R A+ GD A +V
Sbjct  119  CDVLCDVLGVPKLPGWVNRFAHAGDTALEV  148



>ref|XP_009109194.1| PREDICTED: deSI-like protein At4g17486 [Brassica rapa]
 emb|CDY66007.1| BnaA08g30790D [Brassica napus]
Length=254

 Score =   187 bits (476),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 112/150 (75%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV++HIYD+T SG  ++  N  ++Q+N+  KDGI LGG+FH A+Q+YG+ EW++G+ +
Sbjct  1    MTEVVVHIYDVTNSG--SEKTNNTILQINRFFKDGIGLGGIFHSAIQVYGDDEWSFGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+TKNP YTYRE I  G+T C+   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSTKNPMYTYREKIVLGKTDCTIFMVNQILRELSREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVPKLP W +R A+ GD A +V
Sbjct  119  CDVLCDRLGVPKLPGWVNRFAHAGDTALEV  148



>ref|NP_194298.1| PPPDE putative thiol peptidase family protein [Arabidopsis thaliana]
 emb|CAB43699.1| putative protein [Arabidopsis thaliana]
 emb|CAB81378.1| putative protein [Arabidopsis thaliana]
 gb|AAM61523.1| unknown [Arabidopsis thaliana]
 gb|AAO24562.1| At4g25680 [Arabidopsis thaliana]
 dbj|BAE99636.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85094.1| PPPDE putative thiol peptidase family protein [Arabidopsis thaliana]
Length=252

 Score =   187 bits (475),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV+LHIYD+T SG  ++  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MTEVVLHIYDVTNSG--SEKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             G+G+FSCP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   LGTGVFSCPSGKNPMYTYREKIVLGKTDCTIFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVPK+P W +R AN GD A +V
Sbjct  119  CDVLCDRLGVPKIPGWVNRFANAGDTALEV  148



>ref|XP_002869660.1| hypothetical protein ARALYDRAFT_492258 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45919.1| hypothetical protein ARALYDRAFT_492258 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV+LHIYD+T SG  ++  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MTEVVLHIYDVTNSG--SEKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGGDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGKTDCTIFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVP++P W +R AN GD A +V
Sbjct  119  CDVLCDRLGVPEIPGWVNRFANAGDTALEV  148



>emb|CDX94426.1| BnaC01g17580D [Brassica napus]
Length=252

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV+LHIYD+T SG  ++  N  ++Q+N+  KDGI LGG+FH A+Q+YG+ EW+YG  +
Sbjct  1    MTEVVLHIYDVTNSG--SEKTNNTILQINRFFKDGIGLGGIFHSAIQVYGDEEWSYGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP++KNP YTYRE I  G+T C+   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSSKNPMYTYREKIVLGKTDCTIFMVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L + LGVPKLP W +R A+ GD A +V
Sbjct  119  CDVLCDVLGVPKLPGWVNRFAHAGDTALEV  148



>ref|XP_010933984.1| PREDICTED: desumoylating isopeptidase 2-like [Elaeis guineensis]
Length=239

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 108/147 (73%), Gaps = 2/147 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EVILH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVILHVYDVTNSE--SEKTNNTILQINRVFKDRIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             G+G+FSCP +KNP YTYRE I  G T+CS  KV+ IL+EL  EWPGD Y L+S+N  HF
Sbjct  59   NGTGVFSCPPSKNPMYTYRERILLGETNCSILKVSQILRELSREWPGDSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C    E+LGVPKLP W +R A+VGDAA
Sbjct  119  CDAFCERLGVPKLPGWVNRFASVGDAA  145



>ref|XP_009139416.1| PREDICTED: deSI-like protein At4g17486 [Brassica rapa]
Length=245

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV++HIYD+T +G  +D  N  ++Q+N++ KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVVHIYDVTNTG--SDKTNNTILQINRIFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+F CP++KNP YTYRE I  GRT C+   VN I +EL  EWPG  Y L+SRN  HF
Sbjct  59   QGTGVFRCPSSKNPMYTYREKIVLGRTDCTIFMVNQIFRELTREWPGHTYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVPKLP W +R A+ GD A +V
Sbjct  119  CDVLCDRLGVPKLPGWVNRFAHAGDTALEV  148



>emb|CDX94429.1| BnaC01g17550D [Brassica napus]
Length=245

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV++HIYD+T +G  +D  N  ++Q+N++ KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVVHIYDVTNTG--SDKTNNTILQINRIFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+F CP++KNP YTYRE I  GRT C+   VN I +EL  EWPG  Y L+SRN  HF
Sbjct  59   QGTGVFRCPSSKNPMYTYREKIVLGRTDCTIFMVNQIFRELTREWPGHTYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVPKLP W +R A  GD A +V
Sbjct  119  CDVLCDRLGVPKLPGWVNRFAQAGDTALEV  148



>ref|XP_010448394.1| PREDICTED: uncharacterized protein LOC104730857 [Camelina sativa]
Length=255

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 107/150 (71%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG   +  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSGS--EKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+F CP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFRCPSGKNPMYTYREKIVLGKTECTPFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L +KLGVPK+P W +R AN GD A +V
Sbjct  119  CDLLCDKLGVPKIPGWVNRFANAGDTALEV  148



>emb|CDX89404.1| BnaA01g14890D [Brassica napus]
Length=245

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV++HIYD+T +G  +D  N  ++Q+N++ KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVVHIYDVTNTG--SDKTNNTILQINRIFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+F CP++KNP YTYRE I  GRT C+   VN I +EL  EWPG  Y L+SRN  HF
Sbjct  59   QGTGVFRCPSSKNPMYTYREKIVLGRTDCTIFMVNQIFRELTREWPGHTYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVPKLP W +R A+ GD A +V
Sbjct  119  CDVLCDRLGVPKLPGWVNRFAHAGDTALEV  148



>ref|XP_006422020.1| hypothetical protein CICLE_v10005686mg [Citrus clementina]
 gb|ESR35260.1| hypothetical protein CICLE_v10005686mg [Citrus clementina]
Length=256

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 111/151 (74%), Gaps = 3/151 (2%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQI-YGEVEWAYGHR  233
            MT+V LHIYD+T SG   +  N  ++ +NK+ KDGI +GG+FH AVQ+ YG+ EW++G  
Sbjct  1    MTDVRLHIYDVTNSGS--EKTNNTILNINKIFKDGIGVGGIFHSAVQVVYGDEEWSFGFC  58

Query  234  DKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKH  413
            ++GSG+FSCP+ +NP YTYRESI  G+T+ S  KVN IL+EL  EWPG+ Y L+ RN  H
Sbjct  59   EQGSGVFSCPSGRNPMYTYRESIVLGKTNFSIFKVNQILRELSREWPGNSYDLLGRNCNH  118

Query  414  FCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            FC E  ++LGVPKLP W +R AN GDAA +V
Sbjct  119  FCDEFCDRLGVPKLPGWVNRFANAGDAAMEV  149



>ref|XP_011076114.1| PREDICTED: uncharacterized protein LOC105160441 isoform X2 [Sesamum 
indicum]
Length=249

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EVILH+YD+T SG   D  N  ++Q+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MREVILHVYDVTNSGY--DKTNNTIMQINKIFKDGIGLGGIFHTAVQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+T+NP YTYRESI  G+T  S  KVN I +EL  EWPG  Y L+++N  HF
Sbjct  59   QGTGVFSCPSTQNPMYTYRESINLGKTSFSIFKVNQIRRELSREWPGHSYDLLAKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E   +LGV KLP W +R AN GD A ++
Sbjct  119  CDEFCRRLGVQKLPGWVNRFANAGDTAVEI  148



>gb|KFK29064.1| hypothetical protein AALP_AA7G083900 [Arabis alpina]
Length=252

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG  +D  N  ++Q+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSG--SDKTNNTILQINRFFKDGIGLGGIFHSALQVYGTDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRE +  G+T C+   VN IL+EL  EWPG  Y L+++N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKVVLGKTDCTIFMVNQILRELSREWPGHTYDLLAKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVPK+P W +R AN GD A +V
Sbjct  119  CDVLCDRLGVPKIPGWVNRFANAGDTALEV  148



>ref|XP_004513185.1| PREDICTED: uncharacterized protein LOC101510879 [Cicer arietinum]
Length=251

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 111/148 (75%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  242
            +VILHIYD+T SG  ++  N  ++Q+NK+ KDGI LGG+FH AVQ++GE EW++G+ ++G
Sbjct  2    DVILHIYDVTNSG--SEKTNNTILQINKIFKDGIGLGGIFHSAVQVFGEDEWSFGYCEQG  59

Query  243  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  422
            +G+FSCP+ +NP YTYRE+I  G+T+ S  KVN IL+EL  EWPG  Y L+S+N  HFC 
Sbjct  60   TGVFSCPSGQNPMYTYREAIVLGKTNFSIFKVNQILRELSREWPGTAYDLLSKNCNHFCD  119

Query  423  ELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            E  E+L VPKLP W +R AN GD A +V
Sbjct  120  EFCERLDVPKLPGWVNRFANAGDTAMEV  147



>ref|NP_194296.1| PPPDE putative thiol peptidase family protein [Arabidopsis thaliana]
 emb|CAB43697.1| putative protein [Arabidopsis thaliana]
 emb|CAB81376.1| putative protein [Arabidopsis thaliana]
 gb|AAN72011.1| putative protein [Arabidopsis thaliana]
 gb|AAQ55277.1| At4g25660 [Arabidopsis thaliana]
 gb|AEE85090.1| PPPDE putative thiol peptidase family protein [Arabidopsis thaliana]
Length=255

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG  ++  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSG--SEKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRE I  G+T C+   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGKTDCTIFMVNQILRELSREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVPK+P W +R A+ GD A +V
Sbjct  119  CDVLCDRLGVPKIPGWVNRFAHAGDTALEV  148



>ref|XP_011076113.1| PREDICTED: uncharacterized protein LOC105160441 isoform X1 [Sesamum 
indicum]
Length=274

 Score =   186 bits (473),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EVILH+YD+T SG   D  N  ++Q+NK+ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MREVILHVYDVTNSGY--DKTNNTIMQINKIFKDGIGLGGIFHTAVQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+T+NP YTYRESI  G+T  S  KVN I +EL  EWPG  Y L+++N  HF
Sbjct  59   QGTGVFSCPSTQNPMYTYRESINLGKTSFSIFKVNQIRRELSREWPGHSYDLLAKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E   +LGV KLP W +R AN GD A ++
Sbjct  119  CDEFCRRLGVQKLPGWVNRFANAGDTAVEI  148



>ref|XP_009139388.1| PREDICTED: deSI-like protein At4g17486 [Brassica rapa]
Length=251

 Score =   185 bits (470),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 109/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV+LHIYD+  SG  ++  N  ++Q+N+  KDGI LGG+FH A+Q+YG+ EW+YG  +
Sbjct  1    MTEVVLHIYDVINSG--SEKTNNTILQINRFFKDGIRLGGIFHSAIQVYGDEEWSYGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP++KNP YTYRE I  G+T C+   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSSKNPMYTYREKIVLGKTECTIFMVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L + LGVPKLP W +R A+ GD A +V
Sbjct  119  CDVLCDVLGVPKLPGWVNRFAHAGDTALEV  148



>ref|XP_006413284.1| hypothetical protein EUTSA_v10026072mg [Eutrema salsugineum]
 gb|ESQ54737.1| hypothetical protein EUTSA_v10026072mg [Eutrema salsugineum]
Length=250

 Score =   185 bits (469),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M +VILHIYD+T SG  ++  N  ++Q+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MADVILHIYDVTNSG--SEKTNNTILQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP +KNP YTYRE I  GRT C+   VN I +EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPNSKNPMYTYREKIVLGRTDCTIFMVNQIFRELSREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVPKLP W +R A+ GD A +V
Sbjct  119  CDVLCDRLGVPKLPGWVNRFAHAGDTALEV  148



>gb|KFK29065.1| hypothetical protein AALP_AA7G084100 [Arabis alpina]
Length=252

 Score =   185 bits (469),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG  +D  N  ++Q+N+  KDGI LGG+FH A+Q+YG+ EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSG--SDKTNNTILQINRFFKDGIGLGGIFHSAIQVYGDDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+F+CP +KNP YTYRE I  G+T C+   VN IL+EL  EWPG  Y L+++N  HF
Sbjct  59   QGTGVFNCPRSKNPMYTYREKIVLGKTDCTIFMVNQILRELSKEWPGHTYDLLAKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVPK+P W +R A+ GD A +V
Sbjct  119  CDVLCDRLGVPKIPGWVNRFAHAGDTALEV  148



>ref|XP_006413282.1| hypothetical protein EUTSA_v10026034mg [Eutrema salsugineum]
 gb|ESQ54735.1| hypothetical protein EUTSA_v10026034mg [Eutrema salsugineum]
Length=257

 Score =   185 bits (469),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M +V+L+IYD+T SG  ++  N  ++Q+N+  KDGI LGG+FH A+Q+YG+ EW+YG+ +
Sbjct  1    MADVVLYIYDVTNSG--SEKTNNTILQINRFFKDGIGLGGIFHSAIQVYGDDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP++KNP YTYRE I  GRT C+   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSSKNPMYTYREKIVLGRTDCTIFMVNQILRELSREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVPKLP W +R A+ GD A +V
Sbjct  119  CDVLCDRLGVPKLPGWVNRFAHAGDTALEV  148



>gb|KJB23840.1| hypothetical protein B456_004G117500 [Gossypium raimondii]
Length=267

 Score =   185 bits (470),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 106/147 (72%), Gaps = 2/147 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EVILHIYD+T SG  +D  N  +V +NK+ KD I LGG+FH A+Q+YG+ EW++G  +
Sbjct  1    MAEVILHIYDVTNSG--SDKTNNTIVHINKIFKDRIGLGGIFHSAIQVYGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+F CP+ KNP YTYRE +  GRT+ S  KVN IL EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFCCPSRKNPLYTYREFMVLGRTNSSVFKVNQILCELSREWPGTSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C EL E+LGV KLP W +R AN GDAA
Sbjct  119  CDELCERLGVQKLPGWVNRFANTGDAA  145



>ref|XP_006661997.1| PREDICTED: desumoylating isopeptidase 2-like [Oryza brachyantha]
Length=243

 Score =   184 bits (468),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 103/147 (70%), Gaps = 2/147 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP  KNP YTYRE I  G T CS + VN IL+EL   WPG  Y L+SRN  HF
Sbjct  59   SGSGVFSCPIGKNPMYTYRECIVLGETECSIATVNRILRELSRNWPGHSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C EL E+L VPKLP W +R AN GD A
Sbjct  119  CDELCERLAVPKLPGWVNRFANAGDTA  145



>ref|XP_003574249.1| PREDICTED: desumoylating isopeptidase 2-like [Brachypodium distachyon]
Length=242

 Score =   184 bits (468),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 105/147 (71%), Gaps = 2/147 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP +KNP YTYRE I  G T C+ + VN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   NGSGVFSCPISKNPMYTYRERIVLGETECTIATVNRILRELSREWPGHSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C  L ++LGVPKLP W +R AN GD A
Sbjct  119  CDVLCDRLGVPKLPGWVNRFANAGDTA  145



>tpg|DAA46059.1| TPA: hypothetical protein ZEAMMB73_195984 [Zea mays]
Length=195

 Score =   182 bits (463),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 103/147 (70%), Gaps = 2/147 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVYGEDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP  KNP YTYRE I  G T C  + VN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   SGSGVFSCPIGKNPMYTYRERIVLGETECGIAAVNRILRELSREWPGHSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C  L E+LGVPKLP W +R AN GD A
Sbjct  119  CDVLCERLGVPKLPGWVNRFANAGDTA  145



>ref|XP_006284384.1| hypothetical protein CARUB_v10005552mg [Capsella rubella]
 gb|EOA17282.1| hypothetical protein CARUB_v10005552mg [Capsella rubella]
Length=255

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG   +  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSGS--EKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNPMYTYREKIVLGKTDCTIFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVPK+P W +R A+ GD A +V
Sbjct  119  CDVLCDRLGVPKIPGWVNRFAHAGDTALEV  148



>ref|XP_010537155.1| PREDICTED: deSI-like protein At4g17486 [Tarenaya hassleriana]
Length=248

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG  ++  N  +VQ+N++ KDGI LGG+FH A+Q++G+ EW++G  +
Sbjct  1    MAEVVLHIYDVTNSG--SEKTNNTIVQINRIFKDGIGLGGIFHSAIQVFGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+++NP Y YRE I  GRT CS   VN IL+EL  EWPG  Y L+S+N  HF
Sbjct  59   EGTGVFSCPSSENPMYAYREKIVIGRTECSIFLVNQILRELSREWPGHSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  ++LGV KLP W +R A+ GDAA +V
Sbjct  119  CNEFCDRLGVQKLPGWVNRFAHAGDAALEV  148



>emb|CDY49480.1| BnaCnng17460D [Brassica napus]
Length=253

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 111/150 (74%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MTEV++HIYD+T SG  ++  N  ++Q+N+  KDGI LGG+FH A+Q+YG+ EW++G+ +
Sbjct  1    MTEVVVHIYDVTNSG--SEKTNNTILQINRFFKDGIGLGGIFHSAIQVYGDDEWSFGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            + +G+FSCP+TKNP YTYRE I  G+T C+   VN +L+EL  EWPG  Y L+S+N  HF
Sbjct  59   QATGVFSCPSTKNPMYTYREKILLGKTDCTIFMVNQMLRELSREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVPKLP W +R A+ GD A +V
Sbjct  119  CDVLCDRLGVPKLPGWVNRFAHAGDTALEV  148



>ref|XP_008807844.1| PREDICTED: desumoylating isopeptidase 2-like [Phoenix dactylifera]
Length=239

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 104/147 (71%), Gaps = 2/147 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EVILH+YD+T S   ++  N  ++Q+N++ KD + LGG+FH A+Q+YGE EW++G  +
Sbjct  1    MKEVILHVYDVTNSE--SEKTNNTILQINRIFKDRVGLGGIFHSAIQVYGEEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP  KNP YTYRE I  G T CS  KV  IL+EL  EWPGD Y L+S+N  HF
Sbjct  59   NGSGVFSCPPGKNPMYTYREHILLGGTDCSILKVKQILRELSQEWPGDSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C    E+LGVPKLP W +R ANVGD A
Sbjct  119  CDAFCERLGVPKLPGWVNRFANVGDTA  145



>ref|XP_008794771.1| PREDICTED: uncharacterized protein LOC103710694 [Phoenix dactylifera]
 ref|XP_008794772.1| PREDICTED: uncharacterized protein LOC103710694 [Phoenix dactylifera]
 ref|XP_008794773.1| PREDICTED: uncharacterized protein LOC103710694 [Phoenix dactylifera]
 ref|XP_008794774.1| PREDICTED: uncharacterized protein LOC103710694 [Phoenix dactylifera]
Length=276

