BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF047E03

Length=249
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|WP_039310890.1|  hypothetical protein                             96.7    1e-21   
emb|CDJ03953.1|  tubulin alpha chain                                  96.3    3e-21   
emb|CDS16437.1|  tubulin alpha chain                                  96.3    3e-21   Echinococcus granulosus
gb|ACN40426.1|  unknown                                               94.4    4e-21   Picea sitchensis
emb|CBI29424.3|  unnamed protein product                              94.0    5e-21   Vitis vinifera
emb|CBI22190.3|  unnamed protein product                              94.4    6e-21   Vitis vinifera
emb|CBI19330.3|  unnamed protein product                              94.4    6e-21   Vitis vinifera
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                   94.0    6e-21   
gb|AAN33000.1|  alpha-tubulin 4                                       93.6    6e-21   Gossypium hirsutum [American cotton]
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like            94.7    7e-21   Oryza brachyantha
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g           94.7    7e-21   Phaseolus vulgaris [French bean]
ref|XP_003608582.1|  Tubulin alpha-5 chain                            94.7    7e-21   Medicago truncatula
ref|XP_007047652.1|  Tubulin alpha-2 chain                            95.5    7e-21   
emb|CDY25017.1|  BnaC02g39910D                                        94.4    7e-21   Brassica napus [oilseed rape]
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...  94.4    8e-21   
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...  94.4    9e-21   Brassica rapa
emb|CDY29334.1|  BnaA05g16010D                                        94.4    9e-21   Brassica napus [oilseed rape]
emb|CDY66630.1|  BnaCnng51680D                                        94.4    9e-21   Brassica napus [oilseed rape]
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like            94.4    1e-20   
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2        94.0    1e-20   
ref|XP_010104543.1|  Tubulin alpha chain                              94.4    1e-20   
gb|AGV54441.1|  tubulin alpha-2 chain-like protein                    94.4    1e-20   Phaseolus vulgaris [French bean]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975           94.4    1e-20   Selaginella moellendorffii
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                   94.4    1e-20   Fragaria vesca subsp. vesca
gb|KHN01709.1|  Tubulin alpha chain                                   94.4    1e-20   Glycine soja [wild soybean]
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like              94.4    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...  94.4    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like              94.4    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1        94.4    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like              94.4    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...  94.4    1e-20   Brassica rapa
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like              94.4    1e-20   Phoenix dactylifera
gb|AID52921.1|  tubulin alpha chain                                   94.4    1e-20   Carthamus tinctorius
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like            94.4    1e-20   
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                 94.4    1e-20   Malus domestica [apple tree]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                       94.4    1e-20   Jatropha curcas
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                   94.4    1e-20   Eucalyptus grandis [rose gum]
gb|ACN40181.1|  unknown                                               94.4    1e-20   Picea sitchensis
ref|XP_002522104.1|  tubulin alpha chain, putative                    94.4    1e-20   Ricinus communis
gb|ACJ60905.1|  alpha tubulin                                         94.4    1e-20   Betula pendula [white birch]
gb|AAO73546.1|  alpha-tubulin                                         94.4    1e-20   Ceratopteris richardii
ref|NP_171974.1|  tubulin alpha-4 chain                               94.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g           94.4    1e-20   Phaseolus vulgaris [French bean]
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg           94.4    1e-20   Citrus clementina [clementine]
ref|XP_007032501.1|  Tubulin alpha-2 chain                            94.4    1e-20   
ref|XP_007042689.1|  Tubulin alpha-2 chain                            94.4    1e-20   Theobroma cacao [chocolate]
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg           94.4    1e-20   Capsella rubella
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like            94.4    1e-20   Fragaria vesca subsp. vesca
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg           94.4    1e-20   Prunus persica
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg           94.4    1e-20   Prunus persica
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like            94.4    1e-20   Cucumis sativus [cucumbers]
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...  94.4    1e-20   Gossypium hirsutum [American cotton]
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...  94.4    1e-20   Gossypium hirsutum [American cotton]
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...  94.4    1e-20   Glycine max [soybeans]
gb|ABO47739.1|  alpha-tubulin                                         94.4    1e-20   Gossypium hirsutum [American cotton]
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                   94.4    1e-20   Vitis vinifera
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                        94.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KJB29387.1|  hypothetical protein B456_005G097800                  94.4    1e-20   Gossypium raimondii
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like            94.4    1e-20   Populus euphratica
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                 94.4    1e-20   Populus euphratica
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like              94.4    1e-20   Elaeis guineensis
gb|KHG20487.1|  Tubulin alpha chain                                   94.4    1e-20   Gossypium arboreum [tree cotton]
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like            94.4    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like              94.4    1e-20   Nelumbo nucifera [Indian lotus]
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like            94.4    1e-20   Nicotiana sylvestris
ref|XP_009618479.1|  PREDICTED: tubulin alpha-3 chain-like            94.4    1e-20   Nicotiana tomentosiformis
dbj|BAP59012.1|  alpha tubulin                                        94.4    1e-20   Taxus cuspidata [ichii]
ref|XP_002510010.1|  tubulin alpha chain, putative                    94.4    1e-20   Ricinus communis
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g           94.4    1e-20   Populus trichocarpa [western balsam poplar]
gb|AAO23139.1|  alpha tubulin                                         94.4    1e-20   Populus tremuloides
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g           94.4    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010093625.1|  Tubulin alpha chain                              94.4    1e-20   Morus notabilis
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g           94.4    1e-20   Phaseolus vulgaris [French bean]
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg           94.4    1e-20   Eutrema salsugineum [saltwater cress]
ref|XP_007018369.1|  Tubulin alpha-2 chain                            94.4    1e-20   Theobroma cacao [chocolate]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                 94.4    1e-20   Fragaria vesca subsp. vesca
gb|AGG37287.1|  alpha-tubulin 5                                       94.4    1e-20   Salix arbutifolia
gb|AGG37285.1|  alpha-tubulin 3                                       94.4    1e-20   Salix arbutifolia
gb|AGG37283.1|  alpha-tubulin 1                                       94.4    1e-20   Salix arbutifolia
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...  94.4    1e-20   Gossypium hirsutum [American cotton]
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729           94.4    1e-20   Selaginella moellendorffii
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285           94.4    1e-20   Selaginella moellendorffii
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864           94.4    1e-20   
gb|ABX57816.1|  alpha tubulin                                         94.4    1e-20   Picea wilsonii
gb|ABO47737.1|  alpha-tubulin                                         94.4    1e-20   Gossypium hirsutum [American cotton]
gb|ABK92552.1|  unknown                                               94.4    1e-20   Populus trichocarpa [western balsam poplar]
gb|ABV55999.1|  alpha-tubulin 7                                       94.4    1e-20   Populus tremuloides
gb|ABQ59633.1|  alpha-tubulin 3                                       94.4    1e-20   Populus tremuloides
gb|ABQ59634.1|  alpha-tubulin 5                                       94.4    1e-20   Populus tremuloides
