BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF047D04

Length=608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248008.1|  PREDICTED: phosphoglucan, water dikinase, ch...    206   3e-57   Solanum lycopersicum
ref|XP_009777858.1|  PREDICTED: phosphoglucan, water dikinase, ch...    203   2e-56   Nicotiana sylvestris
ref|XP_009599199.1|  PREDICTED: phosphoglucan, water dikinase, ch...    196   6e-54   Nicotiana tomentosiformis
ref|XP_006358812.1|  PREDICTED: phosphoglucan, water dikinase, ch...    191   4e-52   Solanum tuberosum [potatoes]
ref|XP_006358813.1|  PREDICTED: phosphoglucan, water dikinase, ch...    191   4e-52   Solanum tuberosum [potatoes]
ref|NP_001274870.1|  glucan/water dikinase                              191   5e-52   Solanum tuberosum [potatoes]
emb|CBI39424.3|  unnamed protein product                                173   8e-46   Vitis vinifera
ref|XP_002265211.1|  PREDICTED: phosphoglucan, water dikinase, ch...    172   1e-45   Vitis vinifera
ref|XP_002518612.1|  chloroplast alpha-glucan water dikinase, put...    171   6e-45   Ricinus communis
ref|XP_002301739.2|  hypothetical protein POPTR_0002s23550g             167   1e-43   
emb|CDP10310.1|  unnamed protein product                                166   3e-43   Coffea canephora [robusta coffee]
ref|XP_011000022.1|  PREDICTED: LOW QUALITY PROTEIN: phosphogluca...    165   6e-43   Populus euphratica
ref|XP_011042749.1|  PREDICTED: phosphoglucan, water dikinase, ch...    165   6e-43   Populus euphratica
gb|EYU23932.1|  hypothetical protein MIMGU_mgv1a000391mg                162   7e-42   Erythranthe guttata [common monkey flower]
ref|XP_002320442.2|  hypothetical protein POPTR_0014s14510g             161   1e-41   
ref|XP_010069404.1|  PREDICTED: phosphoglucan, water dikinase, ch...    161   1e-41   Eucalyptus grandis [rose gum]
gb|KJB37917.1|  hypothetical protein B456_006G226300                    160   4e-41   Gossypium raimondii
gb|KJB37918.1|  hypothetical protein B456_006G226300                    159   4e-41   Gossypium raimondii
gb|KHF99077.1|  Phosphoglucan, water dikinase, chloroplastic -lik...    159   4e-41   Gossypium arboreum [tree cotton]
gb|KJB71923.1|  hypothetical protein B456_011G147600                    159   6e-41   Gossypium raimondii
gb|KJB71922.1|  hypothetical protein B456_011G147600                    159   6e-41   Gossypium raimondii
gb|KJB71921.1|  hypothetical protein B456_011G147600                    159   6e-41   Gossypium raimondii
ref|XP_011074900.1|  PREDICTED: phosphoglucan, water dikinase, ch...    159   7e-41   Sesamum indicum [beniseed]
ref|XP_010244064.1|  PREDICTED: phosphoglucan, water dikinase, ch...    158   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_007034117.1|  Catalytics,carbohydrate kinases,phosphoglucan      156   7e-40   
ref|XP_010673296.1|  PREDICTED: phosphoglucan, water dikinase, ch...    155   1e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010546804.1|  PREDICTED: phosphoglucan, water dikinase, ch...    154   6e-39   Tarenaya hassleriana [spider flower]
ref|XP_010546803.1|  PREDICTED: phosphoglucan, water dikinase, ch...    154   6e-39   Tarenaya hassleriana [spider flower]
ref|XP_008393849.1|  PREDICTED: phosphoglucan, water dikinase, ch...    151   3e-38   
ref|XP_008393850.1|  PREDICTED: phosphoglucan, water dikinase, ch...    151   3e-38   
gb|KDO57834.1|  hypothetical protein CISIN_1g015140mg                   147   4e-38   Citrus sinensis [apfelsine]