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 105/150 (70%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV++HIYD+T SG  ++  N  +VQ+N++ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MKEVVVHIYDVTNSG--SEKTNNTIVQINRIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP  +NP YTYRESI  G T+CS   VN IL+EL   WPG  Y L+SRN  HF
Sbjct  59   YGSGVFSCPPRRNPMYTYRESIVLGMTNCSIFMVNQILRELSSAWPGSSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C    E L  PKLP W +R AN GDAA +V
Sbjct  119  CDAFCELLAAPKLPGWVNRFANAGDAAMEV  148



>ref|NP_001143918.1| uncharacterized protein LOC100276728 [Zea mays]
 gb|ACG36388.1| hypothetical protein [Zea mays]
 gb|ACR34243.1| unknown [Zea mays]
 tpg|DAA46058.1| TPA: hypothetical protein ZEAMMB73_195984 [Zea mays]
Length=245

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 103/147 (70%), Gaps = 2/147 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVYGEDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP  KNP YTYRE I  G T C  + VN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   SGSGVFSCPIGKNPMYTYRERIVLGETECGIAAVNRILRELSREWPGHSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C  L E+LGVPKLP W +R AN GD A
Sbjct  119  CDVLCERLGVPKLPGWVNRFANAGDTA  145



>gb|AFK48534.1| unknown [Medicago truncatula]
Length=258

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            MT+VIL+IYD+T SG  ++  N  ++Q+NK+ KDGI LGG FH AVQ++GE EW++G+ +
Sbjct  1    MTDVILYIYDVTNSG--SEKANNTILQINKIFKDGIGLGGTFHSAVQVFGEDEWSFGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP+ +NP YTYRESI  G+T+    KVN I++EL  EWPG  Y L+S+N  H 
Sbjct  59   QGSGVFSCPSGQNPMYTYRESIVLGKTNFPIFKVNQIIRELSREWPGTAYDLLSKNCNHL  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E  E+L VPKLP W +R AN GD A +V
Sbjct  119  CDEFCERLDVPKLPGWVNRFANAGDTAMEV  148



>ref|XP_010941159.1| PREDICTED: uncharacterized protein LOC105059531 [Elaeis guineensis]
Length=276

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 106/150 (71%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV++HIYD+T SG  ++  N  +VQ+N++ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MKEVVVHIYDVTNSG--SEKTNNTIVQINRIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP  +NP YTYRESI  G T+ S   VN IL+EL   WPG  Y L+SRN  HF
Sbjct  59   YGSGVFSCPPRRNPMYTYRESIVLGMTNSSIFTVNQILRELSRAWPGRSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C    E LGVPKLP W +R AN GDAA +V
Sbjct  119  CDAFCELLGVPKLPGWVNRFANAGDAAMEV  148



>ref|NP_001065158.1| Os10g0533900 [Oryza sativa Japonica Group]
 gb|AAM88632.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAP54793.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF27072.1| Os10g0533900 [Oryza sativa Japonica Group]
 dbj|BAG93509.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96876.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51309.1| hypothetical protein OsJ_32269 [Oryza sativa Japonica Group]
Length=246

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 103/147 (70%), Gaps = 2/147 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP  KNP YTYRE I  G T CS + VN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   NGSGVFSCPIGKNPMYTYRECIVLGETECSIATVNRILRELSREWPGHSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C  L E+L VPKLP W +R AN GD A
Sbjct  119  CDVLCERLAVPKLPGWVNRFANAGDTA  145



>ref|XP_004983828.1| PREDICTED: deSI-like protein hag1-like [Setaria italica]
Length=251

 Score =   182 bits (463),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 103/147 (70%), Gaps = 2/147 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH A+Q+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAIQVYGEDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP  KNP YTYRE I  G T C  + VN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   TGSGVFSCPIGKNPMYTYRERIVLGETECGIAAVNRILRELSREWPGHSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C  L E+LGVPKLP W +R AN GD A
Sbjct  119  CDVLCERLGVPKLPGWVNRFANAGDTA  145



>gb|EEC67357.1| hypothetical protein OsI_34457 [Oryza sativa Indica Group]
Length=262

 Score =   182 bits (463),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 103/147 (70%), Gaps = 2/147 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP  KNP YTYRE I  G T CS + VN IL+EL  EWPG  Y L+SRN  HF
Sbjct  59   NGSGVFSCPIGKNPMYTYRECIVLGETECSIATVNRILRELSREWPGHSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C  L E+L VPKLP W +R AN GD A
Sbjct  119  CDVLCERLAVPKLPGWVNRFANAGDTA  145



>gb|KHG21774.1| hypothetical protein F383_27627 [Gossypium arboreum]
Length=269

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 105/147 (71%), Gaps = 2/147 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EVILHIYD+T SG  +D  N  +V +NK+ KD I LGG+FH A+Q+YG+ EW++G  +
Sbjct  1    MAEVILHIYDVTNSG--SDKTNNTIVHINKIFKDRIGLGGIFHSAIQVYGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+F CP+ KNP YTYRE +  GRT+ S  KVN IL EL  EWPG  Y  +S+N  HF
Sbjct  59   QGSGVFCCPSRKNPLYTYREFMVLGRTNSSIFKVNQILHELSREWPGTSYDSLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C EL E+LGV KLP W +R AN GDAA
Sbjct  119  CDELCERLGVQKLPGWVNRFANTGDAA  145



>gb|KJB34157.1| hypothetical protein B456_006G050800 [Gossypium raimondii]
Length=269

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 110/169 (65%), Gaps = 21/169 (12%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQ-------------  197
            MTEV LHIYD+T SG  +D  N  +VQ+NK+ KDGI LGG+FH AVQ             
Sbjct  1    MTEVRLHIYDVTNSG--SDKTNSTIVQINKIFKDGIGLGGIFHSAVQFSKENILRQYLCG  58

Query  198  ------IYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKEL  359
                  +YGE EW++G  ++GSG+FSCP+ KNP YTYRES+  G T+ S   VN IL+EL
Sbjct  59   QILGSEVYGEEEWSFGFCEQGSGVFSCPSGKNPMYTYRESMVLGITNFSKLNVNQILQEL  118

Query  360  RDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
              EWPG  Y L+S+N  HFC E  E+LGV KLP W +R AN GDAA ++
Sbjct  119  SREWPGSSYDLLSKNCNHFCDEFCERLGVQKLPGWVNRFANAGDAAIEI  167



>ref|XP_002467590.1| hypothetical protein SORBIDRAFT_01g030660 [Sorghum bicolor]
 gb|EER94588.1| hypothetical protein SORBIDRAFT_01g030660 [Sorghum bicolor]
Length=245

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 102/147 (69%), Gaps = 2/147 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+YGE EW++G  +
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVYGEEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP  KNP YTYRE I  G T C  + VN IL+EL  EW G  Y L+SRN  HF
Sbjct  59   NGSGVFSCPVGKNPMYTYRERIVLGETECGIAAVNRILRELGREWQGQSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C  L E+LGVPKLP W +R AN GD A
Sbjct  119  CDVLCERLGVPKLPGWVNRFANAGDTA  145



>ref|XP_002436336.1| hypothetical protein SORBIDRAFT_10g000670 [Sorghum bicolor]
 gb|EER87703.1| hypothetical protein SORBIDRAFT_10g000670 [Sorghum bicolor]
Length=268

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 106/148 (72%), Gaps = 5/148 (3%)
 Frame = +3

Query  63   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  242
            +V+ H+YD+  +G  +DT    V+ +N+  KDG+ LGG+FH A+Q+YG+ EW++G+ ++G
Sbjct  4    DVVAHVYDVATAG--SDTT---VLHINRFFKDGLGLGGIFHTAIQVYGDEEWSFGYCERG  58

Query  243  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  422
            +G+FSCP  KNP YTYRESI  G+T+C   KVN IL+EL  EWPG  Y L+SRN  HFC 
Sbjct  59   TGVFSCPPCKNPMYTYRESIVLGKTNCCILKVNQILRELSWEWPGQSYELLSRNCNHFCN  118

Query  423  ELLEKLGVPKLPAWAHRLANVGDAAKDV  506
               EKL VPKLP W +R AN GDAA DV
Sbjct  119  TFCEKLEVPKLPGWVNRFANAGDAALDV  146



>ref|XP_002869661.1| hypothetical protein ARALYDRAFT_914007 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45920.1| hypothetical protein ARALYDRAFT_914007 [Arabidopsis lyrata subsp. 
lyrata]
Length=259

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 108/151 (72%), Gaps = 3/151 (2%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG   +  N  +VQ+N+  KDGI LGG+FH A+Q+YG  EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSGS--EKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCE  58

Query  237  KG-SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKH  413
            +G +G+FSCP+ KNP YTYRE I  G+T C+   VN IL+EL  EWPG  Y L+S+N  H
Sbjct  59   QGGTGVFSCPSGKNPMYTYREKIVLGKTDCTIFLVNQILRELSREWPGHTYDLLSKNCNH  118

Query  414  FCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            FC  L ++LGVPK+P W +R A+ GD A +V
Sbjct  119  FCDVLCDRLGVPKIPGWVNRFAHAGDTALEV  149



>ref|XP_009382250.1| PREDICTED: deSI-like protein At4g17486 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=247

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 105/147 (71%), Gaps = 2/147 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LH+YD+T SG  ++  N  ++Q+N++ KD I LGG+FH A+Q++G+ EW++G  +
Sbjct  1    MKEVVLHVYDVTNSG--SEKTNNTILQINRVFKDRIGLGGIFHSAIQVFGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP  +NP YTYRE I  G T+CS  KVN +L+EL   WPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPPGRNPMYTYRERIVLGETNCSIFKVNQVLRELGQAWPGHSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C    E+LGVPK+P W +R AN GD A
Sbjct  119  CDSFCERLGVPKIPGWVNRFANAGDTA  145



>ref|XP_004966587.1| PREDICTED: uncharacterized protein LOC101773931 [Setaria italica]
Length=260

 Score =   180 bits (456),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 103/148 (70%), Gaps = 5/148 (3%)
 Frame = +3

Query  63   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  242
            EV+ H+YD+  +G  N      V+ +N+  KD I LGG+FH A+Q+YG+ EW++G+ ++G
Sbjct  4    EVVAHVYDVANAGTDN-----TVLHINRFFKDAIGLGGIFHTAIQVYGDEEWSFGYCERG  58

Query  243  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  422
            +G+FSCP  KNP YTYRESI  G+T+C   KVN IL+EL  EWPG  Y L+SRN  HFC 
Sbjct  59   TGVFSCPPCKNPMYTYRESIVLGKTNCCILKVNQILRELSWEWPGQSYELLSRNCNHFCN  118

Query  423  ELLEKLGVPKLPAWAHRLANVGDAAKDV  506
               EKL VPKLP W +R AN GDAA +V
Sbjct  119  TFCEKLEVPKLPGWVNRFANAGDAALEV  146



>ref|XP_009382251.1| PREDICTED: desumoylating isopeptidase 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=234

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 106/150 (71%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LH+YD+T SG  ++  N  ++Q+N++ KD I LGG+FH A+Q++G+ EW++G  +
Sbjct  1    MKEVVLHVYDVTNSG--SEKTNNTILQINRVFKDRIGLGGIFHSAIQVFGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP  +NP YTYRE I  G T+CS  KVN +L+EL   WPG  Y L+S+N  HF
Sbjct  59   QGSGVFSCPPGRNPMYTYRERIVLGETNCSIFKVNQVLRELGQAWPGHSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C    E+LGVPK+P W +R AN GD A  V
Sbjct  119  CDSFCERLGVPKIPGWVNRFANAGDTAMVV  148



>ref|XP_009411427.1| PREDICTED: uncharacterized protein LOC103993183 [Musa acuminata 
subsp. malaccensis]
Length=246

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 104/147 (71%), Gaps = 2/147 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG  ++  N  ++Q+N++ KD I LGG+FH A+Q+YG+ EW++G  +
Sbjct  1    MKEVVLHIYDVTNSG--SEKTNNTILQINRIFKDRIGLGGIFHSAIQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+FSCP  KNP YTYRE I  G T+CS  KVN IL+EL   WPG  Y L+++N  HF
Sbjct  59   QGSGVFSCPPGKNPMYTYREHIILGETNCSILKVNQILRELSQAWPGHSYDLLAKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C    E+LGV KLP W +R AN GD A
Sbjct  119  CDAFCERLGVQKLPGWVNRFANAGDTA  145



>ref|XP_010228135.1| PREDICTED: desumoylating isopeptidase 2-like isoform X2 [Brachypodium 
distachyon]
Length=203

 Score =   176 bits (447),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +3

Query  63   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  242
            EV+ H+YD+  SG   +     V+ +N++ KDGI LGG+FH A+Q+YG+ EW++G+ ++G
Sbjct  21   EVVAHVYDVACSGA--EGGGATVLHINRIFKDGIGLGGIFHTAIQVYGDEEWSFGYCEQG  78

Query  243  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  422
            SG+FSCP  KNP YT+RESI  G+T C+   VN IL+EL  EWPG  Y L+SRN  HFC 
Sbjct  79   SGVFSCPPCKNPMYTFRESIVLGKTSCTMFTVNQILRELSWEWPGGSYELLSRNCNHFCN  138

Query  423  ELLEKLGVPKLPAWAHRLANVGD  491
            E  +KL VPKLP W +R AN GD
Sbjct  139  EFCDKLDVPKLPGWVNRFANAGD  161



>ref|XP_009386602.1| PREDICTED: uncharacterized protein LOC103973689 [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   177 bits (449),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 102/150 (68%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+ H+YD+T SG  ++  N  ++ +N+  KDGI +GG+FH ++Q+YG+ EW++G  +
Sbjct  1    MMEVVAHVYDVTNSG--SEKANNTILHINRFFKDGIGVGGIFHSSIQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSC   KNP YTYRESI  G T CS   VN IL+EL  EW G  Y L SRN  HF
Sbjct  59   YGSGVFSCQPCKNPMYTYRESIVLGETTCSIFTVNQILRELSREWRGSSYDLFSRNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C    E L VPKLPAW +RLAN GDAA +V
Sbjct  119  CDAFCEMLDVPKLPAWVNRLANAGDAAMEV  148



>ref|XP_006279084.1| hypothetical protein CARUB_v10012715mg [Capsella rubella]
 gb|EOA11982.1| hypothetical protein CARUB_v10012715mg [Capsella rubella]
Length=803

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV+LHIYD+T SG  ++  N  +VQ+N+  KDGI LGG+FH A+Q+YG+ EW+YG+ +
Sbjct  1    MAEVVLHIYDVTNSG--SEKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGDDEWSYGYCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KN  YTYRE I  G+T C+   VN +L+ELR EWPG  Y L+S+N  HF
Sbjct  59   QGTGVFSCPSGKNSMYTYREKIVLGKTDCTIFMVNQMLRELRREWPGHTYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C  L ++LGVPK+P W +R AN GD A +V
Sbjct  119  CDILCDRLGVPKIPGWVNRFANAGDTALEV  148



>ref|XP_004496529.1| PREDICTED: deSI-like protein At4g17486-like [Cicer arietinum]
Length=230

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 106/150 (71%), Gaps = 3/150 (2%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M +V LH+YDLT    G++  N  +V +NK+ K+GI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MAKVTLHVYDLT---NGSEKTNSTIVHINKIFKNGIGLGGIFHSAVQVYGDDEWSFGFSE  57

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KN  +TYR S+  G+T+ +  KVN IL+EL  EWPG+ Y   S+N  HF
Sbjct  58   EGTGVFSCPSRKNAMFTYRRSLALGKTNYNIFKVNQILRELSKEWPGNSYDRFSKNCNHF  117

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E   +LGVPKLP W +R ANVGD A +V
Sbjct  118  CDEFCVRLGVPKLPGWVNRFANVGDIAMEV  147



>ref|XP_008376975.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103440069 
[Malus domestica]
Length=567

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 106/147 (72%), Gaps = 2/147 (1%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGS  245
            V+L IYD+T SG  +D  N  + Q+NK+ KDGI LGG+FH  +Q+Y E EW++G  ++GS
Sbjct  153  VVLXIYDVTNSG--SDKTNSTIPQINKIFKDGIGLGGIFHSXIQVYREDEWSFGFCEQGS  210

Query  246  GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQE  425
            G+FSCP+ KNP YTYRESI  G T CS  KVN IL+EL  EWPG  Y L+S+N  HF  E
Sbjct  211  GVFSCPSKKNPMYTYRESIVLGTTDCSIFKVNQILRELSREWPGYSYDLLSKNCNHFLDE  270

Query  426  LLEKLGVPKLPAWAHRLANVGDAAKDV  506
            L E+LGVPKLP W +R A+ GDAA +V
Sbjct  271  LCERLGVPKLPGWVNRFAHAGDAAMEV  297



>gb|EPS69052.1| hypothetical protein M569_05713, partial [Genlisea aurea]
Length=223

 Score =   175 bits (443),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 105/151 (70%), Gaps = 5/151 (3%)
 Frame = +3

Query  63   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQI-YGEVEWAYG--HR  233
            EV+LH+YD+T SG  N+  N  +VQ+NK+ KDGI LGG+FH AVQ+ YG+ EW++G   R
Sbjct  1    EVVLHVYDVTNSG--NEKTNNTIVQINKIFKDGIGLGGIFHSAVQVVYGDEEWSFGFCER  58

Query  234  DKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKH  413
              G+G+FSCP+ KNP YTYRESI  G T  S   VN IL+EL  EWPG  Y L+S+N  H
Sbjct  59   GSGTGVFSCPSKKNPMYTYRESIKLGETPFSIFNVNQILRELSREWPGCSYDLLSKNCNH  118

Query  414  FCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            FC E  E+L V K P W +R AN GDAA ++
Sbjct  119  FCDEFSERLAVSKPPGWINRFANAGDAAVEI  149



>ref|XP_003557265.2| PREDICTED: uncharacterized protein LOC100845322 isoform X1 [Brachypodium 
distachyon]
Length=285

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = +3

Query  63   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  242
            EV+ H+YD+  SG   +     V+ +N++ KDGI LGG+FH A+Q+YG+ EW++G+ ++G
Sbjct  21   EVVAHVYDVACSGA--EGGGATVLHINRIFKDGIGLGGIFHTAIQVYGDEEWSFGYCEQG  78

Query  243  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  422
            SG+FSCP  KNP YT+RESI  G+T C+   VN IL+EL  EWPG  Y L+SRN  HFC 
Sbjct  79   SGVFSCPPCKNPMYTFRESIVLGKTSCTMFTVNQILRELSWEWPGGSYELLSRNCNHFCN  138

Query  423  ELLEKLGVPKLPAWAHRLANVGD  491
            E  +KL VPKLP W +R AN GD
Sbjct  139  EFCDKLDVPKLPGWVNRFANAGD  161



>gb|KJB23839.1| hypothetical protein B456_004G117500 [Gossypium raimondii]
Length=282