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                 94.4    1e-20   Vitis vinifera
gb|AAV92352.1|  alpha tubulin 1                                       94.4    1e-20   Pseudotsuga menziesii var. menziesii
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like              94.4    1e-20   Fragaria vesca subsp. vesca
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...  94.4    1e-20   
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1      94.4    1e-20   Glycine max [soybeans]
gb|AAV33983.1|  alpha tubulin                                         89.0    1e-20   Pinus taeda
gb|ABD94137.1|  alpha tubulin                                         88.2    1e-20   Cathaya argyrophylla
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2   94.0    1e-20   
gb|AAG49533.3|  alpha tubulin                                         92.4    1e-20   Glossina morsitans morsitans
gb|KJB58757.1|  hypothetical protein B456_009G224800                  93.6    1e-20   Gossypium raimondii
gb|AHJ80818.1|  Tua1                                                  92.8    1e-20   Eragrostis tef [tef]
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2      94.0    1e-20   Tarenaya hassleriana [spider flower]
gb|AAB84298.1|  tubulin                                               94.0    2e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_008475351.1|  PREDICTED: tubulin alpha-1 chain-like            92.4    2e-20   
gb|ESU44180.1|  Tubulin alpha chain                                   94.0    2e-20   Giardia intestinalis
dbj|BAE01779.1|  unnamed protein product                              92.0    2e-20   Macaca fascicularis [crab eating macaque]
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                 93.2    2e-20   Citrus sinensis [apfelsine]
ref|XP_005461213.1|  PREDICTED: tubulin alpha-1A chain-like           92.0    2e-20   
gb|ETE59910.1|  Tubulin alpha-1A chain                                92.4    2e-20   Ophiophagus hannah
ref|XP_010096739.1|  Tubulin alpha chain                              94.0    2e-20   
ref|NP_001275271.1|  alpha-tubulin-like protein                       94.0    2e-20   Solanum tuberosum [potatoes]
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                   94.0    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979           94.0    2e-20   Selaginella moellendorffii
ref|XP_007426287.1|  PREDICTED: tubulin alpha-1C chain                92.0    2e-20   Python bivittatus
ref|XP_005801995.1|  PREDICTED: tubulin alpha-1A chain-like           92.0    2e-20   
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like              94.0    2e-20   Elaeis guineensis
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like              94.0    2e-20   Vitis vinifera
gb|KDP41548.1|  hypothetical protein JCGZ_15955                       94.0    2e-20   Jatropha curcas
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like              94.0    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005896455.1|  PREDICTED: tubulin alpha-1C chain-like           94.0    2e-20   Bos mutus
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                   93.6    2e-20   Sesamum indicum [beniseed]
gb|KHG18997.1|  Tubulin alpha chain                                   93.6    2e-20   Gossypium arboreum [tree cotton]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1   93.6    2e-20   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like              93.6    2e-20   Cucumis sativus [cucumbers]
gb|ABO47740.1|  alpha-tubulin                                         93.6    2e-20   Gossypium hirsutum [American cotton]
gb|ABO47736.1|  alpha-tubulin                                         93.6    2e-20   Gossypium hirsutum [American cotton]
ref|XP_002110664.1|  alpha tubulin                                    92.0    2e-20   Trichoplax adhaerens
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...  93.6    2e-20   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg           93.6    2e-20   Citrus clementina [clementine]
gb|AIJ27191.1|  alpha-tubulin 1a                                      92.0    2e-20   Mytilus galloprovincialis
emb|CBI25125.3|  unnamed protein product                              92.8    2e-20   Vitis vinifera
gb|AAT77078.1|  alpha tubulin                                         90.9    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2   93.6    2e-20   
ref|NP_001051132.1|  Os03g0726100                                     93.6    2e-20   
gb|ABF13307.1|  alpha-tubulin                                         89.4    2e-20   Phaseolus vulgaris [French bean]
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...  93.6    2e-20   
ref|XP_008172101.1|  PREDICTED: tubulin alpha-1B chain                92.0    2e-20   Chrysemys picta bellii
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2      93.6    2e-20   Brassica rapa
gb|AII97815.1|  BLTX443                                               92.0    2e-20   Nephila pilipes
ref|XP_007634877.1|  PREDICTED: tubulin alpha-1A chain isoform X3     92.0    2e-20   
ref|XP_011366648.1|  PREDICTED: tubulin alpha-1C chain-like           92.0    2e-20   Pteropus vampyrus
gb|ABF98643.1|  Tubulin alpha-1 chain, putative, expressed            93.2    2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|ESU39295.1|  Tubulin alpha chain                                   94.0    2e-20   Giardia intestinalis
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2      93.2    2e-20   
gb|AFW67748.1|  alpha tubulin4                                        92.4    2e-20   
ref|XP_009246735.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...  92.0    3e-20   
gb|EDL87015.1|  rCG50513, isoform CRA_a                               92.0    3e-20   Rattus norvegicus [brown rat]
emb|CAA62916.1|  alpha-tubulin                                        93.2    3e-20   Oryza sativa Japonica Group [Japonica rice]
gb|AAH33064.1|  TUBA1C protein                                        92.0    3e-20   Homo sapiens [man]
emb|CDP00974.1|  unnamed protein product                              93.2    3e-20   Coffea canephora [robusta coffee]
ref|XP_007073037.1|  PREDICTED: tubulin alpha-1C chain                92.0    3e-20   
ref|XP_003770912.1|  PREDICTED: tubulin alpha-1C chain                92.0    3e-20   
ref|XP_010995722.1|  PREDICTED: tubulin alpha-1B chain                92.0    3e-20   Camelus dromedarius [camel]
ref|XP_006264719.1|  PREDICTED: tubulin alpha-1A chain                92.0    3e-20   
gb|EKC22339.1|  Tubulin alpha chain                                   91.7    3e-20   Crassostrea gigas
gb|EHB00536.1|  Tubulin alpha-1C chain                                93.2    3e-20   Heterocephalus glaber [naked mole rat]
gb|KFO33466.1|  Tubulin alpha-1C chain                                92.0    3e-20   Fukomys damarensis [Damara mole rat]
ref|XP_002599490.1|  hypothetical protein BRAFLDRAFT_81006            92.0    3e-20   Branchiostoma floridae
gb|AFW67749.1|  alpha tubulin4                                        92.0    3e-20   
ref|XP_008575749.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...  92.0    3e-20   Galeopterus variegatus [Malayan flying lemur]
gb|EUB56387.1|  Tubulin alpha-1C chain                                95.1    3e-20   Echinococcus granulosus
ref|XP_011475942.1|  PREDICTED: tubulin alpha chain-like              92.0    3e-20   
dbj|BAJ06362.1|  alpha-tubulin                                        93.2    3e-20   Alopecurus aequalis
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                 93.2    3e-20   Brachypodium distachyon [annual false brome]
ref|XP_001764722.1|  predicted protein                                93.2    3e-20   
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like            93.2    3e-20   Setaria italica
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                  93.2    3e-20   Arabis alpina [alpine rockcress]
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570        93.2    3e-20   
ref|XP_006974484.1|  PREDICTED: tubulin alpha-1A chain-like           92.0    3e-20   Peromyscus maniculatus bairdii
gb|AAH21564.1|  TUBA1B protein                                        92.0    3e-20   Homo sapiens [man]
ref|XP_005801996.1|  PREDICTED: tubulin alpha-1B chain-like           91.3    3e-20   
gb|ACU24494.1|  unknown                                               90.1    3e-20   Glycine max [soybeans]
ref|XP_005139691.1|  PREDICTED: tubulin alpha-1B chain-like           92.4    3e-20   
gb|ACU18775.1|  unknown                                               90.5    3e-20   Glycine max [soybeans]
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...  93.2    3e-20   
ref|XP_006168270.1|  PREDICTED: tubulin alpha-2 chain-like            92.0    3e-20   
gb|AFX62866.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila melanogaster
gb|AFX62864.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila melanogaster
gb|AFX62863.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila melanogaster
gb|AFX62862.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila melanogaster
gb|AFX62861.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila melanogaster
gb|AFX62860.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila melanogaster
gb|AFX62859.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila melanogaster