ref|XP_009371117.1|  PREDICTED: phosphoglucan, water dikinase, ch...    150   5e-38   Pyrus x bretschneideri [bai li]
ref|XP_009371116.1|  PREDICTED: phosphoglucan, water dikinase, ch...    151   5e-38   Pyrus x bretschneideri [bai li]
gb|KHG00248.1|  Phosphoglucan, water dikinase, chloroplastic -lik...    150   6e-38   Gossypium arboreum [tree cotton]
ref|XP_004296959.2|  PREDICTED: phosphoglucan, water dikinase, ch...    150   1e-37   Fragaria vesca subsp. vesca
ref|XP_010454991.1|  PREDICTED: phosphoglucan, water dikinase, ch...    149   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006493516.1|  PREDICTED: phosphoglucan, water dikinase, ch...    149   2e-37   Citrus sinensis [apfelsine]
gb|KDP32558.1|  hypothetical protein JCGZ_13108                         149   2e-37   Jatropha curcas
ref|XP_010551754.1|  PREDICTED: phosphoglucan, water dikinase, ch...    149   3e-37   Tarenaya hassleriana [spider flower]
ref|XP_010454990.1|  PREDICTED: phosphoglucan, water dikinase, ch...    149   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006421076.1|  hypothetical protein CICLE_v10004968mg             143   4e-37   
ref|XP_006421074.1|  hypothetical protein CICLE_v10004968mg             143   4e-37   
ref|XP_006421075.1|  hypothetical protein CICLE_v10004968mg             144   7e-37   
gb|AFO83531.1|  glucan water dikinase 3                                 147   1e-36   Manihot esculenta [manioc]
ref|XP_010493901.1|  PREDICTED: phosphoglucan, water dikinase, ch...    147   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010493900.1|  PREDICTED: phosphoglucan, water dikinase, ch...    147   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010107197.1|  Phosphoglucan, water dikinase                      146   1e-36   
gb|AAC26245.1|  contains similarity glycosyl hydrolases                 143   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008222722.1|  PREDICTED: phosphoglucan, water dikinase, ch...    145   3e-36   Prunus mume [ume]
ref|XP_007225436.1|  hypothetical protein PRUPE_ppa000429mg             145   7e-36   Prunus persica
ref|XP_002872212.1|  hypothetical protein ARALYDRAFT_489476             144   8e-36   
ref|XP_006845104.1|  hypothetical protein AMTR_s00005p00168970          144   9e-36   Amborella trichopoda
ref|XP_004497421.1|  PREDICTED: phosphoglucan, water dikinase, ch...    144   1e-35   
ref|XP_004497422.1|  PREDICTED: phosphoglucan, water dikinase, ch...    144   1e-35   Cicer arietinum [garbanzo]
ref|XP_006394878.1|  hypothetical protein EUTSA_v10003634mg             143   2e-35   
ref|NP_001119280.1|  phosphoglucan, water dikinase                      142   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009416602.1|  PREDICTED: phosphoglucan, water dikinase, ch...    143   2e-35   
ref|NP_198009.3|  phosphoglucan, water dikinase                         143   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010907528.1|  PREDICTED: phosphoglucan, water dikinase, ch...    141   7e-35   
gb|KFK26410.1|  hypothetical protein AALP_AA8G245000                    139   5e-34   Arabis alpina [alpine rockcress]
ref|XP_009111699.1|  PREDICTED: phosphoglucan, water dikinase, ch...    139   5e-34   Brassica rapa
ref|XP_010424348.1|  PREDICTED: phosphoglucan, water dikinase, ch...    139   5e-34   Camelina sativa [gold-of-pleasure]