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 106/162 (65%), Gaps = 17/162 (10%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EVILHIYD+T SG  +D  N  +V +NK+ KD I LGG+FH A+Q+YG+ EW++G  +
Sbjct  1    MAEVILHIYDVTNSG--SDKTNNTIVHINKIFKDRIGLGGIFHSAIQVYGDDEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+F CP+ KNP YTYRE +  GRT+ S  KVN IL EL  EWPG  Y L+S+N  HF
Sbjct  59   QGSGVFCCPSRKNPLYTYREFMVLGRTNSSVFKVNQILCELSREWPGTSYDLLSKNCNHF  118

Query  417  CQELLEKLGVPKLP---------------AWAHRLANVGDAA  497
            C EL E+LGV KLP                W +R AN GDAA
Sbjct  119  CDELCERLGVQKLPGCEARGNHILSFHLAGWVNRFANTGDAA  160



>ref|XP_008659380.1| PREDICTED: uncharacterized protein LOC103638177 [Zea mays]
 gb|AFW86207.1| hypothetical protein ZEAMMB73_029409 [Zea mays]
Length=268

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 104/148 (70%), Gaps = 5/148 (3%)
 Frame = +3

Query  63   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  242
            +V+ H+YD+  +G  +DT    V+ +N+  KD I LGG+FH A+Q+YG+ EW++G+ ++G
Sbjct  4    DVVAHVYDVATAG--SDTT---VLHINRFFKDAIGLGGIFHTAIQVYGDEEWSFGYCERG  58

Query  243  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  422
            +G+FSCP  KNP YTYRESI  G+T+C   KVN IL+EL  EWPG  Y L+SRN  HFC 
Sbjct  59   TGVFSCPPCKNPMYTYRESIVLGKTNCCILKVNQILRELSWEWPGHSYELLSRNCNHFCN  118

Query  423  ELLEKLGVPKLPAWAHRLANVGDAAKDV  506
               EKL V KLP W +R AN GDAA +V
Sbjct  119  TFCEKLEVSKLPGWVNRFANAGDAALEV  146



>ref|XP_003592207.1| PPPDE peptidase domain-containing protein [Medicago truncatula]
Length=218

 Score =   171 bits (434),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 104/150 (69%), Gaps = 3/150 (2%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M +V LH+YDLT    G++  N  VV +NK+ K+GI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MAKVTLHVYDLT---NGSEKTNNTVVHINKIFKNGIGLGGIFHGAVQVYGDDEWSFGSCE  57

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KN  YTYR+S+  G+T+ +   VN IL+EL  EWPG+ Y L S+N  HF
Sbjct  58   EGTGVFSCPSRKNARYTYRQSLVLGKTNYNIFMVNQILRELSKEWPGNSYDLFSKNCNHF  117

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E   +LGVP  P W +R ANVGD   +V
Sbjct  118  CDEFCARLGVPNPPGWVNRFANVGDITMEV  147



>gb|AES62458.2| PPPDE thiol peptidase family protein, putative [Medicago truncatula]
Length=230

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 104/150 (69%), Gaps = 3/150 (2%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M +V LH+YDLT    G++  N  VV +NK+ K+GI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MAKVTLHVYDLT---NGSEKTNNTVVHINKIFKNGIGLGGIFHGAVQVYGDDEWSFGSCE  57

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G+FSCP+ KN  YTYR+S+  G+T+ +   VN IL+EL  EWPG+ Y L S+N  HF
Sbjct  58   EGTGVFSCPSRKNARYTYRQSLVLGKTNYNIFMVNQILRELSKEWPGNSYDLFSKNCNHF  117

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C E   +LGVP  P W +R ANVGD   +V
Sbjct  118  CDEFCARLGVPNPPGWVNRFANVGDITMEV  147



>gb|EEE64952.1| hypothetical protein OsJ_19839 [Oryza sativa Japonica Group]
Length=273

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 103/152 (68%), Gaps = 1/152 (1%)
 Frame = +3

Query  54   KMTEVILHIYDLTMSGKGNDTVNYM-VVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  230
            ++ EV+ H+YD+  SG          ++ +N+  KD I LGG+FH A+Q+YG+ EW++G+
Sbjct  11   QVQEVVAHVYDVASSGSSEGGGGGTAILHVNRFFKDAIGLGGIFHTAIQVYGDEEWSFGY  70

Query  231  RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSK  410
             + G+G+FSCP  KNP YTYRESI  G+T CS   VN IL+EL  +WPG  Y L+SRN  
Sbjct  71   CENGTGVFSCPPCKNPMYTYRESIVLGKTTCSIFTVNQILRELSWKWPGGSYELLSRNCN  130

Query  411  HFCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            HFC    EKL VPKLPAW +R AN GDAA +V
Sbjct  131  HFCNTFCEKLDVPKLPAWVNRFANAGDAALEV  162



>gb|EEC79844.1| hypothetical protein OsI_21315 [Oryza sativa Indica Group]
Length=271

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 103/152 (68%), Gaps = 1/152 (1%)
 Frame = +3

Query  54   KMTEVILHIYDLTMSGKGNDTVNYM-VVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  230
            ++ EV+ H+YD+  SG          ++ +N+  KD I LGG+FH A+Q+YG+ EW++G+
Sbjct  9    QVQEVVAHVYDVASSGSSEGGGGGTAILHVNRFFKDAIGLGGIFHTAIQVYGDEEWSFGY  68

Query  231  RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSK  410
             + G+G+FSCP  KNP YTYRESI  G+T CS   VN IL+EL  +WPG  Y L+SRN  
Sbjct  69   CENGTGVFSCPPCKNPMYTYRESIVLGKTTCSIFTVNQILRELSWKWPGGSYELLSRNCN  128

Query  411  HFCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            HFC    EKL VPKLPAW +R AN GDAA +V
Sbjct  129  HFCNTFCEKLDVPKLPAWVNRFANAGDAALEV  160



>gb|EMT20329.1| hypothetical protein F775_52552 [Aegilops tauschii]
Length=285

 Score =   170 bits (431),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = +3

Query  129  VVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPA  308
            V+Q+N++ KDGI LGG+FH A+Q+YG  EW++G+ + GSG+FSCP  KNP YT+RESI  
Sbjct  39   VLQINRIFKDGIGLGGIFHTAIQVYGNEEWSFGYCENGSGVFSCPPAKNPMYTFRESIVL  98

Query  309  GRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            G+T CS   VN I +EL  EWPG  Y L+SRN  HFC E  +KLGVPKLP W +R+AN G
Sbjct  99   GKTSCSPRTVNQIARELSREWPGASYELLSRNCNHFCNEFCDKLGVPKLPGWVNRVANAG  158

Query  489  D  491
            D
Sbjct  159  D  159



>gb|EMS56568.1| hypothetical protein TRIUR3_04780 [Triticum urartu]
Length=482

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = +3

Query  63   EVILHIYDLTMSGKGNDTVNY-MVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDK  239
            E + H+YD+  SG          V+Q+N+L KDGI LGG+FH A+Q+YG  EW++G+ + 
Sbjct  25   EGVAHVYDVAGSGPDGAGGGGATVLQINRLFKDGIGLGGIFHTAIQVYGNEEWSFGYCEN  84

Query  240  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  419
            GSG+FSCP  KNP YT+RESI  G+T CS   VN I +EL  EWPG  Y L+SRN  HFC
Sbjct  85   GSGVFSCPPAKNPMYTFRESIVLGKTSCSPRTVNQIARELSREWPGASYELLSRNCNHFC  144

Query  420  QELLEKLGVPKLPAWAHRLANVGD  491
             E  +KLGVPKLP W +R AN GD
Sbjct  145  NEFCDKLGVPKLPGWVNRFANAGD  168



>ref|XP_008796906.1| PREDICTED: deSI-like protein sdu1 isoform X1 [Phoenix dactylifera]
Length=275

 Score =   168 bits (425),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 2/135 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M EV++HIYD+T SG  ++  N  ++Q+N++ KDGI LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MEEVVVHIYDVTNSG--SEKTNNTILQINRIFKDGIGLGGIFHSAVQVYGDEEWSFGFCE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+FSCP  +NP YTYRESI  G+T+CS   VN IL+EL   WPG  Y L+SRN  HF
Sbjct  59   YGSGVFSCPPRRNPMYTYRESIVLGKTNCSVFMVNQILRELSRAWPGSSYDLLSRNCNHF  118

Query  417  CQELLEKLGVPKLPA  461
            C    E LGVPKLP 
Sbjct  119  CDSFCELLGVPKLPG  133



>ref|XP_001784588.1| predicted protein [Physcomitrella patens]
 gb|EDQ50607.1| predicted protein, partial [Physcomitrella patens]
Length=197

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 103/148 (70%), Gaps = 3/148 (2%)
 Frame = +3

Query  63   EVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKG  242
            +VILH+YD+T S   N   N ++V +NK+++ GI LGG+FH AV++YG+ EW++G  + G
Sbjct  1    KVILHVYDVTNSA--NVRTNSVIVNLNKIMRGGIGLGGIFHGAVEVYGK-EWSFGFCENG  57

Query  243  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  422
            SG+FSC   KNP YTYRESIP G+T  + + V  +L+++  EWPG+ Y L+ RN  HFC 
Sbjct  58   SGVFSCSPKKNPMYTYRESIPLGKTVMAKADVQKVLRDISREWPGNRYDLLKRNCNHFCD  117

Query  423  ELLEKLGVPKLPAWAHRLANVGDAAKDV  506
             L  K+G  KLP W +R AN GDAA +V
Sbjct  118  ALCCKIGAQKLPLWVNRFANAGDAAIEV  145



>gb|EMS61224.1| hypothetical protein TRIUR3_07091 [Triticum urartu]
Length=280

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 105/185 (57%), Gaps = 40/185 (22%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQI------------  200
            M EV+LH+YD+T S   ++  N  ++Q+N++ KD I LGG+FH AVQ+            
Sbjct  1    MKEVVLHVYDVTNSD--SEKTNNTILQINRIFKDRIGLGGIFHSAVQVLHPAPPALPDPG  58

Query  201  --------------------------YGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESI  302
                                      YGE EW++G  + GSG+FSCP +KNP YTYRE I
Sbjct  59   DAFCLRAYPHLLQIPNSHFPMCRVQVYGEEEWSFGFCENGSGVFSCPVSKNPMYTYRERI  118

Query  303  PAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLAN  482
              G T C+ + VN IL+EL  +WPG  Y L+SRN  HFC  L ++LGVPKLP W +R AN
Sbjct  119  VLGETECTIATVNRILRELSRDWPGHSYDLLSRNCNHFCDVLCDRLGVPKLPGWVNRFAN  178

Query  483  VGDAA  497
             GD A
Sbjct  179  AGDTA  183



>ref|XP_001762496.1| predicted protein [Physcomitrella patens]
 gb|EDQ72619.1| predicted protein, partial [Physcomitrella patens]
Length=186

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 101/144 (70%), Gaps = 3/144 (2%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGS  245
            V LH+YD+T SG  N   N  ++ +NK+++ GI LGG+FH AV++ G+ EW++G+ + GS
Sbjct  1    VTLHVYDVTNSG--NVRTNNAIMNLNKIMRGGIGLGGIFHGAVEVDGK-EWSFGYCEIGS  57

Query  246  GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQE  425
            G+FSC  TKN  YTYRES+P G+T  + ++V  +L EL  +WPG+ Y L++RN  HFC+ 
Sbjct  58   GVFSCLPTKNQMYTYRESVPLGKTRKTRAEVQRVLDELSRDWPGNGYDLLARNCNHFCET  117

Query  426  LLEKLGVPKLPAWAHRLANVGDAA  497
               K+GV KLP W +R AN GDAA
Sbjct  118  FCAKIGVDKLPPWVNRFANAGDAA  141



>ref|XP_009385238.1| PREDICTED: uncharacterized protein LOC103972614 [Musa acuminata 
subsp. malaccensis]
Length=226

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 96/150 (64%), Gaps = 2/150 (1%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M  V+ H+YD+T S       N  V ++N + KD I LGG+FH A+Q+YG  EW++G+R+
Sbjct  1    MQAVVAHVYDVTNSPSAK--TNNTVTRINCIFKDCIGLGGIFHSAIQVYGAHEWSFGYRE  58

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG+F C   +N  YTYR+SI  G THCS  +VN IL+EL   W GD Y  +++N  HF
Sbjct  59   RGSGVFHCSPGQNQCYTYRQSIVLGETHCSQYEVNKILRELIRAWTGDSYDPLAKNCNHF  118

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
                 EKLGV KLP W +R AN G++A  +
Sbjct  119  SDAFCEKLGVRKLPGWVNRFANTGNSAMGI  148



>ref|XP_004987201.1| PREDICTED: deSI-like protein At4g17486-like [Setaria italica]
Length=260

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = +3

Query  36   STIFISKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVE  215
            S+   S   EV+LH+Y++T +G   +  +  +  +N+  KDGI +GG+FH AVQ+YGE E
Sbjct  23   SSASTSSGREVVLHVYEITKTGY--EKTDKTIRMINRFFKDGIGVGGIFHSAVQVYGEEE  80

Query  216  WAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLV  395
            W+YG R   +G+FSCP  +N  YTYRESI  G T  S+S+V  IL +L  EWPG  Y  +
Sbjct  81   WSYGFRYCDTGVFSCPVGQNSMYTYRESIVLGVTTFSNSEVKQILIQLSCEWPGFSYDFL  140

Query  396  SRNSKHFCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            SRN  HF  E  EKLG  K+P W +R AN G  A  V
Sbjct  141  SRNCNHFTNEFCEKLGARKIPGWVNRFANAGYTANVV  177



>ref|XP_002968463.1| hypothetical protein SELMODRAFT_16111, partial [Selaginella moellendorffii]
 ref|XP_002970638.1| hypothetical protein SELMODRAFT_16335, partial [Selaginella moellendorffii]
 gb|EFJ28768.1| hypothetical protein SELMODRAFT_16335, partial [Selaginella moellendorffii]
 gb|EFJ30717.1| hypothetical protein SELMODRAFT_16111, partial [Selaginella moellendorffii]
Length=174

 Score =   151 bits (381),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 101/151 (67%), Gaps = 7/151 (5%)
 Frame = +3

Query  57   MTEVILHIYDLT--MSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  230
            M+ V LH+YD+T  MS K N T+      +N+  +DGI +GG+FH AVQ++ E EW++G+
Sbjct  1    MSAVWLHVYDVTNSMSPKTNSTI----AGINRFFRDGIGIGGIFHGAVQVFEE-EWSFGY  55

Query  231  RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSK  410
             + GSG+F CP   NP YTYRE++  G T  S  KVN IL EL  EWPG  Y L++RN  
Sbjct  56   CENGSGVFGCPPKSNPMYTYRETVYIGNTPFSEEKVNQILLELSKEWPGYSYDLLARNCN  115

Query  411  HFCQELLEKLGVPKLPAWAHRLANVGDAAKD  503
            HFC EL  +L VPK+PAW +R AN GDAA D
Sbjct  116  HFCDELCVRLSVPKIPAWVNRFANAGDAAVD  146



>gb|KDO56773.1| hypothetical protein CISIN_1g025261mg [Citrus sinensis]
Length=252

 Score =   144 bits (362),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = +3

Query  159  GINLGGVFHVAV--QIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSS  332
            G+N  G+  ++   Q+YG+ EW++G  ++GSG+FSCP+ +NP YTYRESI  G+T+ S  
Sbjct  28   GLNCRGINSLSFTPQVYGDEEWSFGFCEQGSGVFSCPSGRNPMYTYRESIVLGKTNFSIF  87

Query  333  KVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            KVN IL+EL  EWPG+ Y L+ RN  HFC E  ++LGVPKLP W +R AN GDAA +V
Sbjct  88   KVNQILRELSREWPGNSYDLLGRNCNHFCDEFCDRLGVPKLPGWVNRFANAGDAAMEV  145



>ref|XP_006422021.1| hypothetical protein CICLE_v10005686mg [Citrus clementina]
 gb|ESR35261.1| hypothetical protein CICLE_v10005686mg [Citrus clementina]
Length=252

 Score =   144 bits (362),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 85/118 (72%), Gaps = 2/118 (2%)
 Frame = +3

Query  159  GINLGGVFHVAV--QIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSS  332
            G+N  G+  ++   Q+YG+ EW++G  ++GSG+FSCP+ +NP YTYRESI  G+T+ S  
Sbjct  28   GLNCRGINSLSFTPQVYGDEEWSFGFCEQGSGVFSCPSGRNPMYTYRESIVLGKTNFSIF  87

Query  333  KVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            KVN IL+EL  EWPG+ Y L+ RN  HFC E  ++LGVPKLP W +R AN GDAA +V
Sbjct  88   KVNQILRELSREWPGNSYDLLGRNCNHFCDEFCDRLGVPKLPGWVNRFANAGDAAMEV  145



>ref|XP_006490645.1| PREDICTED: uncharacterized protein LOC102607017 isoform X2 [Citrus 
sinensis]
Length=216

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +3

Query  195  QIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWP  374
            Q+YG+ EW++G  ++GSG+FSCP+ +NP YTYRESI  G+T+ S  KVN IL+EL  EWP
Sbjct  6    QVYGDEEWSFGFCEQGSGVFSCPSGRNPMYTYRESIVLGKTNFSIFKVNQILRELSREWP  65

Query  375  GDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            G+ Y L+ RN  HFC E  ++LGVPKLP W +R AN GDAA +V
Sbjct  66   GNSYDLLGRNCNHFCDEFCDRLGVPKLPGWVNRFANAGDAAMEV  109



>ref|XP_002513658.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49061.1| conserved hypothetical protein [Ricinus communis]
Length=244

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +3

Query  192  VQIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEW  371
            +Q+YGE EW++G  ++G+G+FSCP+ KNP YTYRESI  G+T+ S  KVN IL+EL  EW
Sbjct  1    MQVYGEDEWSFGFCEQGTGVFSCPSGKNPMYTYRESIVLGKTNFSIFKVNQILRELSREW  60

Query  372  PGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            PG  Y L+S+N  HFC E  E+LGVPKLP W +R AN GDAA +V
Sbjct  61   PGSAYDLLSKNCNHFCDEFCERLGVPKLPGWVNRFANAGDAALEV  105



>ref|XP_003535600.1| PREDICTED: deSI-like protein At4g17486-like [Glycine max]
 gb|KHN21780.1| UPF0326 protein [Glycine soja]
Length=240

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M +V+LHIYD+T    G+++    +V +N +L   I LGG+FH AVQ+YG+ EW++G  +
Sbjct  1    MVKVMLHIYDVT---NGSESKKRTIVGINNVLYGTIGLGGIFHSAVQVYGDDEWSFGFCE  57

Query  237  KG-SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKH  413
             G +G+F CPA KN  Y YR+S   G T+ +  +V  +L +L  EW GD Y  +S+N  H
Sbjct  58   GGDTGVFRCPAGKNTMYKYRKSFVLGDTNFNFFQVIEMLTQLSREWRGDSYDPLSKNCNH  117