gb|AFX62858.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila melanogaster
gb|AFX62805.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62804.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62802.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62800.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62799.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62798.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62797.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62796.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62795.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62793.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62792.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62791.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62790.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62789.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62788.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62787.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62786.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62785.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|AFX62784.1|  alpha tubulin 84B                                     92.4    3e-20   Drosophila simulans
gb|KDP32140.1|  hypothetical protein JCGZ_12601                       92.8    3e-20   Jatropha curcas
dbj|BAC24800.1|  alpha tubulin                                        92.8    3e-20   Physcomitrella patens
gb|AAT77076.1|  alpha tubulin                                         88.6    3e-20   Oryza sativa Japonica Group [Japonica rice]
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                 92.8    3e-20   Citrus sinensis [apfelsine]
ref|XP_004817225.1|  PREDICTED: tubulin alpha-3 chain-like            92.0    3e-20   
ref|XP_005324966.1|  PREDICTED: tubulin alpha-1B chain                91.7    3e-20   
ref|XP_007501738.1|  PREDICTED: tubulin alpha-4A chain isoform X2     93.2    3e-20   
gb|AIK29207.1|  putative alpha-tubulin                                91.3    4e-20   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010751708.1|  PREDICTED: tubulin alpha-1A chain-like           92.4    4e-20   
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like              92.8    4e-20   Populus euphratica
emb|CAN62392.1|  hypothetical protein VITISV_016172                   92.8    4e-20   Vitis vinifera
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like            92.8    4e-20   Oryza brachyantha
ref|XP_008412910.1|  PREDICTED: tubulin alpha-1B chain-like           92.0    4e-20   Poecilia reticulata
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg              92.4    4e-20   Erythranthe guttata [common monkey flower]
ref|XP_007248487.1|  PREDICTED: tubulin alpha-1B chain-like           92.0    4e-20   
gb|EGW14703.1|  Tubulin alpha chain, nucleomorph                      92.0    4e-20   Cricetulus griseus [Chinese hamsters]
ref|XP_005745106.1|  PREDICTED: tubulin alpha-1B chain-like           92.4    4e-20   
ref|XP_007606030.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...  92.0    4e-20   
gb|AFW67745.1|  alpha tubulin4                                        88.2    4e-20   
ref|XP_010995781.1|  PREDICTED: tubulin alpha-1A chain-like           92.0    4e-20   Camelus dromedarius [camel]
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                 92.8    4e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                   92.8    4e-20   Vitis vinifera
ref|XP_008702766.1|  PREDICTED: tubulin alpha-1B chain-like           92.0    4e-20   Ursus maritimus [white bear]
ref|XP_008317242.1|  PREDICTED: tubulin alpha-1C chain-like           91.3    4e-20   
dbj|BAE87851.1|  unnamed protein product                              92.0    4e-20   Macaca fascicularis [crab eating macaque]
ref|XP_008139124.1|  PREDICTED: tubulin alpha chain, testis-speci...  90.9    5e-20   
gb|AHJ80823.1|  Tua1                                                  92.8    5e-20   Eragrostis tef [tef]
gb|AHJ80822.1|  Tua1                                                  92.8    5e-20   Eragrostis tef [tef]
gb|AHJ80817.1|  Tua1                                                  92.8    5e-20   Eragrostis tef [tef]
gb|AHJ80815.1|  Tua1                                                  92.8    5e-20   Eragrostis tef [tef]
ref|NP_001167663.1|  tubulin alpha-3 chain                            92.8    5e-20   Zea mays [maize]
emb|CAA06619.1|  alpha-tubulin 1                                      92.8    5e-20   Eleusine indica [crabgrass]
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...  92.8    5e-20   Eleusine indica [crabgrass]
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like            92.8    5e-20   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                 92.8    5e-20   Zea mays [maize]
gb|AFC88832.1|  putative tubulin alpha-3 chain                        92.8    5e-20   Miscanthus sinensis
tpg|DAA51109.1|  TPA: alpha tubulin                                   92.8    5e-20   
gb|AIX10966.1|  tubulin                                               92.8    5e-20   Ornithogalum longebracteatum [sea-onion]
emb|CAB66336.1|  alpha-tubulin                                        92.8    5e-20   Betula pendula [white birch]
ref|XP_004032593.1|  PREDICTED: tubulin alpha-3 chain-like            92.0    5e-20   
gb|AEJ38211.1|  tubulin                                               92.4    5e-20   Laodelphax striatella
ref|XP_005097255.1|  PREDICTED: tubulin alpha-1D chain-like isofo...  91.7    5e-20   
ref|NP_849388.1|  tubulin alpha-6 chain                               92.4    5e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AIV98130.1|  tubulin alpha-2                                       92.4    5e-20   Laodelphax striatella
ref|XP_002038709.1|  GM10965                                          92.4    5e-20   Drosophila sechellia
ref|NP_524264.1|  alpha-Tubulin at 84D                                92.4    5e-20   Drosophila melanogaster
dbj|BAN20459.1|  tubulin alpha chain                                  92.4    5e-20   Riptortus pedestris
ref|XP_003962331.1|  PREDICTED: tubulin alpha-1C chain-like           92.4    5e-20   Takifugu rubripes [tiger puffer]
gb|AAS55708.1|  alpha 2-tubulin                                       92.4    5e-20   Laodelphax striatella
ref|NP_476772.1|  alpha-Tubulin at 84B                                92.4    5e-20   Drosophila melanogaster
ref|XP_005354088.1|  PREDICTED: tubulin alpha-1B chain                91.7    5e-20   
ref|NP_998195.1|  tubulin alpha-1D chain                              92.4    5e-20   Danio rerio [leopard danio]
ref|XP_007456478.1|  PREDICTED: tubulin alpha-1B chain-like           92.4    5e-20   Lipotes vexillifer [baiji]
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like            92.4    5e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1      92.4    5e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                   92.4    5e-20   Nicotiana sylvestris
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                   92.4    5e-20   Nicotiana tomentosiformis
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                 92.4    5e-20   Brassica rapa
ref|XP_002517492.1|  tubulin alpha chain, putative                    92.4    5e-20   Ricinus communis
gb|ABB02631.1|  unknown                                               92.4    5e-20   Solanum tuberosum [potatoes]
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain              92.4    5e-20   Prunus dulcis [sweet almond]
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like            92.4    5e-20   
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like              92.4    5e-20   Solanum tuberosum [potatoes]
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                   92.4    5e-20   
gb|AGG37289.1|  alpha-tubulin 7                                       92.4    5e-20   Salix arbutifolia
ref|NP_193232.1|  tubulin alpha-6 chain                               92.4    5e-20   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB19779.1|  alpha tubulin                                        92.4    5e-20   Nicotiana tabacum [American tobacco]
gb|ABP65320.1|  alpha tubulin                                         92.4    5e-20   Capsicum annuum
emb|CAD13176.1|  alpha-tubulin                                        92.4    5e-20   Nicotiana tabacum [American tobacco]
ref|XP_002130303.1|  PREDICTED: tubulin alpha chain, testis-specific  92.4    5e-20   Ciona intestinalis [sea vase]
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like              92.4    5e-20   Elaeis guineensis
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                   92.4    5e-20   Populus euphratica
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                   92.4    5e-20   Nelumbo nucifera [Indian lotus]
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                   92.4    5e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1      92.4    5e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001067613.1|  Os11g0247300                                     92.4    5e-20   
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain           92.4    5e-20   Hordeum vulgare [barley]
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like            92.4    5e-20   