emb|CDY19771.1|  BnaA09g04240D                                          139   6e-34   Brassica napus [oilseed rape]
ref|XP_006286926.1|  hypothetical protein CARUB_v10000070mg             138   1e-33   Capsella rubella
gb|ABK26307.1|  unknown                                                 130   2e-33   Picea sitchensis
emb|CDX87051.1|  BnaC09g03660D                                          137   3e-33   
ref|XP_007142602.1|  hypothetical protein PHAVU_007G001400g             136   4e-33   Phaseolus vulgaris [French bean]
gb|AAU93516.1|  chloroplast alpha-glucan water dikinase isoform 3       135   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008454006.1|  PREDICTED: phosphoglucan, water dikinase, ch...    135   1e-32   Cucumis melo [Oriental melon]
emb|CDY65142.1|  BnaC02g48400D                                          135   1e-32   Brassica napus [oilseed rape]
ref|XP_008799788.1|  PREDICTED: phosphoglucan, water dikinase, ch...    134   2e-32   
gb|ABR17706.1|  unknown                                                 129   3e-32   Picea sitchensis
gb|ABG21981.1|  chloroplast alpha-glucan water dikinase isoform 3...    132   5e-32   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066613.1|  Os12g0297500                                       134   5e-32   
ref|XP_009129923.1|  PREDICTED: phosphoglucan, water dikinase, ch...    132   1e-31   Brassica rapa
emb|CDY05529.1|  BnaA02g31620D                                          132   1e-31   
gb|KGN53052.1|  hypothetical protein Csa_4G012480                       132   2e-31   Cucumis sativus [cucumbers]
gb|KEH27294.1|  phosphoglucan, water dikinase                           130   6e-31   Medicago truncatula
gb|EEE53074.1|  hypothetical protein OsJ_35828                          130   6e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008454007.1|  PREDICTED: phosphoglucan, water dikinase, ch...    130   6e-31   Cucumis melo [Oriental melon]
ref|XP_006663965.1|  PREDICTED: phosphoglucan, water dikinase, ch...    129   1e-30   Oryza brachyantha
ref|XP_004152111.1|  PREDICTED: phosphoglucan, water dikinase, ch...    129   1e-30   
ref|XP_002453659.1|  hypothetical protein SORBIDRAFT_04g010020          129   2e-30   Sorghum bicolor [broomcorn]
ref|XP_004952076.1|  PREDICTED: phosphoglucan, water dikinase, ch...    129   3e-30   Setaria italica
gb|KHN37254.1|  Phosphoglucan, water dikinase, chloroplastic            128   3e-30   Glycine soja [wild soybean]
ref|XP_010228078.1|  PREDICTED: phosphoglucan, water dikinase, ch...    127   8e-30   Brachypodium distachyon [annual false brome]
gb|EMS54440.1|  Phosphoglucan, water dikinase, chloroplastic            127   1e-29   Triticum urartu
ref|XP_006589801.1|  PREDICTED: LOW QUALITY PROTEIN: phosphogluca...    126   2e-29   
gb|EEC69133.1|  hypothetical protein OsI_38056                          125   5e-29   Oryza sativa Indica Group [Indian rice]
gb|EPS59827.1|  glucan/water dikinase                                   119   1e-28   Genlisea aurea
gb|EMT02873.1|  Phosphoglucan, water dikinase, chloroplastic            123   1e-28   
ref|XP_008662597.1|  PREDICTED: phosphoglucan, water dikinase, ch...    113   1e-26   
ref|XP_002973212.1|  hypothetical protein SELMODRAFT_99378              109   2e-23   
ref|XP_002976638.1|  hypothetical protein SELMODRAFT_105597             108   2e-23   
ref|XP_001752167.1|  predicted protein                                  105   2e-22   
ref|XP_001758857.1|  predicted protein                                  100   2e-20   