Query  414  FCQELLEKLGVPKLPAWAHRLANVGDAAKD  503
            FC E   +LGV KLP W +R AN GD  ++
Sbjct  118  FCDEFCARLGVEKLPGWVNRFANAGDVTRE  147



>ref|XP_002509086.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO70344.1| predicted protein, partial [Micromonas sp. RCC299]
Length=145

 Score =   134 bits (336),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 91/146 (62%), Gaps = 3/146 (2%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M+ V LH+YD+T +    +  N  +  +N+  KD +  GG+FH AV++ G+ EW++G+ D
Sbjct  1    MSLVTLHVYDITNTQY--EAANASIQGLNRFTKDILGAGGIFHGAVEVNGD-EWSFGYCD  57

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG++ C    N  YTYRESIP G T  S ++V  IL  L+  W G EY L++RN  HF
Sbjct  58   RGSGVYCCRPRGNTGYTYRESIPLGVTALSPARVRNILGALQAAWQGHEYDLLARNCNHF  117

Query  417  CQELLEKLGVPKLPAWAHRLANVGDA  494
            C+   E LGV  LPAW +R A+  DA
Sbjct  118  CEAFAEMLGVGSLPAWVNRFASQADA  143



>ref|XP_001764813.1| predicted protein [Physcomitrella patens]
 gb|EDQ70512.1| predicted protein, partial [Physcomitrella patens]
Length=192

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 94/147 (64%), Gaps = 3/147 (2%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M  V LH+YD+T S   +D  N  +  +N++++ GI +GG+FH AV++YG+ EW++G+ +
Sbjct  1    MAVVTLHVYDVTNSI--SDGANKAISSLNRIMRGGIGIGGIFHGAVEVYGK-EWSFGYCE  57

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
             GSG+F C   +NP Y YRES+  G T  S   V+  L EL  EW G  Y L++RN  HF
Sbjct  58   SGSGVFPCTPMRNPMYNYRESLTLGSTDLSRLSVDTALLELSREWQGASYDLLARNCNHF  117

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C    E+LGV K+P W +R AN GDAA
Sbjct  118  CDAFCERLGVDKVPPWVNRFANAGDAA  144



>ref|XP_003061681.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH54311.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=173

 Score =   132 bits (331),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 91/146 (62%), Gaps = 3/146 (2%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M+ V LH+YD+T +    +T N ++  +N+  KD +  GG+FH AV++ G+ EW+YG  +
Sbjct  1    MSLVTLHVYDITNTTY--ETANNVIQGLNRFTKDALGAGGIFHGAVEVNGD-EWSYGFCE  57

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG++ C    N  YTYRES+P G T  S ++V  ++  L+ +WPG EY L+ +N  HF
Sbjct  58   RGSGVYCCHPRGNTGYTYRESVPLGVTSLSPARVRSVIAVLQAQWPGCEYDLLGKNCNHF  117

Query  417  CQELLEKLGVPKLPAWAHRLANVGDA  494
            C+     LGVP  PAW +R A   +A
Sbjct  118  CEAFGAMLGVPGPPAWVNRFATQAEA  143



>gb|KCW46466.1| hypothetical protein EUGRSUZ_K002931, partial [Eucalyptus grandis]
Length=204

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +3

Query  198  IYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPG  377
            +YG+ EW++G  ++G+G+FSCP+ KNP YTYRE +  G T+ S  KVN IL+EL  EWPG
Sbjct  1    VYGDDEWSFGFCEQGTGVFSCPSAKNPMYTYRERVVLGSTNFSIFKVNQILRELSREWPG  60

Query  378  DEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
              Y L+SRN  HFC E  E+LGV KLP W +R AN GD A +V
Sbjct  61   HAYDLLSRNCNHFCDEFCERLGVQKLPGWVNRFANAGDTAVEV  103



>ref|XP_009621011.1| PREDICTED: uncharacterized protein LOC104112711, partial [Nicotiana 
tomentosiformis]
Length=215

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = +3

Query  192  VQIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEW  371
             Q+YG+ EW++G  ++G+G+FSCPA KNP YTYRE I  G T+    +VN IL+EL  EW
Sbjct  13   TQVYGDDEWSFGFCEQGTGVFSCPAGKNPMYTYRECIVLGTTNHQIFEVNQILRELSREW  72

Query  372  PGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            PG  Y L+++N  HFC E  E+LGV KLP W +R A+ GDAA ++
Sbjct  73   PGHSYDLLAKNCNHFCDEFCERLGVQKLPGWVNRFAHAGDAAVEI  117



>emb|CDY54090.1| BnaC08g47300D, partial [Brassica napus]
Length=779

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 91/148 (61%), Gaps = 5/148 (3%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHR-  233
            M EV++HIY+ T SG   D  +   +        G+    VFH A+Q+YG+ EW+YG+  
Sbjct  1    MREVVVHIYEATNSGSEIDRFHKDGIGPIGGGGGGV----VFHSAIQVYGDDEWSYGYYC  56

Query  234  DKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKH  413
            ++ S +FSCP+TKNP YTYRE I  G+T C+   V+ IL++L  EW    Y L S+N  H
Sbjct  57   EQASRVFSCPSTKNPMYTYREKIILGKTDCTIFTVDQILRDLTTEWSEYTYDLFSKNCNH  116

Query  414  FCQELLEKLGVPKLPAWAHRLANVGDAA  497
            FC  L  +LGVPKLP W +R A+ GD A
Sbjct  117  FCDVLCHRLGVPKLPGWVNRFAHAGDTA  144



>gb|KCW46465.1| hypothetical protein EUGRSUZ_K002931, partial [Eucalyptus grandis]
Length=206

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 73/105 (70%), Gaps = 2/105 (2%)
 Frame = +3

Query  198  IYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPG  377
            +YG+ EW++G  ++G+G+FSCP+ KNP YTYRE +  G T+ S  KVN IL+EL  EWPG
Sbjct  1    VYGDDEWSFGFCEQGTGVFSCPSAKNPMYTYRERVVLGSTNFSIFKVNQILRELSREWPG  60

Query  378  DEYSLVSRNSKHFCQELLEKLGVPKLPA--WAHRLANVGDAAKDV  506
              Y L+SRN  HFC E  E+LGV KLP   W +R AN GD A +V
Sbjct  61   HAYDLLSRNCNHFCDEFCERLGVQKLPGECWVNRFANAGDTAVEV  105



>emb|CDY52367.1| BnaA08g31020D, partial [Brassica napus]
Length=779

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 95/152 (63%), Gaps = 13/152 (9%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGV----FHVAVQIYGEVEWAY  224
            M EV++HIYD T SG  ++ ++      N+  KDGI         FH A+Q+YG+ EW++
Sbjct  1    MREVVVHIYDATNSG--SEEID------NRFHKDGIGPIVGGGGVFHSAIQVYGDDEWSF  52

Query  225  GHR-DKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSR  401
            G+  ++ S +FSCP+TKNP YTYRE I  G+T CS   V+ IL++L  EW    Y   S+
Sbjct  53   GYYCEQASRVFSCPSTKNPMYTYREKIILGKTDCSIFTVDQILRDLTREWSEYTYDSFSK  112

Query  402  NSKHFCQELLEKLGVPKLPAWAHRLANVGDAA  497
            N  HFC  L ++LGVPKLP W +R A+ GD A
Sbjct  113  NCNHFCDVLCDRLGVPKLPGWVNRFAHAGDTA  144



>ref|XP_009109196.1| PREDICTED: uncharacterized protein LOC103834861 isoform X1 [Brassica 
rapa]
Length=1024

 Score =   128 bits (322),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 67/148 (45%), Positives = 93/148 (63%), Gaps = 3/148 (2%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHR-  233
            M EV++HIYD T SG  ++ ++    +       G   GGVFH A+Q+YG+ EW++G+  
Sbjct  1    MREVVVHIYDATNSG--SEEIDNRFHKDGIGPIVGGGGGGVFHSAIQVYGDDEWSFGYYC  58

Query  234  DKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKH  413
            ++ S +FSCP+TKNP YTYRE I  G+T CS    + IL++L  EW    Y   S+N  H
Sbjct  59   EQASRVFSCPSTKNPMYTYREKIILGKTDCSIFTFDQILRDLTREWSEYTYDSFSKNCNH  118

Query  414  FCQELLEKLGVPKLPAWAHRLANVGDAA  497
            FC  L ++LGVPKLP W +R A+ GD A
Sbjct  119  FCDVLCDRLGVPKLPGWVNRFAHAGDTA  146



>emb|CEF99575.1| PPPDE putative peptidase domain [Ostreococcus tauri]
Length=217

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 85/150 (57%), Gaps = 3/150 (2%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M  V L +YD+     GN+ V   V  +N L +DG+ LGG+FH  V++YG+ EW++G+ D
Sbjct  1    MALVTLSVYDIKH--PGNEGVTSAVASLNALTRDGLRLGGIFHGGVEVYGD-EWSFGYID  57

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G++ C   KNP Y YRES+  G T  S ++V+  +  L+  W G  Y  + RN  HF
Sbjct  58   RGTGVYRCQPKKNPMYAYRESVALGVTSLSPARVSAAVAALKAAWDGPSYDALGRNCNHF  117

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C+ L E LG    P W +  AN     +D 
Sbjct  118  CEALCEALGCEGPPKWLNSFANNARGVRDA  147



>ref|XP_007509551.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19354.1| predicted protein [Bathycoccus prasinos]
Length=244

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 86/147 (59%), Gaps = 3/147 (2%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M  V L++YD+T +    D  N  +  +N L KD  N GG+FH  ++++G  E++YG+ +
Sbjct  1    MALVTLNVYDITNTKS--DLTNATIQHLNTLTKDTFNAGGIFHGGIEVHG-YEYSYGYCE  57

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G++ C    N  Y +RESIP G T   ++KV  I+  ++  WPG+EY L S+N   F
Sbjct  58   EGTGVYPCQPKMNSAYVFRESIPLGVTSADATKVRAIVAVMKASWPGNEYELFSKNCNTF  117

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAA  497
            C+   + LGVP  P W +R A   + A
Sbjct  118  CEAFTKALGVPPPPDWLNRFATNANGA  144



>ref|XP_003081907.1| putative protein (ISS), partial [Ostreococcus tauri]
Length=429

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 85/150 (57%), Gaps = 3/150 (2%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M  V L +YD+     GN+ V   V  +N L +DG+ LGG+FH  V++YG+ EW++G+ D
Sbjct  213  MALVTLSVYDIKH--PGNEGVTSAVASLNALTRDGLRLGGIFHGGVEVYGD-EWSFGYID  269

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +G+G++ C   KNP Y YRES+  G T  S ++V+  +  L+  W G  Y  + RN  HF
Sbjct  270  RGTGVYRCQPKKNPMYAYRESVALGVTSLSPARVSAAVAALKAAWDGPSYDALGRNCNHF  329

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C+ L E LG    P W +  AN     +D 
Sbjct  330  CEALCEALGCEGPPKWLNSFANNARGVRDA  359



>ref|XP_001701830.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06805.1| predicted protein [Chlamydomonas reinhardtii]
Length=457

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 91/143 (64%), Gaps = 4/143 (3%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGS  245
            V+L++YD+T +   N+  N  + ++N + ++ +++GGVFH A+++  +VEW++G+ + G+
Sbjct  5    VLLNVYDVTNTA--NENTNSFIQRLNSITRE-LSIGGVFHGAIEV-DDVEWSFGYCESGT  60

Query  246  GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQE  425
            G++ C A +N  Y +RE++  G T  S  ++  I+  L+  W G  Y L+ RN  HFC++
Sbjct  61   GVYCCRARQNTMYNFRETLELGVTEKSKQEIKEIVARLKRAWAGTSYDLLQRNCCHFCEQ  120

Query  426  LLEKLGVPKLPAWAHRLANVGDA  494
            L  +LGVP  PAW +R A   DA
Sbjct  121  LCAELGVPPPPAWLNRFAQGADA  143



>ref|XP_001420272.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98565.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=175

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 81/136 (60%), Gaps = 3/136 (2%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD  236
            M  V L +YD+  +   N  ++  V  +N L ++ +N+GG+FH  V+++G+ EW++G+  
Sbjct  1    MALVTLSVYDIKHAE--NARISSAVTSLNTLTRNALNVGGIFHGGVEVFGD-EWSFGYCP  57

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
            +GSG++ C    NP Y YRES+P G T  S ++ +  +  LR +W G +Y ++ RN  HF
Sbjct  58   EGSGVYRCNPRMNPMYEYRESVPLGVTSLSPARASAAVAALRAQWRGSDYEVLERNCNHF  117

Query  417  CQELLEKLGVPKLPAW  464
            C+ L E LG    P W
Sbjct  118  CEALCEALGCEGPPEW  133



>gb|KDO56774.1| hypothetical protein CISIN_1g025261mg [Citrus sinensis]
 gb|KDO56775.1| hypothetical protein CISIN_1g025261mg [Citrus sinensis]
 gb|KDO56776.1| hypothetical protein CISIN_1g025261mg [Citrus sinensis]
Length=183

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +3

Query  282  YTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  461
            YTYRESI  G+T+ S  KVN IL+EL  EWPG+ Y L+ RN  HFC E  ++LGVPKLP 
Sbjct  2    YTYRESIVLGKTNFSIFKVNQILRELSREWPGNSYDLLGRNCNHFCDEFCDRLGVPKLPG  61

Query  462  WAHRLANVGDAAKDV  506
            W +R AN GDAA +V
Sbjct  62   WVNRFANAGDAAMEV  76



>gb|ACU22856.1| unknown [Glycine max]
Length=176

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +3

Query  282  YTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  461
            YTYRESI  G+T+ S  K+N IL+EL  EWPG  Y L+S+N  HFC E  E+LGVPKLP 
Sbjct  2    YTYRESIVLGKTNFSIFKLNQILRELSREWPGSSYDLLSKNCNHFCDEFCERLGVPKLPG  61

Query  462  WAHRLANVGDAAKDV  506
            W +R AN GD A +V
Sbjct  62   WVNRFANAGDTAMEV  76



>ref|NP_001056566.2| Os06g0107000 [Oryza sativa Japonica Group]
 dbj|BAD67713.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18480.2| Os06g0107000 [Oryza sativa Japonica Group]
Length=187

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +3

Query  282  YTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  461
            YTYRESI  G+T CS   VN IL+EL  +WPG  Y L+SRN  HFC    EKL VPKLPA
Sbjct  2    YTYRESIVLGKTTCSIFTVNQILRELSWKWPGGSYELLSRNCNHFCNTFCEKLDVPKLPA  61

Query  462  WAHRLANVGDAAKDV  506
            W +R AN GDAA +V
Sbjct  62   WVNRFANAGDAALEV  76



>ref|XP_006655688.1| PREDICTED: uncharacterized protein LOC102722125 isoform X1 [Oryza 
brachyantha]
Length=193

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +3

Query  282  YTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  461
            YTYRESI  G+T CS   VN IL+EL  +WPG  Y L+SRN  HFC    EKL VPKLPA
Sbjct  2    YTYRESIVLGKTSCSIFTVNQILQELSWKWPGGSYELLSRNCNHFCNAFCEKLEVPKLPA  61

Query  462  WAHRLANVGDAAKDV  506
            W +R AN GDAA +V
Sbjct  62   WVNRFANAGDAALEV  76



>gb|ACJ85321.1| unknown [Medicago truncatula]
 gb|AFK35321.1| unknown [Medicago truncatula]
Length=200

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +3

Query  282  YTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPA  461
            YTYRESI  G+T+    KVN I++EL  EWPG  Y L+S+N  HFC E  E+L VPKLP 
Sbjct  2    YTYRESIVLGKTNFPIFKVNQIIRELSREWPGTAYDLLSKNCNHFCDEFCERLDVPKLPG  61

Query  462  WAHRLANVGDAAKDV  506
            W +R AN GD A +V
Sbjct  62   WVNRFANAGDTAMEV  76



>gb|AFW85568.1| hypothetical protein ZEAMMB73_042236 [Zea mays]
Length=223

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 80/150 (53%), Gaps = 19/150 (13%)
 Frame = +3

Query  51   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYG-  227
            S  + V L++YD+T +   N    ++ +             GV+H  VQ++G VE+AYG 
Sbjct  27   SSSSPVFLNVYDVTPA---NGYARWLGL-------------GVYHSGVQVHG-VEYAYGA  69

Query  228  HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  407
            H    SGIF     + P Y +RES+  G T  S  +V  ++ EL  E+PGD Y+LVSRN 
Sbjct  70   HDGASSGIFEVVPRRCPGYAFRESVAVGATELSRGEVRALMAELAAEFPGDAYNLVSRNC  129

Query  408  KHFCQELLEKL-GVPKLPAWAHRLANVGDA  494
             HFC     +L    ++P W +RLA +G A
Sbjct  130  NHFCDAACRRLVARARIPRWVNRLAKIGVA  159



>gb|EEC80134.1| hypothetical protein OsI_21921 [Oryza sativa Indica Group]
Length=268

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+AYG H   GSGIF     + P Y +RE+I  G T  + ++V  ++
Sbjct  72   GVYHSGVQVHG-VEYAYGAHDGAGSGIFEVAPRRCPGYAFREAILVGTTELTRAEVRAVM  130

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
             +L  ++PGD Y+LVSRN  HFC     +L   ++P W +RLA +G
Sbjct  131  ADLAADFPGDAYNLVSRNCNHFCDAACRRLVRARIPRWVNRLAKIG  176



>ref|XP_008659205.1| PREDICTED: deSI-like protein At4g17486 [Zea mays]
Length=234

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 80/150 (53%), Gaps = 19/150 (13%)
 Frame = +3

Query  51   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYG-  227
            S  + V L++YD+T +   N    ++ +             GV+H  VQ++G VE+AYG 
Sbjct  27   SSSSPVFLNVYDVTPA---NGYARWLGL-------------GVYHSGVQVHG-VEYAYGA  69

Query  228  HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  407
            H    SGIF     + P Y +RES+  G T  S  +V  ++ EL  E+PGD Y+LVSRN 
Sbjct  70   HDGASSGIFEVVPRRCPGYAFRESVAVGATELSRGEVRALMAELAAEFPGDAYNLVSRNC  129

Query  408  KHFCQELLEKL-GVPKLPAWAHRLANVGDA  494
             HFC     +L    ++P W +RLA +G A
Sbjct  130  NHFCDAACRRLVARARIPRWVNRLAKIGVA  159



>emb|CDY62507.1| BnaC04g56370D [Brassica napus]
Length=241

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 85/148 (57%), Gaps = 20/148 (14%)
 Frame = +3

Query  51   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG  227
            + +  V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G
Sbjct  15   TALLPVYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFG  56

Query  228  -HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRN  404
             H    +GIF     K P +T+R+SI  G+T  ++ +V + +++L +E+ G++Y+L+SRN
Sbjct  57   AHEAPSTGIFEVEPKKCPGFTFRKSILVGKTDMAAKEVRVFMEKLAEEYRGNKYNLISRN  116