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein               92.4    5e-20   
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like              92.4    5e-20   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like            92.4    5e-20   
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain              92.4    5e-20   
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain           92.4    5e-20   
gb|ABK92520.1|  unknown                                               92.4    5e-20   
ref|XP_003603670.1|  Tubulin alpha-7 chain                            92.4    5e-20   
ref|NP_001289660.1|  tubulin alpha chain-like                         92.4    5e-20   
gb|ABD92930.1|  alpha tubulin-2A                                      92.4    5e-20   
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like            92.4    5e-20   
emb|CAA62917.1|  alfa-tubulin                                         92.4    5e-20   
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain             92.4    5e-20   
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g           92.4    5e-20   
gb|ETN59126.1|  tubulin alpha chain                                   91.3    5e-20   
ref|XP_006916969.1|  PREDICTED: tubulin alpha-1B chain                92.0    5e-20   
ref|XP_010751704.1|  PREDICTED: tubulin alpha chain                   91.3    5e-20   
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...  92.4    5e-20   
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2      92.0    5e-20   
ref|XP_001101935.1|  PREDICTED: tubulin alpha-3C/D chain-like iso...  92.0    5e-20   
ref|XP_006573681.1|  PREDICTED: tubulin alpha-2 chain-like isofor...  92.0    5e-20   
gb|AIX10773.1|  alpha tubulin                                         92.4    5e-20   
gb|AAX29832.1|  tubulin alpha 2                                       92.0    5e-20   
ref|XP_007936041.1|  PREDICTED: tubulin alpha-1A chain isoform X2     92.4    5e-20   
gb|AHJ80816.1|  Tua1                                                  92.4    6e-20   
ref|XP_002970006.1|  hypothetical protein SELMODRAFT_231415           91.7    6e-20   
ref|XP_004874971.1|  PREDICTED: tubulin alpha-3 chain-like            90.9    6e-20   
gb|ETE56023.1|  Tubulin alpha-1A chain                                87.4    6e-20   
dbj|BAE88902.1|  unnamed protein product                              87.0    6e-20   
gb|ACK76232.1|  alpha-tubulin                                         92.4    6e-20   
ref|XP_005097254.1|  PREDICTED: tubulin alpha-1D chain-like isofo...  91.7    6e-20   
gb|AAB08791.1|  alpha tubulin                                         92.4    6e-20   
gb|AGE09583.1|  TUA1-like protein                                     92.0    6e-20   
gb|ACO51588.1|  Tubulin alpha-1 chain                                 90.5    6e-20   
ref|XP_006794056.1|  PREDICTED: tubulin alpha-1C chain-like           90.9    6e-20   
gb|EAW58053.1|  tubulin, alpha 3, isoform CRA_b                       92.0    6e-20   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672           92.4    6e-20   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058           92.4    6e-20   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469            92.4    6e-20   
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509           92.4    6e-20   
ref|XP_001786415.1|  predicted protein                                88.2    6e-20   
pdb|4DRX|A  Chain A, Gtp-Tubulin In Complex With A Darpin             92.0    6e-20   
gb|AFV46219.1|  hypothetical protein                                  92.0    7e-20   
ref|XP_003759947.1|  PREDICTED: tubulin alpha-1C chain-like           92.0    7e-20   
gb|EPY73087.1|  hypothetical protein CB1_043508005                    86.7    7e-20   
ref|XP_005391932.1|  PREDICTED: tubulin alpha-3 chain-like            90.5    7e-20   
gb|EPQ14625.1|  Peripherin                                            93.2    7e-20   
pdb|3J6E|A  Chain A, Energy Minimized Average Structure Of Microt...  92.0    7e-20   
ref|XP_003801767.1|  PREDICTED: tubulin alpha-3C/D chain-like         92.0    7e-20   
ref|NP_001275472.1|  alpha-tubulin-like protein                       90.1    7e-20   
pdb|1TUB|A  Chain A, Tubulin Alpha-Beta Dimer, Electron Diffraction   92.0    7e-20   
sp|Q40832.1|TBA2_PELFA  RecName: Full=Tubulin alpha-2 chain           92.0    7e-20   
emb|CBN77373.1|  alpha tubulin                                        92.0    7e-20   
emb|CBJ28184.1|  alpha tubulin                                        92.0    7e-20   
ref|XP_006752422.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...  92.0    7e-20   
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1      92.0    7e-20   
gb|AEE61427.1|  unknown                                               92.0    7e-20   
emb|CDP02221.1|  unnamed protein product                              92.0    7e-20   
gb|KHN42598.1|  Tubulin alpha-2 chain                                 92.0    7e-20   
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like            92.0    7e-20   
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...  92.0    7e-20   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136           92.0    7e-20   
ref|XP_004560331.1|  PREDICTED: tubulin alpha-1A chain-like           90.5    7e-20   
pdb|1Z2B|A  Chain A, Tubulin-Colchicine-Vinblastine: Stathmin-Lik...  92.0    7e-20   
ref|XP_011282203.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_010852034.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_010803242.1|  PREDICTED: tubulin alpha-1C chain isoform X1     92.0    7e-20   
ref|XP_010594690.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_010348076.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_010383709.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_009001973.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...  92.0    7e-20   
ref|XP_008580941.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_008144051.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_002718632.1|  PREDICTED: tubulin alpha-1C chain-like           92.0    7e-20   
ref|NP_919369.2|  tubulin alpha-1C chain                              92.0    7e-20   
pdb|3DU7|A  Chain A, Tubulin-Colchicine-Phomopsin A: Stathmin-Lik...  92.0    7e-20   
ref|NP_001029376.1|  tubulin alpha-1C chain                           92.0    7e-20   
ref|XP_003223237.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_007107561.1|  PREDICTED: tubulin alpha-1C chain isoform X1     92.0    7e-20   
ref|XP_006916875.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_006812427.1|  PREDICTED: tubulin alpha-1D chain-like           92.0    7e-20   
ref|NP_116093.1|  tubulin alpha-1C chain isoform c                    92.0    7e-20   
ref|XP_006168269.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_006213088.1|  PREDICTED: tubulin alpha-1C chain-like           92.0    7e-20   
ref|XP_006131233.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_006109687.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...  92.0    7e-20   
ref|XP_005680058.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_005532034.1|  PREDICTED: tubulin alpha-1C chain isoform X1     92.0    7e-20   
ref|XP_005324967.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_005353993.1|  PREDICTED: tubulin alpha-1C chain isoform X1     92.0    7e-20   
ref|XP_005061430.1|  PREDICTED: tubulin alpha-1C chain-like isofo...  92.0    7e-20   
ref|XP_004880760.1|  PREDICTED: tubulin alpha-1C chain isoform X1     92.0    7e-20   
ref|XP_004805867.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_004447014.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_004429035.1|  PREDICTED: tubulin alpha-1C chain isoform 1      92.0    7e-20   
dbj|BAE39705.1|  unnamed protein product                              92.0    7e-20   
ref|NP_001011995.1|  tubulin alpha-1C chain                           92.0    7e-20   
ref|NP_989078.1|  tubulin, alpha 1c                                   92.0    7e-20   
ref|NP_033474.1|  tubulin alpha-1C chain                              92.0    7e-20   
ref|NP_001095253.1|  tubulin alpha chain                              92.0    7e-20   
ref|XP_003825879.1|  PREDICTED: tubulin alpha-1C chain isoform X2     92.0    7e-20   
ref|XP_003355423.1|  PREDICTED: tubulin alpha-1C chain isoformX1      92.0    7e-20   
tpg|DAA32343.1|  TPA: tubulin alpha-1C chain-like                     92.0    7e-20   
ref|XP_001861873.1|  tubulin alpha-2 chain                            92.0    7e-20   
ref|XP_001504231.1|  PREDICTED: tubulin alpha-1C chain isoform 1      92.0    7e-20   
ref|XP_001790595.1|  PREDICTED: tubulin alpha-1C chain-like isofo...  92.0    7e-20   
dbj|BAD96744.1|  tubulin alpha 6 variant                              92.0    7e-20   
gb|AAB84143.1|  alpha-tubulin                                         92.0    7e-20   
ref|NP_001165669.1|  tubulin, alpha 3e                                92.0    7e-20   
emb|CDQ56615.1|  unnamed protein product                              91.7    7e-20   
ref|XP_011496739.1|  PREDICTED: tubulin alpha-1 chain                 92.0    7e-20   
ref|XP_011286227.1|  PREDICTED: tubulin alpha-3 chain                 92.0    7e-20   
ref|XP_010876510.1|  PREDICTED: tubulin alpha chain, testis-speci...  92.0    7e-20   