ref|XP_010040448.1|  PREDICTED: phosphoglucan, water dikinase, ch...  76.6    3e-14   
gb|KIZ07735.1|  hypothetical protein MNEG_0234                        64.7    7e-09   Monoraphidium neglectum
ref|XP_009778046.1|  PREDICTED: uncharacterized protein LOC104227496  63.5    1e-08   Nicotiana sylvestris
ref|XP_005849428.1|  hypothetical protein CHLNCDRAFT_21770            63.2    3e-08   Chlorella variabilis
ref|WP_033217558.1|  cyclomaltodextrin glucanotransferase             58.5    4e-08   
gb|KIY94688.1|  hypothetical protein MNEG_13275                       58.9    2e-07   Monoraphidium neglectum
ref|XP_005849860.1|  hypothetical protein CHLNCDRAFT_57278            60.5    2e-07   Chlorella variabilis
ref|XP_002956065.1|  hypothetical protein VOLCADRAFT_97031            59.3    3e-07   Volvox carteri f. nagariensis
ref|XP_009587696.1|  PREDICTED: uncharacterized protein LOC104085387  58.9    4e-07   Nicotiana tomentosiformis
gb|KIZ07546.1|  hypothetical protein MNEG_0408                        58.2    9e-07   Monoraphidium neglectum
ref|XP_001696825.1|  hypothetical protein CHLREDRAFT_150073           57.8    1e-06   Chlamydomonas reinhardtii
ref|XP_001697099.1|  phosphoglucan water dikinase                     58.2    1e-06   Chlamydomonas reinhardtii
ref|XP_005642714.1|  starch-binding domain-like protein               56.6    1e-06   Coccomyxa subellipsoidea C-169
ref|WP_030916433.1|  hypothetical protein                             56.2    2e-06   Streptomyces sp. NRRL S-384
ref|XP_004302646.1|  PREDICTED: uncharacterized protein LOC101312742  57.0    2e-06   Fragaria vesca subsp. vesca
gb|ABK25218.1|  unknown                                               56.6    2e-06   Picea sitchensis
ref|WP_033216324.1|  hypothetical protein                             55.8    2e-06   Kitasatospora phosalacinea
emb|CBI30404.3|  unnamed protein product                              55.8    4e-06   Vitis vinifera
ref|WP_030918859.1|  cyclomaltodextrin glucanotransferase             52.8    4e-06   
ref|XP_002974170.1|  hypothetical protein SELMODRAFT_414445           55.5    6e-06   Selaginella moellendorffii
ref|XP_010654173.1|  PREDICTED: uncharacterized protein LOC104880162  55.5    6e-06   Vitis vinifera
ref|XP_001258586.1|  starch binding domain protein                    55.5    7e-06   Aspergillus fischeri NRRL 181
ref|XP_005844815.1|  hypothetical protein CHLNCDRAFT_54374            55.5    7e-06   Chlorella variabilis
gb|KIZ03831.1|  hypothetical protein MNEG_4121                        55.1    8e-06   Monoraphidium neglectum
ref|XP_004506775.1|  PREDICTED: protein ycf2-like isoform X1          55.1    8e-06   Cicer arietinum [garbanzo]
ref|XP_002968806.1|  hypothetical protein SELMODRAFT_440606           55.1    9e-06   Selaginella moellendorffii
emb|CAN60108.1|  hypothetical protein VITISV_044328                   55.1    9e-06   Vitis vinifera
gb|KJB46631.1|  hypothetical protein B456_007G379100                  54.7    1e-05   Gossypium raimondii
ref|XP_005844056.1|  hypothetical protein CHLNCDRAFT_139625           53.9    1e-05   Chlorella variabilis
ref|XP_001702927.1|  predicted protein                                52.4    1e-05   Chlamydomonas reinhardtii
gb|KJB46630.1|  hypothetical protein B456_007G379100                  53.9    2e-05   Gossypium raimondii
ref|XP_002963384.1|  hypothetical protein SELMODRAFT_438530           53.9    2e-05   