Query  405  SKHFCQELLEKLGVPKLPAWAHRLANVG  488
              HFC E+  KL    +P W +RLA +G
Sbjct  117  CNHFCNEVCVKLTQKPIPRWVNRLARLG  144



>emb|CDY35370.1| BnaA04g14770D [Brassica napus]
Length=246

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 84/146 (58%), Gaps = 20/146 (14%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-H  230
            +  V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H
Sbjct  17   LLPVYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAH  58

Query  231  RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSK  410
                +GIF     K P +T+R+SI  G+T  ++ +V + +++L +E+ G++Y+L+SRN  
Sbjct  59   EAPSTGIFEVEPKKCPGFTFRKSILVGKTDMAAKEVRVFMEKLAEEYRGNKYNLISRNCN  118

Query  411  HFCQELLEKLGVPKLPAWAHRLANVG  488
            HFC E+  KL    +P W +RLA +G
Sbjct  119  HFCNEVCVKLTQKPIPRWVNRLARLG  144



>ref|XP_009140629.1| PREDICTED: deSI-like protein At4g17486 [Brassica rapa]
Length=249

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 84/146 (58%), Gaps = 20/146 (14%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-H  230
            +  V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H
Sbjct  17   LLPVYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAH  58

Query  231  RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSK  410
                +GIF     K P +T+R+SI  G+T  ++ +V + +++L +E+ G++Y+L+SRN  
Sbjct  59   EAPSTGIFEVEPKKCPGFTFRKSILVGKTDMAAKEVRVFMEKLAEEYRGNKYNLISRNCN  118

Query  411  HFCQELLEKLGVPKLPAWAHRLANVG  488
            HFC E+  KL    +P W +RLA +G
Sbjct  119  HFCNEVCVKLTQKPIPRWVNRLARLG  144



>ref|NP_565588.1| PPPDE putative thiol peptidase-like protein [Arabidopsis thaliana]
 gb|AAK43853.1|AF370476_1 Unknown protein [Arabidopsis thaliana]
 gb|AAD23672.1| expressed protein [Arabidopsis thaliana]
 gb|AAM10253.1| unknown protein [Arabidopsis thaliana]
 gb|AAM62471.1| unknown [Arabidopsis thaliana]
 gb|AEC07669.1| PPPDE putative thiol peptidase-like protein [Arabidopsis thaliana]
Length=240

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 81/143 (57%), Gaps = 20/143 (14%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  239
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHESS  60

Query  240  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  419
             +GIF     K P +T+R+SI  G+T   + +V + +++L +E+ G++Y L++RN  HFC
Sbjct  61   STGIFEVEPKKCPGFTFRKSILVGKTDLVAKEVRVFMEKLAEEYQGNKYHLITRNCNHFC  120

Query  420  QELLEKLGVPKLPAWAHRLANVG  488
             E+  KL    +P W +RLA +G
Sbjct  121  NEVCLKLAQKSIPRWVNRLARLG  143



>gb|KFK32585.1| hypothetical protein AALP_AA6G262400 [Arabis alpina]
Length=240

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 81/143 (57%), Gaps = 20/143 (14%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  239
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHESS  60

Query  240  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  419
             +GIF     K P +T+R+SI  G+T  S+ +V + +++L +E+ G++Y L+ RN  HFC
Sbjct  61   STGIFEVEPKKCPGFTFRKSILVGKTDSSAKEVRVFMEKLAEEYKGNKYHLIRRNCNHFC  120

Query  420  QELLEKLGVPKLPAWAHRLANVG  488
             E+  KL    +P W +RLA +G
Sbjct  121  NEVCLKLTQNPIPRWVNRLARLG  143



>ref|XP_002878832.1| hypothetical protein ARALYDRAFT_481377 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55091.1| hypothetical protein ARALYDRAFT_481377 [Arabidopsis lyrata subsp. 
lyrata]
Length=241

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 81/143 (57%), Gaps = 20/143 (14%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  239
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHESS  60

Query  240  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  419
             +GIF     K P +T+R+SI  G+T   + +V + +++L +E+ G++Y L++RN  HFC
Sbjct  61   STGIFEVEPKKCPGFTFRKSILVGKTDLVAKEVRVFMEKLAEEYQGNKYHLITRNCNHFC  120

Query  420  QELLEKLGVPKLPAWAHRLANVG  488
             E+  KL    +P W +RLA +G
Sbjct  121  NEVCLKLTQKSIPRWVNRLARLG  143



>ref|XP_003560998.1| PREDICTED: deSI-like protein At4g17486 [Brachypodium distachyon]
Length=254

 Score = 90.5 bits (223),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+AYG H   GSGIF     + P Y +RES+  G T  + ++V  ++
Sbjct  66   GVYHSGVQVHG-VEYAYGAHEGNGSGIFEVLPRRCPGYAFRESVLVGTTELTRAQVRAVM  124

Query  351  K-ELRDEWPGDEYSLVSRNSKHFCQELLEKL-GVPKLPAWAHRLANVG  488
              EL  E+PGD Y+LVSRN  HFC     +L    ++P W +RLA +G
Sbjct  125  AGELAAEFPGDAYNLVSRNCNHFCDAACRRLVAQARIPRWVNRLAKIG  172



>ref|XP_002782648.1| hypothetical protein Pmar_PMAR021197 [Perkinsus marinus ATCC 
50983]
 gb|EER14443.1| hypothetical protein Pmar_PMAR021197 [Perkinsus marinus ATCC 
50983]
Length=463

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 64/104 (62%), Gaps = 4/104 (4%)
 Frame = +3

Query  138  MNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGSGIFSCPATKN-PNY--TYRESIPA  308
            +N +L + + +GG FH AV++YG VEW+YG+   G G+F+ P T + P    TYRE +P 
Sbjct  112  VNTVLSEVVGVGGAFHAAVEVYG-VEWSYGYCQYGCGVFAVPPTSSEPGSIGTYRECLPV  170

Query  309  GRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKL  440
             R     ++V  IL+EL+ +WPG  Y L+ RN  HFC   L KL
Sbjct  171  ERCRLPVTEVIQILEELKGDWPGSSYDLLHRNCTHFCDVFLRKL  214



>ref|XP_006405117.1| hypothetical protein EUTSA_v10000310mg [Eutrema salsugineum]
 gb|ESQ46570.1| hypothetical protein EUTSA_v10000310mg [Eutrema salsugineum]
Length=236

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 69/106 (65%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GVFH  V+I+G VE+A+G H    +GIF     K P +T+R+SI  G+T   + +V + +
Sbjct  39   GVFHSGVEIHG-VEYAFGAHESSSTGIFEVEPKKCPGFTFRKSILVGQTDMGAKEVRVYM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G++Y L++RN  HFC E+  KL   ++P W +RLA +G
Sbjct  98   EKLAEEYQGNKYHLITRNCNHFCNEVCIKLTQKQIPRWVNRLARLG  143



>ref|XP_009117078.1| PREDICTED: deSI-like protein At4g17486 [Brassica rapa]
Length=240

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 81/143 (57%), Gaps = 20/143 (14%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  239
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHEYP  60

Query  240  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  419
             +GIF     K P +T+R+SI  G+T   +  V + +++L +E+ G++Y+L+SRN  HFC
Sbjct  61   STGIFEVEPKKCPGFTFRKSILVGKTDTCARDVRVYMEKLAEEYRGNKYNLISRNCNHFC  120

Query  420  QELLEKLGVPKLPAWAHRLANVG  488
             E+  KL    LP W +RLA +G
Sbjct  121  NEVCVKLTQKPLPRWVNRLARLG  143



>ref|XP_010472522.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
Length=240

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 81/143 (57%), Gaps = 20/143 (14%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  239
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHESS  60

Query  240  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  419
             +GIF     K P +T+R+SI  G+T   + +V + +++L +E+ G++Y L++RN  HFC
Sbjct  61   NTGIFEVEPKKCPGFTFRKSILVGKTDLVAKEVRVYMEKLAEEYQGNKYHLITRNCNHFC  120

Query  420  QELLEKLGVPKLPAWAHRLANVG  488
             E+  KL    +P W +RLA +G
Sbjct  121  NEVCVKLTQKSIPRWVNRLARLG  143



>ref|XP_006294896.1| hypothetical protein CARUB_v10023946mg [Capsella rubella]
 gb|EOA27794.1| hypothetical protein CARUB_v10023946mg [Capsella rubella]
Length=241

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 81/143 (57%), Gaps = 20/143 (14%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  239
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHESS  60

Query  240  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  419
             +GIF     K P +T+R+SI  G+T   + +V + +++L +E+ G++Y L++RN  HFC
Sbjct  61   STGIFEVEPKKCPGFTFRKSILVGKTDLVAKEVRVYMEKLAEEYQGNKYHLITRNCNHFC  120

Query  420  QELLEKLGVPKLPAWAHRLANVG  488
             E+  KL    +P W +RLA +G
Sbjct  121  NEVCIKLTQKSIPRWVNRLARLG  143



>ref|XP_010417284.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
Length=236

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 80/143 (56%), Gaps = 20/143 (14%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  239
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHESS  60

Query  240  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  419
             +GIF     K P +T+R+SI  G+T   + +V + +++L  E+ G++Y L++RN  HFC
Sbjct  61   NTGIFEVEPKKCPGFTFRKSILVGKTDLVAKEVRVYMEKLAQEYQGNKYHLITRNCNHFC  120

Query  420  QELLEKLGVPKLPAWAHRLANVG  488
             E+  KL    +P W +RLA +G
Sbjct  121  NEVCVKLTQKSIPRWVNRLARLG  143



>emb|CDX76766.1| BnaC08g33520D [Brassica napus]
Length=236

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 81/143 (57%), Gaps = 20/143 (14%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  239
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHEYP  60

Query  240  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  419
             +GIF     K P +T+R+SI  G+T   +  V + +++L +E+ G++Y+L+SRN  HFC
Sbjct  61   STGIFEVEPKKCPGFTFRKSILVGKTDKCARDVRVYMEKLAEEYRGNKYNLISRNCNHFC  120

Query  420  QELLEKLGVPKLPAWAHRLANVG  488
             E+  KL    +P W +RLA +G
Sbjct  121  NEVCVKLTQKPIPRWVNRLARLG  143



>ref|XP_010429510.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
Length=240

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 80/143 (56%), Gaps = 20/143 (14%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  239
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHESS  60

Query  240  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  419
             +GIF     K P +T+R+SI  G+T   + +V + +++L  E+ G++Y L++RN  HFC
Sbjct  61   NTGIFEVEPKKCPGFTFRKSILVGKTDLVAKEVRVYMEKLAQEYQGNKYHLITRNCNHFC  120

Query  420  QELLEKLGVPKLPAWAHRLANVG  488
             E+  KL    +P W +RLA +G
Sbjct  121  NEVCVKLTQKSIPRWVNRLARLG  143



>ref|XP_009039394.1| hypothetical protein AURANDRAFT_7483, partial [Aureococcus anophagefferens]
 gb|EGB05850.1| hypothetical protein AURANDRAFT_7483 [Aureococcus anophagefferens]
Length=105

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYGH-RDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GVFH A+++YG+ E+++G  R   SGIF+C     P +TYRESI  G    +  +V  IL
Sbjct  1    GVFHGAIEVYGQ-EFSFGGCRQNKSGIFACKPKSCPMHTYRESIYLGDCKKTIKEVQSIL  59

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
              ++ EW G  Y+L+ +N   F     +KLGV ++P W H LA+VG
Sbjct  60   DSMKPEWMGPTYNLLRKNCCSFSNAFAQKLGVGEIPNWVHHLADVG  105



>emb|CDY56277.1| BnaA09g55810D [Brassica napus]
Length=548

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 81/143 (57%), Gaps = 20/143 (14%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  239
            V L++YDLT               MN     G  LG GVFH  V+++G VE+A+G H   
Sbjct  19   VYLNVYDLT--------------PMNAY---GYWLGLGVFHSGVEVHG-VEYAFGAHEYP  60

Query  240  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  419
             +GIF     K P +T+R+SI  G+T   +  V + +++L +E+ G++Y+L+SRN  HFC
Sbjct  61   STGIFEVEPKKCPGFTFRKSILVGKTDTCARDVRVYMEKLAEEYRGNKYNLISRNCNHFC  120

Query  420  QELLEKLGVPKLPAWAHRLANVG  488
             E+  KL    +P W +RLA +G
Sbjct  121  NEVCVKLTQKPIPRWVNRLARLG  143



>ref|XP_009383188.1| PREDICTED: deSI-like protein At4g17486 [Musa acuminata subsp. 
malaccensis]
Length=236

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ +G VE+AYG H    +GIF     + P +T+R+SI  GRT     +V  ++
Sbjct  38   GVYHSGVQAHG-VEYAYGAHEHPTTGIFEGEPRQCPGFTFRKSILIGRTDLGPREVRALM  96

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            +E+  E+ GD Y+LVS+N  HFC E   +L    +P W +RLA +G
Sbjct  97   EEMAAEYTGDTYNLVSKNCNHFCDEACLRLTGKPIPKWVNRLAKIG  142



>emb|CDJ26229.1| hypothetical protein [Brassica oleracea]
Length=229

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 79/143 (55%), Gaps = 20/143 (14%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLG-GVFHVAVQIYGEVEWAYG-HRDK  239
            V L++YDLT        +N+           G  LG G++H  ++++G VE+ YG H   
Sbjct  21   VYLNVYDLT-------PMNFY----------GYWLGIGIYHSGLEVHG-VEYGYGAHEHS  62

Query  240  GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFC  419
             +GIF     K P +T+R+SI  G T   + +V   ++EL DE+ G +Y L++RN  HFC
Sbjct  63   STGIFKVEPKKCPGFTFRKSILVGETEMKAKEVGSFMEELADEYQGSKYHLITRNCNHFC  122

Query  420  QELLEKLGVPKLPAWAHRLANVG  488
             ++  KL    +P+W +RLA +G
Sbjct  123  NDVCLKLTQKSIPSWVNRLARLG  145



>ref|XP_008452873.1| PREDICTED: deSI-like protein At4g17486 [Cucumis melo]
Length=235

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G H    SGIF     + P +T+R+SI  GRT+    +V   +
Sbjct  39   GVYHSGVQVHG-VEYAFGAHEHATSGIFEVEPRQCPGFTFRKSICIGRTNLGPKEVRSFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L++RN  HFC ++  +L    +P+W +RLA +G
Sbjct  98   EKLAEEYSGNTYHLITRNCNHFCNDVCIRLAGKPIPSWVNRLARLG  143



>ref|XP_010665872.1| PREDICTED: deSI-like protein At4g17486 [Beta vulgaris subsp. 
vulgaris]
Length=226

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G H +  +G+F     + P +T+R+SI  GRT   + +V  ++
Sbjct  37   GVYHSGVQVHG-VEYAFGAHDNATTGVFEVEPKQCPGFTFRKSILIGRTDLGAKEVRALM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            ++L  E+ G+ Y L+S+N  HFC +L  +L    +P+W +RLA +G   K V
Sbjct  96   EKLSKEYFGNTYHLISKNCNHFCNDLCIRLSGKPIPSWVNRLARLGLLCKCV  147



>ref|XP_009126505.1| PREDICTED: deSI-like protein At4g17486 [Brassica rapa]
 emb|CDX75209.1| BnaA01g04930D [Brassica napus]
Length=230

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  ++++G VE+ YG H    +GIF     K P +T+R+SI  G T   + ++   +
Sbjct  42   GIYHSGLEVHG-VEYGYGAHEHSSTGIFKVEPKKCPGFTFRKSILVGETEMKAKEIGSFM  100

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            +EL DE+ G +Y L++RN  HFC ++  KL    +P+W +RLA +G
Sbjct  101  EELSDEYQGSKYHLITRNCNHFCNDVCLKLTQKSIPSWVNRLARLG  146



>emb|CDX68806.1| BnaC01g06470D [Brassica napus]
Length=310

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  ++++G VE+ YG H    +GIF     K P +T+R+SI  G T   + +V   +
Sbjct  42   GIYHSGLEVHG-VEYGYGAHEHSSTGIFKVEPKKCPGFTFRKSILVGETEMKAKEVGSFM  100

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            +EL DE+ G +Y L++RN  HFC ++  KL    +P+W +RLA +G
Sbjct  101  EELADEYQGSKYHLITRNCNHFCNDVCLKLTQKSIPSWVNRLARLG  146



>ref|XP_004145512.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus]
 ref|XP_004167666.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus]
 gb|KGN55449.1| hypothetical protein Csa_4G652130 [Cucumis sativus]
Length=234

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G H    SGIF     + P +T+R+SI  GRT+     V   +
Sbjct  39   GVYHSGVQVHG-VEYAFGAHEHATSGIFEVEPRQCPGFTFRKSICIGRTNLGPKDVRSFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L++RN  HFC ++  +L    +P+W +RLA +G
Sbjct  98   EKLAEEYSGNTYHLITRNCNHFCNDVCIRLAGKPIPSWVNRLARLG  143



>ref|XP_011036649.1| PREDICTED: deSI-like protein At4g17486 [Populus euphratica]
Length=232

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  VQ++G VE+ +G H    +GIF     + P + +R+SI  GRT     +V + +
Sbjct  39   GIYHSGVQVHG-VEYGFGAHDHPTTGIFEVEPKQCPGFMFRKSILIGRTDLGPKEVRVFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L  E+PG+ Y L+++N  HFC ++  KL   K+P W +RLA +G
Sbjct  98   EKLAQEFPGNTYHLITKNCNHFCNDVCLKLTGKKIPRWVNRLARIG  143



>ref|XP_010526233.1| PREDICTED: deSI-like protein At4g17486 [Tarenaya hassleriana]
Length=248

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  V ++G VE+A+G H    +GIF     K P +TYR+SI  G+T     +V   +
Sbjct  39   GIYHSGVAVHG-VEYAFGAHEHSSTGIFEVEPKKCPGFTYRKSILVGKTDMGPKEVRAFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G++Y+L+ RN  HFC ++  KL   ++P+W +RLA +G
Sbjct  98   EKLAEEYRGNKYNLIRRNCNHFCNDVCLKLTQKQIPSWVNRLARLG  143



>ref|XP_002437960.1| hypothetical protein SORBIDRAFT_10g005540 [Sorghum bicolor]
 gb|EER89327.1| hypothetical protein SORBIDRAFT_10g005540 [Sorghum bicolor]
Length=272

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 86/175 (49%), Gaps = 30/175 (17%)
 Frame = +3

Query  3    HRLPQHTELLASTIFISKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVF  182
             +L Q      +    S  + V L++YD+T +   N    ++ +             GV+
Sbjct  17   QQLQQRGAGAGAGEAPSSSSPVFLNVYDVTPA---NGYARWLGL-------------GVY  60