ref|XP_010641177.1|  PREDICTED: tubulin alpha-3 chain                 92.0    7e-20   
ref|XP_009424945.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...  92.0    7e-20   
ref|XP_009441600.1|  PREDICTED: tubulin alpha-3 chain                 92.0    7e-20   
ref|XP_008989316.1|  PREDICTED: tubulin alpha-3 chain                 92.0    7e-20   
gb|AIL52742.1|  putative alpha-tubulin                                92.0    7e-20   
ref|XP_008561381.1|  PREDICTED: tubulin alpha-3 chain                 92.0    7e-20   
ref|XP_008558997.1|  PREDICTED: tubulin alpha-1 chain                 92.0    7e-20   
ref|XP_008288436.1|  PREDICTED: tubulin alpha-1B chain-like           92.0    7e-20   
sp|Q6PEY2.2|TBA3E_HUMAN  RecName: Full=Tubulin alpha-3E chain; Al...  92.0    7e-20   
ref|XP_003399700.1|  PREDICTED: tubulin alpha-1 chain-like            92.0    7e-20   
gb|AAX29538.1|  tubulin alpha 6                                       92.0    7e-20   
ref|XP_422851.1|  PREDICTED: tubulin alpha-3 chain                    92.0    7e-20   
ref|NP_001033252.1|  tubulin alpha-3 chain                            92.0    7e-20   
ref|NP_997195.1|  tubulin alpha-3E chain                              92.0    7e-20   
gb|AAH57810.1|  Tubulin, alpha 3d                                     92.0    7e-20   
ref|XP_005809818.1|  PREDICTED: tubulin alpha-1B chain-like           92.0    7e-20   
ref|XP_005084109.1|  PREDICTED: tubulin alpha-3 chain-like            92.0    7e-20   
ref|XP_004863093.1|  PREDICTED: tubulin alpha-1B chain-like           92.0    7e-20   
ref|XP_004878662.1|  PREDICTED: tubulin alpha-3 chain-like isofor...  92.0    7e-20   
ref|XP_004569650.1|  PREDICTED: tubulin alpha chain-like              92.0    7e-20   
ref|XP_006035257.1|  PREDICTED: tubulin alpha-1B chain                92.0    7e-20   
ref|NP_001118163.1|  tubulin alpha chain, testis-specific             92.0    7e-20   
ref|NP_033472.1|  tubulin alpha-3 chain                               92.0    7e-20   
ref|XP_004880763.1|  PREDICTED: tubulin alpha-1B chain-like           92.0    7e-20   
dbj|BAK63748.1|  tubulin alpha-2 chain                                92.0    7e-20   
ref|XP_003279191.1|  PREDICTED: tubulin alpha-3C/D chain-like         92.0    7e-20   
ref|XP_006675832.1|  tubulin, alpha, ubiquitous                       92.0    7e-20   
ref|XP_003243865.1|  PREDICTED: tubulin alpha-1C chain                92.0    7e-20   
ref|XP_001607699.1|  PREDICTED: tubulin alpha-1 chain                 92.0    7e-20   
ref|XP_001604160.1|  PREDICTED: tubulin alpha-1 chain-like            92.0    7e-20   
gb|ABM55668.1|  putative alpha-tubulin                                92.0    7e-20   
gb|EAW55606.1|  hCG1992406, isoform CRA_a                             92.0    7e-20   
ref|XP_966407.1|  PREDICTED: tubulin alpha-1A chain                   92.0    7e-20   
dbj|BAE02042.1|  unnamed protein product                              92.0    7e-20   
ref|XP_001705720.1|  Alpha-tubulin                                    92.0    7e-20   
gb|EFO61705.1|  Alpha-tubulin                                         92.0    7e-20   
gb|AAK51091.1|  alpha tubulin                                         87.0    7e-20   
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2   91.7    7e-20   
ref|NP_001292201.1|  tubulin alpha-1 chain                            92.0    7e-20   
ref|XP_011428863.1|  PREDICTED: tubulin alpha-1A chain                92.0    7e-20   
ref|XP_011233044.1|  PREDICTED: tubulin alpha-1B chain                92.0    7e-20   
ref|XP_009861085.1|  PREDICTED: tubulin alpha chain, testis-speci...  92.0    7e-20   
ref|XP_009861084.1|  PREDICTED: tubulin alpha chain, testis-specific  92.0    7e-20   
gb|KFM79250.1|  Tubulin alpha chain                                   92.0    7e-20   
ref|XP_008831083.1|  PREDICTED: tubulin alpha-1B chain-like           92.0    7e-20   
ref|XP_008831082.1|  PREDICTED: tubulin alpha-1B chain                92.0    7e-20   
ref|XP_008400581.1|  PREDICTED: tubulin alpha-1B chain-like           92.0    7e-20   
ref|XP_008069065.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...  92.0    7e-20   
ref|XP_002752478.1|  PREDICTED: tubulin alpha-1A chain                92.0    7e-20   
ref|XP_002714140.1|  PREDICTED: tubulin alpha-1B chain-like           92.0    7e-20   
ref|XP_002738175.1|  PREDICTED: tubulin alpha-1A chain-like isofo...  92.0    7e-20   
ref|XP_002732020.1|  PREDICTED: tubulin alpha-1A chain-like           92.0    7e-20   
ref|XP_006811914.1|  PREDICTED: tubulin alpha-1A chain-like           92.0    7e-20   
ref|XP_002129440.1|  PREDICTED: tubulin alpha-1A chain                92.0    7e-20   
ref|XP_002110662.1|  conserved hypothetical protein                   92.0    7e-20   
ref|NP_001098596.2|  tubulin alpha-1B chain                           92.0    7e-20   
gb|AAH62238.1|  Tubulin, alpha 1A                                     92.0    7e-20   
gb|AAA91576.1|  alpha-tubulin                                         92.0    7e-20   
ref|XP_005986295.1|  PREDICTED: tubulin alpha-1A chain-like           92.0    7e-20   
gb|AAA74395.1|  alpha-tubulin                                         92.0    7e-20   
ref|XP_007566938.1|  PREDICTED: tubulin alpha-1A chain-like           92.0    7e-20   
ref|XP_007426281.1|  PREDICTED: tubulin alpha-1A chain isoform X3     92.0    7e-20   
ref|XP_007235803.1|  PREDICTED: tubulin alpha chain-like isoform X2   92.0    7e-20   
ref|XP_007198449.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...  92.0    7e-20   
ref|XP_007179355.1|  PREDICTED: tubulin alpha-1B chain                92.0    7e-20   
ref|XP_006054596.1|  PREDICTED: tubulin alpha-1B chain                92.0    7e-20   
ref|XP_007073038.1|  PREDICTED: tubulin alpha-1A chain-like           92.0    7e-20   
ref|XP_007073036.1|  PREDICTED: tubulin alpha-1A chain-like           92.0    7e-20   
gb|AHJ25700.1|  alpha-tubulin                                         92.0    7e-20   
sp|P02550.1|TBA1A_PIG  RecName: Full=Tubulin alpha-1A chain; AltN...  92.0    7e-20   
pdb|1JFF|A  Chain A, Refined Structure Of Alpha-beta Tubulin From...  92.0    7e-20   
pdb|1SA0|A  Chain A, Tubulin-Colchicine: Stathmin-Like Domain Com...  92.0    7e-20   
ref|NP_035784.1|  tubulin alpha-1B chain                              92.0    7e-20   
ref|XP_006008956.1|  PREDICTED: tubulin alpha-1A chain-like           92.0    7e-20   
ref|XP_005981039.1|  PREDICTED: tubulin alpha-1B chain-like           92.0    7e-20   
ref|XP_005896454.1|  PREDICTED: tubulin alpha-1A chain-like           92.0    7e-20   
ref|XP_005709455.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...  92.0    7e-20   
ref|XP_004863092.1|  PREDICTED: tubulin alpha-1A chain-like           92.0    7e-20   
ref|XP_004880762.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...  92.0    7e-20   
ref|XP_004616768.1|  PREDICTED: tubulin alpha-1B chain isoform X1     92.0    7e-20   
ref|XP_004429038.1|  PREDICTED: tubulin alpha-1B chain                92.0    7e-20   
ref|XP_004429037.1|  PREDICTED: tubulin alpha-1A chain                92.0    7e-20   
ref|XP_004400918.1|  PREDICTED: tubulin alpha-1B chain-like           92.0    7e-20   
ref|XP_004400917.1|  PREDICTED: tubulin alpha-1B chain-like           92.0    7e-20   
gb|ELU02861.1|  hypothetical protein CAPTEDRAFT_161855                92.0    7e-20   
gb|ELT87969.1|  hypothetical protein CAPTEDRAFT_156933                92.0    7e-20   
emb|CAJ38791.1|  alpha tubulin protein                                92.0    7e-20   
dbj|BAE40598.1|  unnamed protein product                              92.0    7e-20   
dbj|BAE37745.1|  unnamed protein product                              92.0    7e-20   
dbj|BAE26417.1|  unnamed protein product                              92.0    7e-20   
dbj|BAE30708.1|  unnamed protein product                              92.0    7e-20   
dbj|BAE34741.1|  unnamed protein product                              92.0    7e-20   
dbj|BAE29999.1|  unnamed protein product                              92.0    7e-20   
ref|NP_001029267.1|  tubulin alpha-1B chain                           92.0    7e-20   
ref|NP_035783.1|  tubulin alpha-1A chain                              92.0    7e-20   
prf||0812252A  tubulin alpha                                          92.0    7e-20
sp|P36220.1|TBA_TORMA  RecName: Full=Tubulin alpha chain; AltName...  92.0    7e-20   
ref|NP_001191499.1|  tubulin alpha-1 chain                            92.0    7e-20   
ref|XP_003939173.1|  PREDICTED: tubulin alpha-1A chain                92.0    7e-20   
ref|XP_003793653.1|  PREDICTED: tubulin alpha-1C chain isoform 2      92.0    7e-20   
ref|XP_003726964.1|  PREDICTED: tubulin alpha-1C chain-like isofo...  92.0    7e-20   
emb|CCG28032.1|  alpha tubulin 5                                      92.0    7e-20   
ref|XP_005324965.1|  PREDICTED: tubulin alpha-1A chain                92.0    7e-20   
dbj|BAK03519.1|  predicted protein                                    92.0    7e-20   
ref|XP_011067628.1|  PREDICTED: tubulin alpha-1 chain-like            92.0    7e-20   
emb|CAO79602.1|  alpha-tubulin                                        92.0    7e-20   
dbj|BAF82043.1|  unnamed protein product                              92.0    7e-20   
gb|AAI51892.1|  MGC171407 protein                                     92.0    7e-20   