ref|WP_030499128.1|  alpha-amylase                                    54.3    2e-05   Micromonospora purpureochromogenes
ref|XP_005847512.1|  hypothetical protein CHLNCDRAFT_52636            53.9    2e-05   Chlorella variabilis
ref|XP_002974668.1|  hypothetical protein SELMODRAFT_415024           53.9    2e-05   
gb|KHN47425.1|  Phosphoglucan, water dikinase, chloroplastic          53.1    2e-05   Glycine soja [wild soybean]
gb|KIY98013.1|  hypothetical protein MNEG_9950                        53.1    3e-05   Monoraphidium neglectum
ref|XP_005644670.1|  hypothetical protein COCSUDRAFT_67495            53.5    3e-05   Coccomyxa subellipsoidea C-169
ref|XP_006398635.1|  hypothetical protein EUTSA_v10013736mg           53.5    3e-05   
ref|XP_007026748.1|  Carbohydrate-binding-like fold, putative iso...  53.5    3e-05   
ref|XP_007026749.1|  Carbohydrate-binding-like fold, putative iso...  53.5    3e-05   
dbj|GAM27795.1|  hypothetical protein SAMD00019534_109710             51.2    3e-05   Acytostelium subglobosum LB1
gb|KJB46629.1|  hypothetical protein B456_007G379100                  53.1    3e-05   Gossypium raimondii
ref|XP_001701978.1|  predicted protein                                50.4    3e-05   Chlamydomonas reinhardtii
ref|XP_004506776.1|  PREDICTED: protein ycf2-like isoform X2          53.5    3e-05   
ref|XP_002502726.1|  carbohydrate-binding module family 20 protein    52.8    4e-05   Micromonas commoda
emb|CAB42581.1|  putative degreening-enhanced protein                 52.0    4e-05   Auxenochlorella protothecoides
ref|WP_034223083.1|  glycosidase                                      53.1    5e-05   
ref|XP_006576534.1|  PREDICTED: phosphoglucan, water dikinase, ch...  52.0    5e-05   
ref|XP_006576539.1|  PREDICTED: phosphoglucan, water dikinase, ch...  52.0    5e-05   
ref|XP_005846256.1|  hypothetical protein CHLNCDRAFT_135558           52.8    6e-05   Chlorella variabilis
ref|WP_013286849.1|  MULTISPECIES: alpha-amylase                      52.8    6e-05   Micromonospora
gb|ESL03105.1|  alpha amylase, catalytic domain protein               52.8    6e-05   Catonella morbi ATCC 51271
ref|XP_006398636.1|  hypothetical protein EUTSA_v10013736mg           52.4    6e-05   
ref|XP_003520734.1|  PREDICTED: uncharacterized protein LOC100778097  52.4    7e-05   
ref|WP_030461968.1|  hypothetical protein                             51.6    8e-05   
gb|ACU23169.1|  unknown                                               52.4    8e-05   Glycine max [soybeans]
ref|XP_005644337.1|  hypothetical protein COCSUDRAFT_48869            52.4    8e-05   Coccomyxa subellipsoidea C-169
gb|KHG02392.1|  Phosphoglucan, water dikinase, chloroplastic -lik...  52.0    8e-05   Gossypium arboreum [tree cotton]
ref|XP_006576535.1|  PREDICTED: phosphoglucan, water dikinase, ch...  51.2    9e-05   
ref|WP_029664274.1|  glycosidase                                      52.4    9e-05   
gb|KHN46339.1|  Phosphoglucan, water dikinase, chloroplastic          52.0    9e-05   Glycine soja [wild soybean]
gb|KHN36405.1|  Phosphoglucan, water dikinase, chloroplastic          51.2    9e-05   Glycine soja [wild soybean]
ref|WP_026447047.1|  hypothetical protein                             52.4    9e-05   Acidobacteriaceae bacterium URHE0068
gb|KHN48367.1|  Alpha-amylase                                         52.0    1e-04   Glycine soja [wild soybean]