Query  183  HVAVQ----------IYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSS  329
            H  VQ          ++G VE+AYG H    SGIF     + P YT+RES+  G T  S 
Sbjct  61   HSGVQGTFCSPGSRPLHG-VEYAYGAHDGASSGIFEVVPRRCPGYTFRESVLVGTTELSR  119

Query  330  SKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKL--GVPKLPAWAHRLANVG  488
            ++V  ++ +L  ++PGD Y+LVSRN  HFC     +L  G  ++P W +RLA +G
Sbjct  120  AEVRALMSDLAADFPGDAYNLVSRNCNHFCDAACRRLVAGRARIPRWVNRLAKIG  174



>emb|CBI21088.3| unnamed protein product [Vitis vinifera]
Length=174

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  VQ++G VE+A+G H    +GIF     + P +T+R+SI  GRT      V   +
Sbjct  37   GIYHSGVQVHG-VEYAFGAHEHPTTGIFEVEPKQCPGFTFRKSILIGRTDLGPKDVRSFM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y+L++RN  HFC ++  +L    +P W +RLA +G
Sbjct  96   EKLAEEYSGNTYNLITRNCNHFCNDVCNRLTGKPIPRWVNRLARLG  141



>ref|XP_002324900.1| hypothetical protein POPTR_0018s02300g [Populus trichocarpa]
 gb|EEF03465.1| hypothetical protein POPTR_0018s02300g [Populus trichocarpa]
Length=232

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  VQ++G VE+ +G H    +GIF     + P + +R+SI  GRT     +V + +
Sbjct  39   GIYHSGVQVHG-VEYGFGAHDHPTTGIFEVEPKQCPGFMFRKSILIGRTDLGPKEVRVFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L  E+PG+ Y L+++N  HFC ++  KL   K+P W +RLA +G
Sbjct  98   EKLAQEFPGNTYHLITKNCNHFCNDVCLKLTGKKIPRWVNRLARIG  143



>ref|XP_008445255.1| PREDICTED: deSI-like protein At4g17486 [Cucumis melo]
Length=234

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G H    +GIF       P +TYR+SI  GRT+ S  ++   +
Sbjct  39   GVYHSGVQVHG-VEYAFGAHEHASTGIFEVEPKHCPGFTYRKSILIGRTNLSPREIRSFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P W +RLA +G
Sbjct  98   EKLAEEYSGNTYHLITKNCNHFCNDVCVRLTGKPIPRWVNRLARLG  143



>ref|XP_004138707.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus]
 ref|XP_004160769.1| PREDICTED: deSI-like protein At4g17486-like [Cucumis sativus]
 gb|KGN62984.1| hypothetical protein Csa_2G382570 [Cucumis sativus]
Length=234

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G H    +GIF       P +TYR+SI  GRT+ S  ++   +
Sbjct  39   GVYHSGVQVHG-VEYAFGAHEHASTGIFEVEPKHCPGFTYRKSILIGRTNLSPREIRSFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P W +RLA +G
Sbjct  98   EKLAEEYSGNTYHLITKNCNHFCNDVCIRLTGKPIPRWVNRLARLG  143



>ref|XP_006285485.1| hypothetical protein CARUB_v10006919mg [Capsella rubella]
 gb|EOA18383.1| hypothetical protein CARUB_v10006919mg [Capsella rubella]
Length=660

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  ++++G VE+ YG H    SGIF     K P +T+R+SI  G T   + +V   +
Sbjct  39   GIYHSGLEVHG-VEYGYGAHEKSSSGIFEVEPKKCPGFTFRKSILVGETEMRAKEVRTFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G++Y+L++RN  HFC  +  KL    +P+W +RLA +G
Sbjct  98   EKLAEEYQGNKYNLITRNCNHFCNHVCLKLTQKSIPSWVNRLARIG  143



>ref|NP_001174638.1| Os06g0182100 [Oryza sativa Japonica Group]
 dbj|BAD72532.1| apoptosis-related protein PNAS-4 like [Oryza sativa Japonica 
Group]
 dbj|BAD72576.1| apoptosis-related protein PNAS-4 like [Oryza sativa Japonica 
Group]
 dbj|BAH93366.1| Os06g0182100 [Oryza sativa Japonica Group]
Length=271

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 7/112 (6%)
 Frame = +3

Query  174  GVFHVAVQ-IYG-----EVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSS  332
            GV+H  VQ +Y       + +AYG H   GSGIF     + P Y +RE+I  G T  + +
Sbjct  66   GVYHSGVQGMYALLSSPSILYAYGAHDGAGSGIFEVAPRRCPGYAFREAILVGTTELTRA  125

Query  333  KVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            +V  ++ +L  ++PGD Y+LVSRN  HFC     +L   ++P W +RLA +G
Sbjct  126  EVRAVMADLAADFPGDAYNLVSRNCNHFCDAACRRLVRARIPRWVNRLAKIG  177



>ref|XP_010942141.1| PREDICTED: deSI-like protein At4g17486 [Elaeis guineensis]
Length=221

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 63/106 (59%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+AYG H    +GIF     + P + +R+SI  GRT      V  ++
Sbjct  37   GVYHSGVQVHG-VEYAYGAHEHATTGIFEGEPRQCPGFVFRKSILIGRTDLGPRDVRALM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            +EL  E+ G+ Y+L+S+N  HFC E   +L    +P W +RLA +G
Sbjct  96   EELATEYTGNTYNLISKNCNHFCNEACLRLTNKPIPRWVNRLARIG  141



>emb|CDP18789.1| unnamed protein product [Coffea canephora]
Length=218

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G H    +G+F     + P +T+R+SI  GRT     +V   +
Sbjct  42   GVYHSGVQVHG-VEYAFGAHEHSTTGVFEVEPKQCPGFTFRKSILIGRTDLGPKEVRAFM  100

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y+L+++N  HFC ++  +L    +P+W +RLA +G
Sbjct  101  EKLAEEYSGNTYNLITKNCNHFCNDVCLRLTRKPIPSWVNRLARLG  146



>ref|XP_009035395.1| hypothetical protein AURANDRAFT_7465, partial [Aureococcus anophagefferens]
 gb|EGB09396.1| hypothetical protein AURANDRAFT_7465, partial [Aureococcus anophagefferens]
Length=132

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 75/142 (53%), Gaps = 12/142 (8%)
 Frame = +3

Query  66   VILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH-RDKG  242
            V  H+YD+  S          + ++N++ +  +  GGVFH A+++ G  E+++G  R + 
Sbjct  2    VFFHVYDVGKSKH--------IRRLNRVTE--VVGGGVFHGAIEVCG-AEFSFGGCRAQR  50

Query  243  SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQ  422
            SG+F C  TK P + YRES   G       +V  IL  L   W G  Y L+ +N   F +
Sbjct  51   SGVFKCEPTKCPMHGYRESAYLGDCGLKPPQVQAILAALSPNWYGPTYDLIRKNCCSFSK  110

Query  423  ELLEKLGVPKLPAWAHRLANVG  488
                +LGV  +PAW+HRLA+ G
Sbjct  111  AFAVELGVGPVPAWSHRLADAG  132



>ref|XP_009032180.1| hypothetical protein AURANDRAFT_19518 [Aureococcus anophagefferens]
 gb|EGB12505.1| hypothetical protein AURANDRAFT_19518 [Aureococcus anophagefferens]
Length=182

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 70/123 (57%), Gaps = 0/123 (0%)
 Frame = +3

Query  120  NYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRES  299
            N ++ ++N ++++ +  GGVFH A+++ G      G R    GIF+C   K P +T+RES
Sbjct  18   NKVLQELNYVVENFLGEGGVFHGAIEVCGHEHSFGGCRQNRCGIFTCEPKKCPMHTFRES  77

Query  300  IPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLA  479
               G    S  +++ +L+ ++ EW G  Y L+ +N  +F +    KLG  K+P W + LA
Sbjct  78   FYLGDCGKSERQIHDVLESMKPEWMGPTYDLLRKNCCYFSEAFSLKLGTGKIPKWVNHLA  137

Query  480  NVG  488
            +VG
Sbjct  138  HVG  140



>ref|XP_008808226.1| PREDICTED: deSI-like protein At4g17486 [Phoenix dactylifera]
Length=221

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+AYG H    +GIF     + P + +R+SI  GRT     +V  ++
Sbjct  37   GVYHSGVQVHG-VEYAYGAHEHATTGIFEGEPRQCPGFVFRKSILIGRTDLGQREVRALM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            +EL  E+ G+ Y+L+S+N  HFC +   +L    +P W +RLA +G
Sbjct  96   EELAAEYTGNTYNLISKNCNHFCNKACLRLTNKPIPRWVNRLARIG  141



>gb|KFK29811.1| hypothetical protein AALP_AA7G181900 [Arabis alpina]
Length=222

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  ++++G VE+ YG H    SGIF     K P +T+R+SI  G T  ++ +V   +
Sbjct  40   GIYHSGLEVHG-VEYGYGAHEAPSSGIFEVEPKKCPGFTFRKSILVGETEMNAKEVRTFM  98

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
             +L +E+ G+ Y +++RN  HFC ++  KL    +P+W +RLA +G
Sbjct  99   LKLAEEYKGNNYHIITRNCNHFCNQVCLKLTQKSIPSWVNRLARIG  144



>ref|XP_006412534.1| hypothetical protein EUTSA_v10025954mg [Eutrema salsugineum]
 gb|ESQ53987.1| hypothetical protein EUTSA_v10025954mg [Eutrema salsugineum]
Length=275

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  ++++G VE+ YG H    SGIF     K P +T+R+SI  G T   + +V   +
Sbjct  39   GIYHSGLEVHG-VEYGYGAHEQPSSGIFEVEPKKCPGFTFRKSILVGETEMRAKEVRSFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G++Y L++RN  HFC  +  KL    +P+W +RLA +G
Sbjct  98   EKLSEEYQGNKYHLITRNCNHFCNHVCLKLTQNAIPSWVNRLARLG  143



>ref|XP_010648702.1| PREDICTED: deSI-like protein At4g17486 [Vitis vinifera]
Length=226

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  VQ++G VE+A+G H    +GIF     + P +T+R+SI  GRT      V   +
Sbjct  37   GIYHSGVQVHG-VEYAFGAHEHPTTGIFEVEPKQCPGFTFRKSILIGRTDLGPKDVRSFM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y+L++RN  HFC ++  +L    +P W +RLA +G
Sbjct  96   EKLAEEYSGNTYNLITRNCNHFCNDVCNRLTGKPIPRWVNRLARLG  141



>ref|XP_011039595.1| PREDICTED: deSI-like protein At4g17486 [Populus euphratica]
 ref|XP_011039596.1| PREDICTED: deSI-like protein At4g17486 [Populus euphratica]
Length=235

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+ +G H  + +GIF     + P + +R+SI  GRT     +V   +
Sbjct  39   GVYHSGVQVHG-VEYGFGAHDHETTGIFEVEPKQCPGFMFRKSILIGRTDLGPKEVRAFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L  E+PG+ Y L+++N  HFC ++  KL    +P W +RLA +G
Sbjct  98   EKLAQEYPGNAYHLITKNCNHFCNDMCFKLTGKTIPQWVNRLARLG  143



>ref|XP_009394943.1| PREDICTED: deSI-like protein At4g17486 [Musa acuminata subsp. 
malaccensis]
Length=231

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+AYG H    +GIF     + P + +R+SI  GRT     +V  ++
Sbjct  50   GVYHSGVQVHG-VEYAYGAHDHPTTGIFEGEPRQCPGFVFRKSILIGRTDLGPCEVRALM  108

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            +EL  ++ GD Y+L+S+N  HFC E   +L    +P W +RLA +G
Sbjct  109  EELAAKYTGDTYNLISKNCNHFCNEASLRLTGKPIPRWVNRLAKIG  154



>ref|XP_009794916.1| PREDICTED: deSI-like protein At4g17486 [Nicotiana sylvestris]
Length=161

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 66/108 (61%), Gaps = 2/108 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G H    +GIF     + P +T+R+SI  GRT     +V   +
Sbjct  37   GVYHSGVQVHG-VEYAFGAHEHPTTGIFEVEPKQCPGFTFRKSILIGRTDLGPKEVRAFM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVGDA  494
            ++L +E+ G  Y+L+++N  HFC ++  +L    +P W +RLA +G+ 
Sbjct  96   EKLAEEYTGHSYNLITKNCNHFCSDVCVRLTGKPIPRWVNRLARLGNC  143



>ref|XP_002309663.2| hypothetical protein POPTR_0006s27740g [Populus trichocarpa]
 gb|EEE93186.2| hypothetical protein POPTR_0006s27740g [Populus trichocarpa]
Length=235

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+++G H  + +GIF     + P + +R+SI  GRT     +V   +
Sbjct  39   GVYHSGVQVHG-VEYSFGAHDHETTGIFEVEPKQCPGFMFRKSILIGRTDLGPKEVRAFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L  E+PG+ Y L+++N  HFC ++  KL    +P W +RLA +G
Sbjct  98   EKLAQEYPGNTYHLITKNCNHFCNDVCFKLTGKTIPQWVNRLARLG  143



>ref|XP_010929119.1| PREDICTED: deSI-like protein At4g17486 [Elaeis guineensis]
Length=228

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 63/106 (59%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+AYG H     GIF     + P + +R+SI  GRT     +V  ++
Sbjct  37   GVYHSGVQVHG-VEYAYGAHEHATPGIFEGEPRQCPGFVFRKSILIGRTDMGPREVRALM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            +EL  ++ G+ Y+L+S+N  HFC E   +L    +P W +RLA +G
Sbjct  96   EELATDYTGNTYNLISKNCNHFCNETCLRLTNKPIPRWVNRLAKIG  141



>ref|XP_009037509.1| hypothetical protein AURANDRAFT_6447, partial [Aureococcus anophagefferens]
 gb|EGB07699.1| hypothetical protein AURANDRAFT_6447, partial [Aureococcus anophagefferens]
Length=105

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 60/103 (58%), Gaps = 1/103 (1%)
 Frame = +3

Query  171  GGVFHVAVQIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GG+FH  V++ G VE++YG+ D+G+G+F+         ++R  +P GR    +  +   L
Sbjct  3    GGIFHAGVELAG-VEYSYGYCDRGTGVFTNDPLDAYGASHRSRVPMGRCGLDARAIERRL  61

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLA  479
              L   W G+ Y+L++RN  HFC  L  +LGV  +PAW + LA
Sbjct  62   ARLVALWQGNTYALLTRNCCHFCDALCAELGVGPIPAWVNGLA  104



>gb|AAL38722.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14255.1| unknown protein [Arabidopsis thaliana]
Length=249

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  ++++G VE+ YG H    SGIF     K P +T+R+SI  G T   + +V   +
Sbjct  39   GIYHSGLEVHG-VEYGYGAHEKSSSGIFEVEPKKCPGFTFRKSILVGETEMKAKEVRSFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G++Y L++RN  HFC  +  KL    +P+W +RLA +G
Sbjct  98   EKLSEEYQGNKYHLITRNCNHFCNHVSLKLTHKSIPSWVNRLARLG  143



>gb|EYU32380.1| hypothetical protein MIMGU_mgv1a013824mg [Erythranthe guttata]
Length=209

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  VQ++G +E+A+G H    +GIF       P +T+R+SI  GR+    ++V+  +
Sbjct  37   GIYHSGVQVHG-IEYAFGAHEHSATGIFEVEPKHCPGFTFRKSILIGRSDLGLNEVSEFM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y+L++RN  HFC ++  +L    +P W +RLA +G
Sbjct  96   EKLAEEYSGNTYNLITRNCNHFCNDVCLRLTGKPIPRWVNRLARLG  141



>ref|XP_004291942.1| PREDICTED: deSI-like protein At4g17486 [Fragaria vesca subsp. 
vesca]
Length=216

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYGHRDKGS-GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G  D  S GIF     K P + +R+SI  GRT     +V   +
Sbjct  38   GVYHSGVQVHG-VEYAFGAHDHASTGIFEVEPKKCPGFVFRKSILIGRTDLGPKEVRAFM  96

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +++ G+ Y L+++N  HFC ++  KL    +P W +RLA +G
Sbjct  97   EKLAEDYSGNTYHLITKNCNHFCNDVCLKLTERTIPRWVNRLARLG  142



>ref|XP_002869301.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45560.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=677

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  ++++G VE+ YG H    SGIF     K P +T+R+SI  G T   + +V   +
Sbjct  39   GIYHSGLEVHG-VEYGYGAHEHSSSGIFEVEPKKCPGFTFRKSILVGETEMRAKEVRTFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G++Y L++RN  HFC  +  KL    +P+W +RLA +G
Sbjct  98   EKLSEEYQGNKYHLITRNCNHFCNHVCLKLTQNSIPSWVNRLARLG  143



>gb|KJB56553.1| hypothetical protein B456_009G124800 [Gossypium raimondii]
Length=173

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G H    +GIF     +   +T+R+SI  G+T    + V  ++
Sbjct  37   GVYHSGVQVHG-VEYAFGAHEYPTTGIFEAEPKQCDGFTFRKSILIGKTELGPADVRGVM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            ++L +E+ G+ Y+L+++N  HFC +   +L    +P+W +RLA +G++A  +
Sbjct  96   EDLAEEYKGNAYNLITKNCNHFCNDACIRLTGNPIPSWVNRLARIGNSAFSI  147



>gb|ADE75652.1| unknown [Picea sitchensis]
Length=267

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 78/145 (54%), Gaps = 18/145 (12%)
 Frame = +3

Query  60   TEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYG-HRD  236
            T V L++YDLT     N  V +  +             GVFH  V+++G VE+A+G H  
Sbjct  60   THVYLNVYDLT---PMNGYVYWAGL-------------GVFHSGVEVHG-VEYAFGVHDF  102

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
              SG+F     + P +T+R+SI  G T+ S S++   L++L   + GD Y L+++N  HF
Sbjct  103  PTSGVFEVEPRQCPGFTFRKSIYIGTTNLSPSQLREFLEQLAGNYNGDTYHLIAKNCNHF  162

Query  417  CQELLEKLGVPKLPAWAHRLANVGD  491
            C ++  KL    +P W +RLA +G 
Sbjct  163  CNDICLKLTGNSIPGWVNRLAKIGS  187



>gb|KFK27777.1| hypothetical protein AALP_AA8G427400 [Arabis alpina]
Length=214

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  V+++G VE+ +G H    +GIF     + P +T+R+SI  GRT     KV   +
Sbjct  36   GIYHSGVEVHG-VEYGFGAHEHSSTGIFEVEPKQCPGFTFRKSILVGRTDLDPEKVRAFM  94

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P+W +RLA  G
Sbjct  95   EKLAEEYSGNTYHLITKNCNHFCNDVCVQLTRRSIPSWVNRLARFG  140



>ref|XP_010313710.1| PREDICTED: deSI-like protein At4g17486 isoform X2 [Solanum lycopersicum]
Length=223

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 77/147 (52%), Gaps = 18/147 (12%)
 Frame = +3