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +1

Query  118  AKMRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            +KMRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  3    SKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  46



>emb|CDJ03953.1| tubulin alpha chain [Echinococcus multilocularis]
 emb|CDS41235.1| tubulin alpha chain [Echinococcus multilocularis]
Length=510

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  112  SFAKMRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            SF KMRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  56   SFFKMRECISIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI  101



>emb|CDS16437.1| tubulin alpha chain [Echinococcus granulosus]
Length=510

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  112  SFAKMRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            SF KMRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  56   SFFKMRECISIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI  101



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score = 94.0 bits (232),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTI  42



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score = 94.0 bits (232),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score = 93.6 bits (231),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+HIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_006650518.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTV  42



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTV  42



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTV  42



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  SSNSSFAKMRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            +  S+  KMRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSD TV
Sbjct  43   AGQSNHEKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTV  92



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_009124557.1| PREDICTED: tubulin alpha-6 chain-like isoform X2 [Brassica rapa]
Length=431

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score = 94.4 bits (233),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_006601463.1| PREDICTED: tubulin alpha-3 chain-like [Glycine max]
Length=432

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AGV54441.1| tubulin alpha-2 chain-like protein [Phaseolus vulgaris]
Length=448

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|KHN01709.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_007155784.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
 gb|ESW27778.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_003524707.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Glycine max]
 gb|KHN47565.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_009779180.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana sylvestris]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_009618479.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana tomentosiformis]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AAO23139.1| alpha tubulin [Populus tremuloides]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_002989731.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
 ref|XP_002991763.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ07167.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ09208.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_002989721.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
 ref|XP_002993678.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ05267.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ09198.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|ABO47737.1| alpha-tubulin [Gossypium hirsutum]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AAV33983.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33984.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33985.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33986.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33987.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33988.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33989.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33990.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33991.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33992.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33993.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33994.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33995.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33996.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33997.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33998.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV33999.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34000.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34001.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34002.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34003.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34004.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34005.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34006.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34007.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34008.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34009.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34010.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34011.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34012.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34013.1| alpha tubulin, partial [Pinus taeda]
 gb|AAV34014.1| alpha tubulin, partial [Pinus taeda]
 gb|AHY28653.1| alpha-tubulin, partial [Pinus echinata]
 gb|AHY28654.1| alpha-tubulin, partial [Pinus echinata]
 gb|AHY28655.1| alpha-tubulin, partial [Pinus elliottii]
 gb|AHY28656.1| alpha-tubulin, partial [Pinus elliottii]
 gb|AHY28657.1| alpha-tubulin, partial [Pinus palustris]
 gb|AHY28658.1| alpha-tubulin, partial [Pinus palustris]
 gb|AHY28659.1| alpha-tubulin, partial [Pinus taeda]
 gb|AHY28660.1| alpha-tubulin, partial [Pinus taeda]
Length=95

 Score = 89.0 bits (219),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|ABD94137.1| alpha tubulin [Cathaya argyrophylla]
 gb|ABD94138.1| alpha tubulin [Cathaya argyrophylla]
Length=59

 Score = 88.2 bits (217),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AAG49533.3| alpha tubulin [Glossina morsitans morsitans]
Length=278

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+HIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AHJ80818.1| Tua1, partial [Eragrostis tef]
Length=291

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>ref|XP_010531322.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Tarenaya hassleriana]
Length=454

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AAB84298.1| tubulin [Oryza sativa Indica Group]
Length=451

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSD+TV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTV  42



>ref|XP_008475351.1| PREDICTED: tubulin alpha-1 chain-like [Diaphorina citri]
Length=307

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|ESU44180.1| Tubulin alpha chain [Giardia intestinalis]
Length=461

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +1

Query  121  KMRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            KMRECIS+HIGQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  7    KMRECISVHIGQAGVQIGNACWELYCLEHGIQHDGQMPSDKTI  49



>dbj|BAE01779.1| unnamed protein product [Macaca fascicularis]
Length=251

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|KDO78780.1| hypothetical protein CISIN_1g037616mg, partial [Citrus sinensis]
Length=383

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+HIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_005461213.1| PREDICTED: tubulin alpha-1A chain-like [Oreochromis niloticus]
Length=252

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|ETE59910.1| Tubulin alpha-1A chain, partial [Ophiophagus hannah]
Length=310

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +1

Query  121  KMRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            K+RECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  124  KLRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  166


 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|NP_001275271.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABB72803.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=452

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_002972670.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
 ref|XP_002988134.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ10926.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ25891.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
Length=450

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_007426287.1| PREDICTED: tubulin alpha-1C chain [Python bivittatus]
Length=256

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_005801995.1| PREDICTED: tubulin alpha-1A chain-like, partial [Xiphophorus 
maculatus]
Length=256

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_005896455.1| PREDICTED: tubulin alpha-1C chain-like [Bos mutus]
Length=470

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  100  SSNSSFAKMRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            S  + F+  RECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  10   SQQTPFSPTRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  59