ref|XP_006576537.1|  PREDICTED: phosphoglucan, water dikinase, ch...  51.6    1e-04   
gb|KHN45754.1|  Phosphoglucan, water dikinase, chloroplastic          52.0    1e-04   Glycine soja [wild soybean]
gb|EHK25059.1|  glycoside hydrolase family 15 protein                 52.0    1e-04   Trichoderma virens Gv29-8
ref|XP_004183886.1|  hypothetical protein EIN_170650                  49.7    1e-04   Entamoeba invadens IP1
ref|WP_007544893.1|  cyclomaltodextrin glucanotransferase             52.0    1e-04   Haloferax larsenii
ref|XP_004538448.1|  PREDICTED: dentin sialophosphoprotein-like i...  52.0    1e-04   
gb|EQB53702.1|  glycosyl hydrolase family 15                          51.6    1e-04   Colletotrichum gloeosporioides Cg-14
ref|WP_022874232.1|  glycosidase                                      52.0    1e-04   
ref|XP_004246332.1|  PREDICTED: uncharacterized protein LOC101251213  51.6    1e-04   
ref|WP_034837471.1|  alpha-amylase [                                  52.0    1e-04   
emb|CDZ24376.1|  Cyclomaltodextrin glucanotransferase [ [             52.0    1e-04   [Clostridium] cellulosi
ref|XP_010543884.1|  PREDICTED: uncharacterized protein LOC104816652  51.6    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_007205350.1|  hypothetical protein PRUPE_ppa007150mg           51.6    1e-04   
gb|EMD46465.1|  starch binding domain containing protein              48.9    1e-04   Entamoeba histolytica KU27
ref|WP_008323077.1|  cyclomaltodextrin glucanotransferase             51.6    1e-04   Haloferax elongans
ref|XP_652601.2|  hypothetical protein                                48.9    1e-04   Entamoeba histolytica HM-1:IMSS
ref|XP_003516949.1|  PREDICTED: ribonuclease E/G-like protein, ch...  51.6    1e-04   Glycine max [soybeans]
ref|XP_006576533.1|  PREDICTED: phosphoglucan, water dikinase, ch...  51.2    2e-04   
ref|XP_001768545.1|  predicted protein                                51.2    2e-04   
ref|XP_002477993.1|  alpha-amylase, putative                          51.6    2e-04   Talaromyces stipitatus ATCC 10500
ref|XP_003051549.1|  hypothetical protein NECHADRAFT_92513            51.2    2e-04   [Nectria] haematococca mpVI 77-13-4
ref|XP_001270539.1|  glucan 1,4-alpha-glucosidase, putative           51.2    2e-04   Aspergillus clavatus NRRL 1
ref|XP_003060950.1|  carbohydrate-binding module family 20 protein    51.2    2e-04   Micromonas pusilla CCMP1545
ref|WP_038992291.1|  glycosidase                                      51.2    2e-04   
ref|XP_006576541.1|  PREDICTED: ribonuclease E/G-like protein, ch...  51.2    2e-04   
ref|XP_006366357.1|  PREDICTED: uncharacterized protein LOC102586811  51.2    2e-04   Solanum tuberosum [potatoes]
ref|XP_008243940.1|  PREDICTED: uncharacterized protein LOC103342132  51.2    2e-04   Prunus mume [ume]
ref|WP_035419445.1|  alpha-amylase                                    51.2    2e-04   
ref|XP_002502832.1|  carbohydrate-binding module family 20 protein    50.8    2e-04   Micromonas commoda
gb|EAY76546.1|  hypothetical protein OsI_04489                        50.8    2e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_004156602.1|  PREDICTED: uncharacterized LOC101213899          50.8    2e-04   
gb|EAZ14199.1|  hypothetical protein OsJ_04123                        50.8    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004137725.1|  PREDICTED: uncharacterized protein LOC101213899  50.8    3e-04   