Query  51   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  230
            S  T VIL++YDLT + + +  + +                G+FH  ++++G +E+ YG 
Sbjct  23   SYETPVILNVYDLTPANQYSVWLGF----------------GIFHSGIEVHG-MEYGYGA  65

Query  231  RD-KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  407
             D   SG+F       P + YR S+P GR     S+ +  L+++  E+ GD Y L+S+N 
Sbjct  66   HDFPISGVFEVEPKSCPGFIYRCSVPLGRIKMPPSEFHAFLEDVASEYHGDTYHLISKNC  125

Query  408  KHFCQELLEKLGVPKLPAWAHRLANVG  488
             HF  ++ ++L    +P W +RLA VG
Sbjct  126  NHFTDDIAQRLTGKGIPGWVNRLARVG  152



>ref|XP_004251588.1| PREDICTED: deSI-like protein At4g17486 isoform X1 [Solanum lycopersicum]
Length=224

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 77/147 (52%), Gaps = 18/147 (12%)
 Frame = +3

Query  51   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  230
            S  T VIL++YDLT + + +  + +                G+FH  ++++G +E+ YG 
Sbjct  23   SYETPVILNVYDLTPANQYSVWLGF----------------GIFHSGIEVHG-MEYGYGA  65

Query  231  RD-KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  407
             D   SG+F       P + YR S+P GR     S+ +  L+++  E+ GD Y L+S+N 
Sbjct  66   HDFPISGVFEVEPKSCPGFIYRCSVPLGRIKMPPSEFHAFLEDVASEYHGDTYHLISKNC  125

Query  408  KHFCQELLEKLGVPKLPAWAHRLANVG  488
             HF  ++ ++L    +P W +RLA VG
Sbjct  126  NHFTDDIAQRLTGKGIPGWVNRLARVG  152



>gb|EXX77625.1| hypothetical protein RirG_022140 [Rhizophagus irregularis DAOM 
197198w]
Length=158

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 71/146 (49%), Gaps = 14/146 (10%)
 Frame = +3

Query  54   KMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHR  233
            K   V L++YD+   GK  D    M V             GVFH +V+I G      GH 
Sbjct  22   KYISVYLNVYDMLPRGKITDMCYKMGV-------------GVFHSSVEILGREYNFGGHD  68

Query  234  DKGSGIF-SCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSK  410
               +G+F + P    PN T++ESI  G T     ++  ++ EL  EW G+ Y+L++RN  
Sbjct  69   SDYTGVFVTRPKQGPPNVTFKESIAMGYTTMDKEEIKNVIDELSREWHGNTYNLLTRNCN  128

Query  411  HFCQELLEKLGVPKLPAWAHRLANVG  488
            HF  EL E+L     P W +R A +G
Sbjct  129  HFSSELCEQLVGKPAPKWINRAAKLG  154



>ref|XP_006366865.1| PREDICTED: deSI-like protein At4g17486-like [Solanum tuberosum]
Length=224

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 77/147 (52%), Gaps = 18/147 (12%)
 Frame = +3

Query  51   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  230
            S  T VIL++YDLT + + +  + +                G+FH  ++++G +E+ YG 
Sbjct  23   SYETPVILNVYDLTPANQYSVWLGF----------------GIFHSGIEVHG-MEYGYGA  65

Query  231  RDKG-SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  407
             D   SG+F       P + YR S+P GR     S+ +  L+++  E+ GD Y L+S+N 
Sbjct  66   HDFPISGVFEVEPKSCPGFIYRCSVPLGRIKMPPSEFHAFLEDVASEYHGDTYHLISKNC  125

Query  408  KHFCQELLEKLGVPKLPAWAHRLANVG  488
             HF  ++ ++L    +P W +RLA VG
Sbjct  126  NHFTDDIAQRLTGKGIPGWVNRLARVG  152



>emb|CDY65538.1| BnaCnng47550D [Brassica napus]
 emb|CDY65539.1| BnaCnng47560D [Brassica napus]
 emb|CDX88162.1| BnaA06g27530D [Brassica napus]
Length=220

 Score = 81.6 bits (200),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  V+++G VE+ +G H    +GIF     + P +T+R+SI  GRT     KV   +
Sbjct  40   GVYHSGVEVHG-VEYGFGAHEHSTTGIFEVEPKQCPGFTFRKSILIGRTDLDPEKVRAFM  98

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P+W +RLA  G
Sbjct  99   EKLSEEYSGNTYHLITKNCNHFCNDVCVQLTRRSIPSWVNRLARFG  144



>ref|XP_009151042.1| PREDICTED: deSI-like protein At4g17486 [Brassica rapa]
Length=220

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  V+++G VE+ +G H    +GIF     + P +T+R+SI  GRT     KV   +
Sbjct  40   GVYHSGVEVHG-VEYGFGAHEHSTTGIFEVEPKQCPGFTFRKSILIGRTDLDPEKVRAFM  98

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P+W +RLA  G
Sbjct  99   EKLAEEYSGNTYHLITKNCNHFCNDVCVQLTRRSIPSWVNRLARFG  144



>ref|XP_002515452.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46901.1| conserved hypothetical protein [Ricinus communis]
Length=230

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 63/106 (59%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYGHRDKGS-GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  VQ++G VE+ +G  D  S GIF     + P +T+R+SI  GRT     +V   +
Sbjct  39   GIYHSGVQVHG-VEYGFGAHDHSSTGIFEVEPKQCPGFTFRKSILIGRTDLGPKEVRAFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L  E+ G+ Y L+++N  HFC ++  KL    +P W +RLA +G
Sbjct  98   EKLAHEYSGNSYHLITKNCNHFCNDVCIKLTGKTIPRWVNRLARLG  143



>emb|CDY07077.1| BnaA04g22380D [Brassica napus]
Length=220

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  V+++G VE+ +G H    +GIF     + P +T+R+SI  GRT     KV   +
Sbjct  40   GVYHSGVEVHG-VEYGFGAHEHSTTGIFEVEPKQCPGFTFRKSILIGRTDLDPEKVRAFM  98

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P+W +RLA  G
Sbjct  99   EKLAEEYSGNTYHLITKNCNHFCNDVCVQLTRRSIPSWVNRLARFG  144



>gb|KDP33538.1| hypothetical protein JCGZ_07109 [Jatropha curcas]
Length=230

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 63/106 (59%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYGHRDKGS-GIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  VQ++  +E+ +G  D  S GIF     + P +T+R+SI  GRT     +V   +
Sbjct  39   GIYHSGVQVH-NIEYGFGAHDHPSTGIFEVEPKQCPGFTFRKSILIGRTDLGPKEVRTFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L  ++PG+ Y L+++N  HFC ++  KL    +P W +RLA +G
Sbjct  98   EKLAQDYPGNSYHLITKNCNHFCNDVCHKLTGKTIPRWVNRLARLG  143



>ref|XP_008377676.1| PREDICTED: deSI-like protein At4g17486 [Malus domestica]
Length=229

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 63/106 (59%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G H    +GIF     + P + +R+SI  GRT      +   +
Sbjct  39   GVYHSGVQVHG-VEYAFGAHEHATTGIFEVEPKQCPGFVFRKSILIGRTDLGPKDIRAFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P W +RLA +G
Sbjct  98   EKLAEEYSGNTYHLITKNCNHFCNDVCTRLTRKPIPRWVNRLARLG  143



>ref|XP_008378831.1| PREDICTED: deSI-like protein At4g17486 [Malus domestica]
Length=229

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYGHRDKG-SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G  D   +GIF     + P + +R+SI  GRT     +V   +
Sbjct  39   GVYHSGVQVHG-VEYAFGAHDHATTGIFEVEPKQCPGFVFRKSILIGRTDLDPKEVRAFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P W +RLA +G
Sbjct  98   EKLAEEYSGNTYHLITKNCNHFCNDVCTRLTGKPIPRWVNRLARLG  143



>gb|EXX77624.1| hypothetical protein RirG_022140 [Rhizophagus irregularis DAOM 
197198w]
Length=192

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 71/146 (49%), Gaps = 14/146 (10%)
 Frame = +3

Query  54   KMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHR  233
            K   V L++YD+   GK  D    M V             GVFH +V+I G      GH 
Sbjct  22   KYISVYLNVYDMLPRGKITDMCYKMGV-------------GVFHSSVEILGREYNFGGHD  68

Query  234  DKGSGIF-SCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSK  410
               +G+F + P    PN T++ESI  G T     ++  ++ EL  EW G+ Y+L++RN  
Sbjct  69   SDYTGVFVTRPKQGPPNVTFKESIAMGYTTMDKEEIKNVIDELSREWHGNTYNLLTRNCN  128

Query  411  HFCQELLEKLGVPKLPAWAHRLANVG  488
            HF  EL E+L     P W +R A +G
Sbjct  129  HFSSELCEQLVGKPAPKWINRAAKLG  154



>ref|XP_009390569.1| PREDICTED: deSI-like protein At4g17486 [Musa acuminata subsp. 
malaccensis]
Length=231

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 65/112 (58%), Gaps = 2/112 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+AYG H    +GIF     + P + +R+SI  G T     +V  ++
Sbjct  37   GVYHSGVQVHG-VEYAYGAHEHPTTGIFEGEPRQCPGFAFRKSIHIGLTDLGPREVRALV  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            +E+  E+ GD Y+L+S+N  HFC +   +L    +P W +RLA +G   K V
Sbjct  96   EEMSAEYTGDTYNLISKNCNHFCDDACLRLTGKHIPKWVNRLAKIGLLCKCV  147



>ref|XP_007223906.1| hypothetical protein PRUPE_ppa010937mg [Prunus persica]
 gb|EMJ25105.1| hypothetical protein PRUPE_ppa010937mg [Prunus persica]
Length=229

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYGHRDKG-SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G  D   +GIF     + P + +R+SI  GRT     +V   +
Sbjct  39   GVYHSGVQVHG-VEYAFGAHDHATTGIFEVEPKQCPGFVFRKSILIGRTDLGPKEVRAFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P W +RLA +G
Sbjct  98   EKLAEEYSGNTYHLITKNCNHFCNDVCTRLTGKPIPRWVNRLARLG  143



>ref|NP_194926.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAA16591.1| putative protein [Arabidopsis thaliana]
 emb|CAB79916.1| putative protein [Arabidopsis thaliana]
 gb|AEE85985.1| uncharacterized protein AT4G31980 [Arabidopsis thaliana]
Length=680

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  ++++G VE+ YG H    SGIF     K P +T+R+SI  G T   + +V   +
Sbjct  39   GIYHSGLEVHG-VEYGYGAHEKSSSGIFEVEPKKCPGFTFRKSILVGETEMKAKEVRSFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G++Y L++RN  HFC  +  KL    +P+W +RLA +G
Sbjct  98   EKLSEEYQGNKYHLITRNCNHFCNHVSLKLTHKSIPSWVNRLARLG  143



>ref|XP_006450315.1| hypothetical protein CICLE_v10009362mg [Citrus clementina]
 ref|XP_006483449.1| PREDICTED: deSI-like protein At4g17486-like [Citrus sinensis]
 gb|ESR63555.1| hypothetical protein CICLE_v10009362mg [Citrus clementina]
 gb|KDO67511.1| hypothetical protein CISIN_1g026795mg [Citrus sinensis]
Length=233

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  VQ++G VE+ +G H    +GIF     + P +T+R+SI  GRT     +V   +
Sbjct  39   GIYHSGVQVHG-VEYGFGAHDHSTTGIFEVEPKQCPGFTFRKSILIGRTDLGPREVRAFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L+++N  HFC ++  KL    +P W +RLA +G
Sbjct  98   EKLAEEYSGNTYHLITKNCNHFCNDVCLKLTRKPIPRWVNRLARLG  143



>ref|XP_006394766.1| hypothetical protein EUTSA_v10004898mg [Eutrema salsugineum]
 gb|ESQ32052.1| hypothetical protein EUTSA_v10004898mg [Eutrema salsugineum]
Length=218

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  V+++G +E+ +G H    +GIF     + P +T+R+SI  GRT     KV   +
Sbjct  40   GIYHSGVEVHG-IEYGFGAHEQSTTGIFEVEPKQCPGFTFRKSILIGRTDLDPEKVRAFM  98

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P+W +RLA  G
Sbjct  99   EKLAEEYSGNTYHLITKNCNHFCNDVCIQLTRRSIPSWVNRLARFG  144



>gb|KHG11379.1| hypothetical protein F383_11015 [Gossypium arboreum]
Length=271

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  VQ++G VE+ +G H    +GIF    T+ P +T+R+SI  GRT      V   +
Sbjct  39   GIYHSGVQVHG-VEYGFGAHEHSATGIFEVEPTQCPGFTFRKSILIGRTDLGPKDVRSFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L  ++ G+ Y L+++N  HFC ++  +L    +P+W +RLA +G
Sbjct  98   EKLATDYSGNTYHLITKNCNHFCNDVCIQLAGKPIPSWVNRLARLG  143



>ref|XP_003603314.1| hypothetical protein MTR_3g106240 [Medicago truncatula]
 gb|AES73565.1| PPPDE thiol peptidase family protein, putative [Medicago truncatula]
Length=213

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++ +VE+ +G H +  +GIF       P +T+R+SI  G T   ++ + + +
Sbjct  39   GVYHSGVQVH-DVEYGFGAHENDTTGIFEVQPKNCPGFTFRKSIFIGTTDLGTNDIRVFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L  E+ G+ Y L+S+N  HFC ++  KL    +P W +RLA +G
Sbjct  98   EKLAQEYSGNSYHLISKNCNHFCHDVCYKLTGKSIPRWVNRLARLG  143



>gb|KHG02026.1| hypothetical protein F383_26397 [Gossypium arboreum]
Length=225

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G+FH  +++YG +E+ YG H D  SG+F       P + +R S+  G T  S S+  L +
Sbjct  44   GIFHSGIEVYG-LEYGYGAHEDPTSGVFELEPRSCPGFIFRRSVLLGSTSMSRSEFQLFI  102

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L  ++ GD Y L+++N  HF  E+  +L    +P W +RLA +G
Sbjct  103  EQLSQKYHGDTYHLITKNCNHFTDEVCLQLTGKPIPGWVNRLARLG  148



>ref|XP_010532094.1| PREDICTED: deSI-like protein At4g17486 isoform X2 [Tarenaya hassleriana]
Length=232

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  V+++G VE+A+G H    +GIF     +   +T+R+SI  G+T     +V  ++
Sbjct  37   GVYHSGVEVHG-VEYAFGAHEYPTTGIFEGEPKQCEGFTFRKSILIGKTDMERREVRSVM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            +EL + + GD Y+L+++N  HFC E   +L    +P+W +RLA +G
Sbjct  96   EELAESYKGDSYNLITKNCNHFCDEACVRLTGNSIPSWVNRLARIG  141



>gb|AFK47902.1| unknown [Lotus japonicus]
Length=226

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 63/106 (59%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+ +G H  + +GIF       P +T+R+SI  G T    S+V   +
Sbjct  39   GVYHSGVQVHG-VEYGFGAHEHETTGIFEVQPKNCPGFTFRKSILIGTTDLGPSEVREFM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L  E+ G+ Y L+S+N  HFC ++  KL    +P W +RLA +G
Sbjct  98   EKLAQEYSGNTYHLISKNCNHFCADVCLKLTGKSIPRWVNRLARLG  143



>ref|XP_010532093.1| PREDICTED: deSI-like protein At4g17486 isoform X1 [Tarenaya hassleriana]
Length=236

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  V+++G VE+A+G H    +GIF     +   +T+R+SI  G+T     +V  ++
Sbjct  37   GVYHSGVEVHG-VEYAFGAHEYPTTGIFEGEPKQCEGFTFRKSILIGKTDMERREVRSVM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            +EL + + GD Y+L+++N  HFC E   +L    +P+W +RLA +G
Sbjct  96   EELAESYKGDSYNLITKNCNHFCDEACVRLTGNSIPSWVNRLARIG  141



>ref|XP_006596080.1| PREDICTED: deSI-like protein At4g17486-like isoform X2 [Glycine 
max]
Length=189

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 61/106 (58%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+ +G H    +GIF       P +T+R+SI  G T      V + +
Sbjct  37   GVYHSGVQVHG-VEYGFGAHERDTTGIFEVEPGHCPGFTFRKSIFIGSTDMGPKDVRVFM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            + L DE+ G+ Y L+ +N  HFC++L  +L    +P W +RLA +G
Sbjct  96   ERLADEYSGNTYHLIQKNCNHFCEDLCFRLTGKSIPRWVNRLARLG  141



>ref|XP_003091095.1| hypothetical protein CRE_24283 [Caenorhabditis remanei]
 gb|EFP02287.1| hypothetical protein CRE_24283 [Caenorhabditis remanei]
Length=387

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 70/113 (62%), Gaps = 7/113 (6%)
 Frame = +3

Query  165  NLG-GVFHVAVQIYGEVEWAYG-HRDKGSGIF-SCPATKNP---NYTYRESIPAGRTHCS  326
            N+G G+FH  ++I+G VE+AYG H  + SG+F + P         + ++ESI  G T  S
Sbjct  90   NIGVGIFHSGIEIFG-VEYAYGGHPYQFSGVFENSPQDAEELGDTFKFKESIVVGETDQS  148

Query  327  SSKVNLILKELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANV  485
            SS++  ++K+L DE+ GD Y L+SRN  HF   L  KL   ++P W +RLAN+
Sbjct  149  SSEIRRLIKQLGDEFRGDRYHLISRNCNHFSAVLARKLTGKEIPGWINRLANL  201



>ref|XP_002951862.1| hypothetical protein VOLCADRAFT_92471 [Volvox carteri f. nagariensis]
 gb|EFJ46967.1| hypothetical protein VOLCADRAFT_92471 [Volvox carteri f. nagariensis]
Length=403

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 64/142 (45%), Gaps = 35/142 (25%)
 Frame = +3

Query  171  GGVFHVAVQIYGEVEWAYGHRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNL--  344
            G  FH AVQ+  ++EW++G+ + G+G++ C A  N  YT+RE I  G T  +  +V L  
Sbjct  16   GTTFHGAVQLE-DLEWSFGYCESGTGVYCCRARSNSLYTFREHIELGATRKTKQEVRLGT  74

Query  345  --------------------------------ILKELRDEWPGDEYSLVSRNSKHFCQEL  428
                                            IL   +  WPG  Y L+ RN  HFC++L
Sbjct  75   GDGVASVVAAVVVVVVVVAAVVAGGGGGSIREILSRFKRAWPGSSYDLLQRNCCHFCEDL  134

Query  429  LEKLGVPKLPAWAHRLANVGDA  494
               L VP  PAW +R A   DA
Sbjct  135  CLALEVPSPPAWLNRFAQGADA  156



>ref|XP_007215933.1| hypothetical protein PRUPE_ppa011077mg [Prunus persica]
 gb|EMJ17132.1| hypothetical protein PRUPE_ppa011077mg [Prunus persica]
Length=224