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+HIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+HIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+HIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+HIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+HIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+HIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_002110664.1| alpha tubulin [Trichoplax adhaerens]
 gb|EDV26668.1| alpha tubulin [Trichoplax adhaerens]
Length=265

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+HIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+HIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AIJ27191.1| alpha-tubulin 1a, partial [Mytilus galloprovincialis]
Length=271

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>emb|CBI25125.3| unnamed protein product [Vitis vinifera]
Length=375

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/41 (95%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKT  246
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKT
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT  41



>gb|AAT77078.1| alpha tubulin [Oryza sativa Japonica Group]
Length=195

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSD+TV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTV  42



>ref|XP_008440460.1| PREDICTED: tubulin alpha chain-like isoform X2 [Cucumis melo]
Length=437

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+HIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|NP_001051132.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|AAG16905.1|AF182523_1 alpha-tubulin [Oryza sativa]
 gb|AAS07163.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|AAT77077.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|ABF98642.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG78592.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF13046.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|EAY91719.1| hypothetical protein OsI_13361 [Oryza sativa Indica Group]
 gb|EAZ28437.1| hypothetical protein OsJ_12419 [Oryza sativa Japonica Group]
 gb|AFI71265.1| alpha tubulin [Oryza sativa Japonica Group]
Length=451

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSD+TV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTV  42



>gb|ABF13307.1| alpha-tubulin [Phaseolus vulgaris]
Length=132

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_010557536.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Tarenaya hassleriana]
Length=455

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_008172101.1| PREDICTED: tubulin alpha-1B chain [Chrysemys picta bellii]
Length=279

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_009107245.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Brassica rapa]
Length=459

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AII97815.1| BLTX443 [Nephila pilipes]
Length=274

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+H+GQAG+QVGNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISVHVGQAGVQVGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_007634877.1| PREDICTED: tubulin alpha-1A chain isoform X3 [Cricetulus griseus]
Length=288

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_011366648.1| PREDICTED: tubulin alpha-1C chain-like [Pteropus vampyrus]
Length=301

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|ABF98643.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=433

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSD+TV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTV  42



>gb|ESU39295.1| Tubulin alpha chain [Giardia intestinalis]
Length=511

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +1

Query  121  KMRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            KMRECIS+HIGQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  57   KMRECISVHIGQAGVQIGNACWELYCLEHGIQHDGQMPSDKTI  99



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFW67748.1| alpha tubulin4 [Zea mays]
Length=364

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>ref|XP_009246735.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-3C/D chain [Pongo 
abelii]
Length=319

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|EDL87015.1| rCG50513, isoform CRA_a [Rattus norvegicus]
Length=319

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>emb|CAA62916.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSD+TV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTV  42



>gb|AAH33064.1| TUBA1C protein [Homo sapiens]
Length=325

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>emb|CDP00974.1| unnamed protein product [Coffea canephora]
Length=450

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+HIGQAGIQVGNACWELYCL HGIQ DGQMPSD+TV
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTV  42



>ref|XP_007073037.1| PREDICTED: tubulin alpha-1C chain [Panthera tigris altaica]
Length=333

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_003770912.1| PREDICTED: tubulin alpha-1C chain [Sarcophilus harrisii]
Length=334

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_010995722.1| PREDICTED: tubulin alpha-1B chain, partial [Camelus dromedarius]
Length=339

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_006264719.1| PREDICTED: tubulin alpha-1A chain [Alligator mississippiensis]
Length=340

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|EKC22339.1| Tubulin alpha chain [Crassostrea gigas]
Length=294

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|EHB00536.1| Tubulin alpha-1C chain [Heterocephalus glaber]
Length=437

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 38/46 (83%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  112  SFAKMRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            S A MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  21   SRAIMRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  66



>gb|KFO33466.1| Tubulin alpha-1C chain [Fukomys damarensis]
Length=343

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_002599490.1| hypothetical protein BRAFLDRAFT_81006 [Branchiostoma floridae]
 gb|EEN55502.1| hypothetical protein BRAFLDRAFT_81006 [Branchiostoma floridae]
Length=343

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|AFW67749.1| alpha tubulin4 [Zea mays]
Length=321

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>ref|XP_008575749.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-3E chain [Galeopterus 
variegatus]
Length=308

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|EUB56387.1| Tubulin alpha-1C chain [Echinococcus granulosus]
Length=1453

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +1

Query  109   SSFAKMRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
             ++F+KMRECISIH+GQAG+Q+GNACWELYCL HGIQ +GQMPSDKT+
Sbjct  999   AAFSKMRECISIHVGQAGVQMGNACWELYCLEHGIQPNGQMPSDKTI  1045



>ref|XP_011475942.1| PREDICTED: tubulin alpha chain-like [Oryzias latipes]
Length=314

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>dbj|BAJ06362.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTV  42



>ref|XP_003560377.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=451

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTV  42



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP+DKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPADKTV  42



>ref|XP_004981922.1| PREDICTED: tubulin alpha-1 chain-like [Setaria italica]
 emb|CAE52515.1| alpha tubulin [Setaria viridis]
Length=451

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTV  42



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGN+CWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_002466535.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|EER93533.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|ACX70682.1| tubulin alpha-2-like protein [Sorghum bicolor]
Length=452

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTV  42



>ref|XP_006974484.1| PREDICTED: tubulin alpha-1A chain-like [Peromyscus maniculatus 
bairdii]
Length=327

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|AAH21564.1| TUBA1B protein [Homo sapiens]
 gb|AIC63288.1| TUBA1B, partial [synthetic construct]
Length=335

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_005801996.1| PREDICTED: tubulin alpha-1B chain-like, partial [Xiphophorus 
maculatus]
Length=255

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTL  42



>gb|ACU24494.1| unknown [Glycine max]
Length=173

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_005139691.1| PREDICTED: tubulin alpha-1B chain-like, partial [Melopsittacus 
undulatus]
Length=407

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +1

Query  121  KMRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            K+RECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  66   KLRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  108



>gb|ACU18775.1| unknown [Glycine max]
Length=202

 Score = 90.5 bits (223),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_006579968.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Glycine max]
Length=462

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 40/42 (95%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_006168270.1| PREDICTED: tubulin alpha-2 chain-like [Tupaia chinensis]
Length=369

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|AFX62866.1| alpha tubulin 84B, partial [Drosophila melanogaster]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62864.1| alpha tubulin 84B, partial [Drosophila melanogaster]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62863.1| alpha tubulin 84B, partial [Drosophila melanogaster]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62862.1| alpha tubulin 84B, partial [Drosophila melanogaster]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62861.1| alpha tubulin 84B, partial [Drosophila melanogaster]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62860.1| alpha tubulin 84B, partial [Drosophila melanogaster]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62859.1| alpha tubulin 84B, partial [Drosophila melanogaster]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62858.1| alpha tubulin 84B, partial [Drosophila melanogaster]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62805.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62804.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62802.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62800.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62799.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62798.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62797.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62796.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62795.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62793.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62792.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62791.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62790.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62789.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62788.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62787.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62786.1| alpha tubulin 84B, partial [Drosophila simulans]
 gb|AFX62794.1| alpha tubulin 84B, partial [Drosophila simulans]
 gb|AFX62803.1| alpha tubulin 84B, partial [Drosophila simulans]
 gb|AFX62806.1| alpha tubulin 84B, partial [Drosophila simulans]
 gb|AFX62865.1| alpha tubulin 84B, partial [Drosophila melanogaster]
 gb|AFX62867.1| alpha tubulin 84B, partial [Drosophila melanogaster]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62785.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|AFX62784.1| alpha tubulin 84B, partial [Drosophila simulans]
Length=415

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDK+V
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSV  42



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDK+V
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSV  42



>gb|AAT77076.1| alpha tubulin [Oryza sativa Japonica Group]
Length=128

 Score = 88.6 bits (218),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSD+TV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTV  42



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 39/41 (95%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKT  246
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKT
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT  41