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G H    +GIF     K   +T+R+SI  G+T     +V  ++
Sbjct  37   GVYHSGVQVHG-VEYAFGAHEYPTTGIFEGEPKKCDGFTFRKSILIGKTDVGPLEVRAVM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            +EL +++ G+ Y+L+++N  HFC +   +L    +P+W +RLA +G
Sbjct  96   EELAEQYKGNAYNLITKNCNHFCNDACVRLTGNSIPSWVNRLARIG  141



>ref|XP_010245553.1| PREDICTED: deSI-like protein At4g17486 [Nelumbo nucifera]
Length=224

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYGHRD-KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G  D   +GIF     + P +T+R+SI  GRT     +V   +
Sbjct  37   GVYHSGVQVHG-VEYAFGAHDFPTTGIFEGEPKQCPGFTFRKSILIGRTDLGPREVRAFM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y+L+++N  HFC +   +L    +P W +RLA +G
Sbjct  96   EKLAEEYTGNTYNLITKNCNHFCNDACLRLTGKPIPRWVNRLARLG  141



>ref|XP_010537890.1| PREDICTED: deSI-like protein At4g17486 isoform X2 [Tarenaya hassleriana]
Length=232

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  V+++G +E+A+G H    +GIF     +   +T+R+SI  G+T     +V  ++
Sbjct  37   GVYHSGVEVHG-IEYAFGAHEYPTTGIFEGEPKQCEGFTFRKSILIGKTDMEQREVRAVM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L D + G+ Y+L+++N  HFC E   KL    +P+W +RLA +G
Sbjct  96   EDLADSYKGNSYNLITKNCNHFCDEACIKLTGNPIPSWVNRLARIG  141



>ref|XP_009797717.1| PREDICTED: deSI-like protein At4g17486 isoform X2 [Nicotiana 
sylvestris]
Length=226

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 73/147 (50%), Gaps = 18/147 (12%)
 Frame = +3

Query  51   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  230
            S  + VIL++YDLT + +      +                G+FH  ++++G +E+ YG 
Sbjct  20   SYESPVILNVYDLTPANQYTVWFGF----------------GIFHSGIEVHG-MEYGYGA  62

Query  231  RDKG-SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  407
             D   SG+F       P + YR SIP GR     S+    L+ +  E+ GD Y L+S+N 
Sbjct  63   HDFPISGVFEVEPKSCPGFIYRCSIPLGRIKMPPSEFQAFLENMASEYHGDTYHLISKNC  122

Query  408  KHFCQELLEKLGVPKLPAWAHRLANVG  488
             HF  ++ ++L    +P W +RLA VG
Sbjct  123  NHFTDDIAQRLTGKGIPGWVNRLARVG  149



>ref|XP_010537889.1| PREDICTED: deSI-like protein At4g17486 isoform X1 [Tarenaya hassleriana]
Length=236

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  V+++G +E+A+G H    +GIF     +   +T+R+SI  G+T     +V  ++
Sbjct  37   GVYHSGVEVHG-IEYAFGAHEYPTTGIFEGEPKQCEGFTFRKSILIGKTDMEQREVRAVM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L D + G+ Y+L+++N  HFC E   KL    +P+W +RLA +G
Sbjct  96   EDLADSYKGNSYNLITKNCNHFCDEACIKLTGNPIPSWVNRLARIG  141



>ref|XP_009630833.1| PREDICTED: deSI-like protein At4g17486 [Nicotiana tomentosiformis]
Length=227

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 73/147 (50%), Gaps = 18/147 (12%)
 Frame = +3

Query  51   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  230
            S  + VIL++YDLT + +      +                G+FH  V+++G +E+ YG 
Sbjct  20   SYESPVILNVYDLTPANQYTVWFGF----------------GIFHSGVEVHG-MEYGYGA  62

Query  231  RD-KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  407
             D   SG+F       P + YR SIP GR     S+    L+ +  E+ GD Y L+S+N 
Sbjct  63   HDFPISGMFEVEPKSCPGFIYRCSIPLGRIKMPPSEFQAFLENMASEYHGDTYHLISKNC  122

Query  408  KHFCQELLEKLGVPKLPAWAHRLANVG  488
             HF  ++ ++L    +P W +RLA VG
Sbjct  123  NHFTDDIAQRLTGKGIPGWVNRLARVG  149



>ref|XP_006288624.1| hypothetical protein CARUB_v10001926mg [Capsella rubella]
 gb|EOA21522.1| hypothetical protein CARUB_v10001926mg [Capsella rubella]
Length=219

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  V+++G VE+ +G H    +GIF     + P +T+R+SI  GRT   S KV   +
Sbjct  40   GIYHSGVEVHG-VEYGFGAHEHSTTGIFEVEPKQCPGFTFRKSILIGRTDLDSDKVRSFM  98

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +++ G+ Y L+++N  HFC ++  +L    +P W +RLA  G
Sbjct  99   EKLAEDYSGNTYHLITKNCNHFCNDVCVQLTRRSIPNWVNRLARFG  144



>gb|AFK46726.1| unknown [Lotus japonicus]
Length=217

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 62/106 (58%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+ +G H    +GIF       P +T+R+S+  G T   +  V  ++
Sbjct  39   GVYHSGVQVHG-VEYGFGAHERSTTGIFEVEPGHCPGFTFRKSVYIGSTDLGAKDVRALM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L  E+PG+ Y L+ +N  HFC ++  KL    +P W +RLA +G
Sbjct  98   EKLAAEYPGNTYHLIQKNCNHFCNDVCNKLTGKSIPRWVNRLARLG  143



>ref|XP_009593660.1| PREDICTED: deSI-like protein At4g17486 [Nicotiana tomentosiformis]
Length=223

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  V ++G VE+A+G H    +GIF     + P +T+R+SI  GRT     +V   +
Sbjct  37   GVYHSGVHVHG-VEYAFGAHEHPTTGIFEVEPKQCPGFTFRKSILIGRTDLGPKEVRAFM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G  Y+L+++N  HFC ++  +L    +P W +RLA +G
Sbjct  96   EKLAEEYTGHSYNLITKNCNHFCSDVCVRLTGKPIPRWVNRLARLG  141



>ref|XP_009797716.1| PREDICTED: deSI-like protein At4g17486 isoform X1 [Nicotiana 
sylvestris]
Length=227

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 73/147 (50%), Gaps = 18/147 (12%)
 Frame = +3

Query  51   SKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGH  230
            S  + VIL++YDLT + +      +                G+FH  ++++G +E+ YG 
Sbjct  20   SYESPVILNVYDLTPANQYTVWFGF----------------GIFHSGIEVHG-MEYGYGA  62

Query  231  RD-KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  407
             D   SG+F       P + YR SIP GR     S+    L+ +  E+ GD Y L+S+N 
Sbjct  63   HDFPISGVFEVEPKSCPGFIYRCSIPLGRIKMPPSEFQAFLENMASEYHGDTYHLISKNC  122

Query  408  KHFCQELLEKLGVPKLPAWAHRLANVG  488
             HF  ++ ++L    +P W +RLA VG
Sbjct  123  NHFTDDIAQRLTGKGIPGWVNRLARVG  149



>ref|XP_003544599.1| PREDICTED: deSI-like protein At4g17486-like isoform X1 [Glycine 
max]
 gb|KHN04156.1| UPF0326 protein [Glycine soja]
Length=215

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 61/106 (58%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+ +G H    +GIF       P +T+R+SI  G T      V + +
Sbjct  37   GVYHSGVQVHG-VEYGFGAHERDTTGIFEVEPGHCPGFTFRKSIFIGSTDMGPKDVRVFM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            + L DE+ G+ Y L+ +N  HFC++L  +L    +P W +RLA +G
Sbjct  96   ERLADEYSGNTYHLIQKNCNHFCEDLCFRLTGKSIPRWVNRLARLG  141



>ref|XP_010421363.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
Length=218

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  V+++G VE+ +G H    +GIF     + P +T+R+SI  GRT     KV   +
Sbjct  40   GIYHSGVEVHG-VEYGFGAHDHSTTGIFEVEPKQCPGFTFRKSILIGRTDLDPEKVRAFM  98

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P+W +RLA  G
Sbjct  99   EKLAEEYSGNTYHLITKNCNHFCNDVCVQLTRRSIPSWVNRLARFG  144



>ref|XP_008228762.1| PREDICTED: deSI-like protein At4g17486 [Prunus mume]
Length=224

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G H    +GIF     K   +T+R+SI  G+T     +V  ++
Sbjct  37   GVYHSGVQVHG-VEYAFGAHEYPTTGIFEGEPKKCDGFTFRKSILIGKTDVGPLEVRAVM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            +EL +++ G+ Y+L+++N  HFC +   +L    +P+W +RLA +G
Sbjct  96   EELAEQYKGNAYNLITKNCNHFCNDACVRLTGNSIPSWVNRLARIG  141



>ref|XP_010089948.1| hypothetical protein L484_014459 [Morus notabilis]
 gb|EXB38644.1| hypothetical protein L484_014459 [Morus notabilis]
Length=231

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G H    +GIF       P +T+R+SI  GRT     +V  ++
Sbjct  39   GVYHSGVQVHG-VEYAFGAHDHSTTGIFEVEPKLCPGFTFRKSILIGRTDLGPKEVRSLM  97

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +++ G+ Y L+++N  HFC ++  KL    +P W +RLA +G
Sbjct  98   EKLAEDYSGNTYHLITKNCNHFCNDVSLKLTGKPIPRWVNRLARLG  143



>ref|XP_006846873.1| hypothetical protein AMTR_s00150p00063670 [Amborella trichopoda]
 gb|ERN08454.1| hypothetical protein AMTR_s00150p00063670 [Amborella trichopoda]
Length=220

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 63/106 (59%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  VQ++G VE+A+G H    +GIF     K P + +R+SI  GR+  +  +V  ++
Sbjct  38   GIYHSGVQVHG-VEYAFGAHEHSSTGIFETEPRKCPGFVFRKSILIGRSGLNPKEVRSLM  96

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L  E+ G+ Y L+ +N  HFC +   KL    +P W +RLA +G
Sbjct  97   EQLASEYTGNSYHLIMKNCNHFCNDACIKLTGNPIPRWVNRLARIG  142



>ref|XP_005704609.1| hypothetical protein Gasu_44260 [Galdieria sulphuraria]
 gb|EME28089.1| hypothetical protein Gasu_44260 [Galdieria sulphuraria]
Length=180

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 75/141 (53%), Gaps = 9/141 (6%)
 Frame = +3

Query  60   TEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRDK  239
            T V+LH+YDL       D V  +    N L+  G+   G FH  V+I+G+ E+++G  + 
Sbjct  13   TPVVLHVYDLIHP----DEVERLRKVNNYLILFGL---GFFHSGVEIFGK-EYSFGANNS  64

Query  240  -GSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
              +G+FS P  +     YR+SI  G T  S  +V  +++ +  E+PG  YSL   N  HF
Sbjct  65   METGVFSVPPKQTVGAIYRQSILIGETLYSEHEVEHLIRIVAAEYPGSSYSLFYNNCNHF  124

Query  417  CQELLEKLGVPKLPAWAHRLA  479
              +L E+L    +P W +RLA
Sbjct  125  SNDLCERLCGKSIPKWINRLA  145



>ref|NP_568467.1| PPPDE putative thiol peptidase family protein [Arabidopsis thaliana]
 gb|AAQ89667.1| At5g25170 [Arabidopsis thaliana]
 dbj|BAD94368.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD94825.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93408.1| PPPDE putative thiol peptidase family protein [Arabidopsis thaliana]
Length=218

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  V+++G VE+ +G H    +GIF     + P +T+R+SI  GRT      V + +
Sbjct  40   GIYHSGVEVHG-VEYGFGAHDHSTTGIFEVEPKQCPGFTFRKSILIGRTDLDPENVRVFM  98

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P+W +RLA  G
Sbjct  99   EKLAEEYSGNSYHLITKNCNHFCNDVCVQLTRRSIPSWVNRLARFG  144



>ref|XP_010493765.1| PREDICTED: deSI-like protein At4g17486 [Camelina sativa]
Length=218

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G++H  V+++G VE+ +G H    +GIF     + P +T+R+SI  GRT     KV   +
Sbjct  40   GIYHSGVEVHG-VEYGFGAHDHSTTGIFEVEPKQCPGFTFRKSILIGRTDLDPEKVRAFM  98

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y L+++N  HFC ++  +L    +P+W +RLA  G
Sbjct  99   EKLAEEYSGNTYHLITKNCNHFCNDVCVQLTRRSIPSWVNRLARFG  144



>gb|KEH40779.1| PPPDE thiol peptidase family protein, putative [Medicago truncatula]
Length=247

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 77/150 (51%), Gaps = 18/150 (12%)
 Frame = +3

Query  60   TEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYGHRD-  236
            T V L++YDLT       TVN        +   G+   G+FH  V++YG VE+A+G  D 
Sbjct  41   TPVYLNVYDLT-------TVN------GYMYWAGV---GIFHTGVEVYG-VEYAFGAHDY  83

Query  237  KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNSKHF  416
              SG+F     + P + +R+SI  G T+    ++   ++    ++ GD Y L+ +N  HF
Sbjct  84   PSSGVFEVEPRQCPGFKFRKSIFMGTTNLDPFQIREFMENQSAKYNGDSYHLIVKNCNHF  143

Query  417  CQELLEKLGVPKLPAWAHRLANVGDAAKDV  506
            C+++  KL    +P W +RLA +G     +
Sbjct  144  CEDICYKLTGNSIPKWVNRLARIGSCCNCI  173



>ref|XP_007154966.1| hypothetical protein PHAVU_003G161600g [Phaseolus vulgaris]
 ref|XP_007154967.1| hypothetical protein PHAVU_003G161600g [Phaseolus vulgaris]
 ref|XP_007154968.1| hypothetical protein PHAVU_003G161600g [Phaseolus vulgaris]
 ref|XP_007154969.1| hypothetical protein PHAVU_003G161600g [Phaseolus vulgaris]
 gb|ESW26960.1| hypothetical protein PHAVU_003G161600g [Phaseolus vulgaris]
 gb|ESW26961.1| hypothetical protein PHAVU_003G161600g [Phaseolus vulgaris]
 gb|ESW26962.1| hypothetical protein PHAVU_003G161600g [Phaseolus vulgaris]
 gb|ESW26963.1| hypothetical protein PHAVU_003G161600g [Phaseolus vulgaris]
Length=224

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYGHRD-KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            G+FH  ++++G+ E+ +G  D   SG+F     K P + YR SI  G+T+ S+S+    +
Sbjct  48   GIFHSGIEVHGK-EYGFGAHDFPASGVFEVEPRKCPGFVYRCSITLGQTNMSASEFRTFI  106

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            + +  E+ GD Y L+++N  HF ++L  +L   ++P W +RLA +G
Sbjct  107  ENMASEYHGDTYHLITKNCNHFTEDLSNRLTGKQIPGWVNRLAKLG  152



>ref|XP_009032864.1| hypothetical protein AURANDRAFT_6216, partial [Aureococcus anophagefferens]
 gb|EGB12460.1| hypothetical protein AURANDRAFT_6216, partial [Aureococcus anophagefferens]
Length=135

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 73/147 (50%), Gaps = 15/147 (10%)
 Frame = +3

Query  57   MTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDG--INLGGVFHVAVQIYGEVEWAYGH  230
            +  V LH+YD+  S           V   ++   G     GGVFH A+++YG+ E+ +  
Sbjct  1    VAPVTLHVYDVGRS-----------VHTGRINSFGAATRAGGVFHGAIEVYGK-EFTFAG  48

Query  231  RDKG-SGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRNS  407
             +K   GIFS    K P +TYRESI  G    +  +   IL  +  +W    Y+L+ +N 
Sbjct  49   SNKAMPGIFSSNPRKCPFHTYRESIYLGDCGLTRRQTLAILHRMAADWMAPTYNLLLKNC  108

Query  408  KHFCQELLEKLGVPKLPAWAHRLANVG  488
              FC+E   +LGV  +P W + LA VG
Sbjct  109  CFFCKEFALELGVGTIPGWVYELAKVG  135



>ref|XP_006427585.1| hypothetical protein CICLE_v10027044mg [Citrus clementina]
 gb|ESR40825.1| hypothetical protein CICLE_v10027044mg [Citrus clementina]
Length=224

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G H    +GIF     +   +T+R+SI  G+T    ++V  ++
Sbjct  37   GVYHSGVQVHG-VEYAFGAHEYPTTGIFEGEPKQCEGFTFRKSILIGKTDIGPAEVRTVM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y+L+++N  HFC +   +L    +P+W +RLA +G
Sbjct  96   EDLAEEYKGNAYNLITKNCNHFCNDACIRLTGNPIPSWVNRLARIG  141



>ref|XP_006465205.1| PREDICTED: deSI-like protein At4g17486-like [Citrus sinensis]
Length=224

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 67/106 (63%), Gaps = 2/106 (2%)
 Frame = +3

Query  174  GVFHVAVQIYGEVEWAYG-HRDKGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLIL  350
            GV+H  VQ++G VE+A+G H    +GIF     +   +T+R+SI  G+T    ++V  ++
Sbjct  37   GVYHSGVQVHG-VEYAFGAHEYPTTGIFEGEPKQCEGFTFRKSILIGKTDMGPAEVRTVM  95

Query  351  KELRDEWPGDEYSLVSRNSKHFCQELLEKLGVPKLPAWAHRLANVG  488
            ++L +E+ G+ Y+L+++N  HFC +   +L    +P+W +RLA +G
Sbjct  96   EDLAEEYKGNAYNLITKNCNHFCNDACIRLTGNPIPSWVNRLARIG  141



>gb|EPS65739.1| hypothetical protein M569_09039, partial [Genlisea aurea]
Length=253

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 77/150 (51%), Gaps = 18/150 (12%)
 Frame = +3

Query  48   ISKMTEVILHIYDLTMSGKGNDTVNYMVVQMNKLLKDGINLGGVFHVAVQIYGEVEWAYG  227
            + K + V L++YDLT        VN  V         G+   G+FH  V+++G VE+A+G
Sbjct  35   VRKTSNVYLNVYDLT-------AVNGYVYWA------GL---GIFHSGVEVHG-VEYAFG  77

Query  228  HRD-KGSGIFSCPATKNPNYTYRESIPAGRTHCSSSKVNLILKELRDEWPGDEYSLVSRN  404
              D   SG+F     + P + +R+SI  G T     KV   ++ L   + GD Y L+ +N
Sbjct  78   AHDFSSSGVFEVEPRQCPGFNFRKSILIGTTTMDPFKVRHFIERLAANYNGDTYHLIVKN  137

Query  405  SKHFCQELLEKLGVPKLPAWAHRLANVGDA  494
              HFC ++  KL   K+P W +R+A +G A
Sbjct  138  CNHFCDDVCYKLTGNKIPDWVNRMAKLGKA  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905