>ref|XP_004817225.1| PREDICTED: tubulin alpha-3 chain-like [Mustela putorius furo]
Length=376

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_005324966.1| PREDICTED: tubulin alpha-1B chain [Ictidomys tridecemlineatus]
Length=294

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_007501738.1| PREDICTED: tubulin alpha-4A chain isoform X2 [Monodelphis domestica]
Length=467

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 38/53 (72%), Positives = 48/53 (91%), Gaps = 1/53 (2%)
 Frame = +1

Query  94   VCSSNSSFAK-MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            + +S++SFA+  RECIS+H+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  9    LATSSTSFAEYFRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI  61



>gb|AIK29207.1| putative alpha-tubulin, partial [Cynoglossus semilaevis]
Length=270

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTL  42



>ref|XP_010751708.1| PREDICTED: tubulin alpha-1A chain-like [Larimichthys crocea]
Length=403

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +1

Query  121  KMRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            K+RECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  124  KLRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  166


 Score = 92.0 bits (227),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP+DKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPNDKTV  42



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 39/41 (95%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKT  246
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKT
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT  41



>ref|XP_006650524.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQ GIQVGNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHIGQPGIQVGNACWELYCLEHGIQADGQMPSDKTV  42



>ref|XP_008412910.1| PREDICTED: tubulin alpha-1B chain-like [Poecilia reticulata]
Length=381

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+HIGQAGIQVGN+CWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISVHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_007248487.1| PREDICTED: tubulin alpha-1B chain-like, partial [Astyanax mexicanus]
Length=384

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|EGW14703.1| Tubulin alpha chain, nucleomorph [Cricetulus griseus]
Length=388

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_005745106.1| PREDICTED: tubulin alpha-1B chain-like [Pundamilia nyererei]
Length=426

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 36/43 (84%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +1

Query  121  KMRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            K+RECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  124  KLRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  166


 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 35/42 (83%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECIS+H+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_007606030.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-1A chain isoform 
X1 [Cricetulus griseus]
Length=392

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|AFW67745.1| alpha tubulin4 [Zea mays]
Length=111

 Score = 88.2 bits (217),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>ref|XP_010995781.1| PREDICTED: tubulin alpha-1A chain-like [Camelus dromedarius]
Length=396

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSD TV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDTTV  42



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 39/41 (95%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKT  246
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMPSDKT
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT  41



>ref|XP_008702766.1| PREDICTED: tubulin alpha-1B chain-like [Ursus maritimus]
Length=400

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_008317242.1| PREDICTED: tubulin alpha-1C chain-like, partial [Cynoglossus 
semilaevis]
Length=307

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTL  42



>dbj|BAE87851.1| unnamed protein product [Macaca fascicularis]
Length=385

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>ref|XP_008139124.1| PREDICTED: tubulin alpha chain, testis-specific-like [Eptesicus 
fuscus]
Length=257

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +1

Query  118  AKMRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            A+ RECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  19   ARKRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  62



>gb|AHJ80823.1| Tua1 [Eragrostis tef]
Length=451

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>gb|AHJ80822.1| Tua1 [Eragrostis tef]
Length=451

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>gb|AHJ80817.1| Tua1 [Eragrostis tef]
Length=451

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>gb|AHJ80815.1| Tua1 [Eragrostis tef]
Length=451

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>ref|NP_001167663.1| tubulin alpha-3 chain [Zea mays]
 gb|ACG26907.1| tubulin alpha-3 chain [Zea mays]
 gb|AFW67746.1| alpha tubulin4 isoform 1 [Zea mays]
 gb|AFW67747.1| alpha tubulin4 isoform 2 [Zea mays]
Length=451

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>emb|CAA06619.1| alpha-tubulin 1 [Eleusine indica]
Length=451

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>sp|O22347.1|TBA1_ELEIN RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Eleusine indica]
 gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
 emb|CAA06618.1| alpha-tubulin 1 [Eleusine indica]
 gb|AFC88823.1| putative tubulin alpha-1 chain [Miscanthus sinensis]
 gb|AFC88833.1| tubulin alpha-1 chain [Miscanthus sinensis]
Length=451

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>ref|XP_008665337.1| PREDICTED: tubulin alpha-1 chain-like [Zea mays]
 sp|P14640.1|TBA1_MAIZE RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Zea mays]
 emb|CAA33734.1| alpha1-tubulin [Zea mays]
 tpg|DAA51112.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51113.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51114.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51117.1| TPA: tubulin alpha-1 chain [Zea mays]
Length=451

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>ref|XP_008665339.1| PREDICTED: tubulin alpha-2 chain [Zea mays]
 sp|P14641.1|TBA2_MAIZE RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Zea mays]
 emb|CAA33733.1| alpha2-tubulin [Zea mays]
 tpg|DAA51111.1| TPA: tubulin alpha-2 chain [Zea mays]
Length=451

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>gb|AFC88832.1| putative tubulin alpha-3 chain [Miscanthus sinensis]
Length=451

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>tpg|DAA51109.1| TPA: alpha tubulin [Zea mays]
Length=452

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKT+
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTI  42



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGI+ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTV  42



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGI+ DGQMPSDKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTV  42



>ref|XP_004032593.1| PREDICTED: tubulin alpha-3 chain-like [Gorilla gorilla gorilla]
Length=406

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKT+
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI  42



>gb|AEJ38211.1| tubulin [Laodelphax striatella]
Length=449

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_005097255.1| PREDICTED: tubulin alpha-1D chain-like isoform X2 [Aplysia californica]
Length=387

 Score = 91.7 bits (226),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|NP_849388.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 dbj|BAH19475.1| AT4G14960 [Arabidopsis thaliana]
 gb|AEE83529.1| tubulin alpha-6 chain [Arabidopsis thaliana]
Length=427

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 39/42 (93%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIHIGQAGIQVGNACWELYCL HGIQ DGQMP DKTV
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTV  42



>gb|AIV98130.1| tubulin alpha-2 [Laodelphax striatella]
Length=450

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_002038709.1| GM10965 [Drosophila sechellia]
 ref|XP_002102496.1| GD19940 [Drosophila simulans]
 gb|EDW55246.1| GM10965 [Drosophila sechellia]
 gb|EDX11999.1| GD19940 [Drosophila simulans]
Length=450

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|NP_524264.1| alpha-Tubulin at 84D [Drosophila melanogaster]
 ref|XP_001979199.1| GG14119 [Drosophila erecta]
 ref|XP_002096643.1| GE24934 [Drosophila yakuba]
 sp|P06605.1|TBA3_DROME RecName: Full=Tubulin alpha-3 chain [Drosophila melanogaster]
 gb|AAA28987.1| alpha-tubulin 3 [Drosophila melanogaster]
 gb|AAF54007.1| alpha-Tubulin at 84D [Drosophila melanogaster]
 gb|AAL89946.1| SD07763p [Drosophila melanogaster]
 gb|AAO39634.1| AT26363p [Drosophila melanogaster]
 gb|AAV37003.1| LD07757p [Drosophila melanogaster]
 gb|EDV48157.1| GG14119 [Drosophila erecta]
 gb|EDW96355.1| GE24934 [Drosophila yakuba]
 gb|ACL86275.1| alphaTub84D-PA, partial [synthetic construct]
 gb|ACL90967.1| alphaTub84D-PA [synthetic construct]
Length=450

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>dbj|BAN20459.1| tubulin alpha chain [Riptortus pedestris]
Length=450

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



>ref|XP_003962331.1| PREDICTED: tubulin alpha-1C chain-like [Takifugu rubripes]
Length=450

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +1

Query  124  MRECISIHIGQAGIQVGNACWELYCLXHGIQLDGQMPSDKTV  249
            MRECISIH+GQAG+Q+GNACWELYCL HGIQ DGQMPSDKTV
Sbjct  1    MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTV  42



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555840426830