ref|WP_030158763.1|  hypothetical protein                             50.8    3e-04   Glycomyces sp. NRRL B-16210
ref|WP_041648945.1|  glycosidase                                      50.8    3e-04   
ref|WP_028596875.1|  alpha-amylase                                    50.8    3e-04   Paenibacillus pasadenensis
gb|EWM63158.1|  alpha-amylase                                         50.8    3e-04   Micromonospora sp. M42
ref|WP_043323282.1|  alpha-amylase                                    50.8    3e-04   Micromonospora sp. M42
ref|WP_022110961.1|  4-alpha-glucanotransferase                       50.8    3e-04   
ref|WP_015794440.1|  alpha-amylase                                    50.8    3e-04   Catenulispora acidiphila
gb|KGO46641.1|  Glycoside hydrolase, family 13                        50.4    3e-04   Penicillium expansum
emb|CBT76664.1|  glycosyl hydrolase, family 13                        50.4    3e-04   Glutamicibacter arilaitensis Re117
ref|WP_035849789.1|  glycosidase                                      50.4    3e-04   Kitasatospora azatica
ref|XP_002951018.1|  hypothetical protein VOLCADRAFT_91596            50.4    3e-04   Volvox carteri f. nagariensis
ref|XP_002954891.1|  hypothetical protein VOLCADRAFT_118865           50.8    3e-04   Volvox carteri f. nagariensis
ref|WP_030583847.1|  hypothetical protein                             48.5    3e-04   
ref|XP_002947049.1|  hypothetical protein VOLCADRAFT_103274           50.4    3e-04   Volvox carteri f. nagariensis
dbj|GAM42477.1|  alpha-amylase                                        50.4    4e-04   Talaromyces cellulolyticus
ref|WP_012749393.1|  alpha-amylase                                    50.4    4e-04   Geobacillus sp. WCH70
ref|XP_002145753.1|  alpha-amylase, putative                          50.4    4e-04   Talaromyces marneffei ATCC 18224
ref|WP_029360941.1|  glycosidase                                      50.4    4e-04   
ref|XP_006848182.1|  hypothetical protein AMTR_s00029p00236780        50.1    4e-04   
ref|WP_013150819.1|  alpha-amylase                                    50.4    4e-04   Thermoanaerobacter mathranii
ref|WP_028991976.1|  alpha-amylase                                    50.4    4e-04   Thermoanaerobacter thermocopriae
ref|NP_001044849.1|  Os01g0856900                                     50.1    4e-04   
ref|XP_002584589.1|  glucoamylase                                     50.4    4e-04   Uncinocarpus reesii 1704
ref|XP_001273135.1|  Glycosyl hydrolase, family 15, putative          50.4    4e-04   Aspergillus clavatus NRRL 1
ref|XP_002873018.1|  glycoside hydrolase starch-binding domain-co...  50.1    4e-04   
ref|XP_006795663.1|  PREDICTED: dentin sialophosphoprotein-like       50.4    4e-04   Neolamprologus brichardi [lyretail cichlid]
ref|XP_001209972.1|  hypothetical protein ATEG_07286                  50.1    5e-04   Aspergillus terreus NIH2624
ref|XP_005729253.1|  PREDICTED: uncharacterized protein LOC102200471  50.1    5e-04   Pundamilia nyererei
ref|XP_005943798.1|  PREDICTED: dentin sialophosphoprotein-like       50.1    5e-04   Haplochromis burtoni
ref|WP_019418183.1|  hypothetical protein                             50.1    5e-04   Anoxybacillus kamchatkensis
ref|XP_011399502.1|  Phosphoglucan, water dikinase, chloroplastic     49.7    5e-04   Auxenochlorella protothecoides
ref|WP_004057795.1|  alpha-amylase                                    50.1    5e-04   Haloferax mediterranei
emb|CAI46245.1|  cyclomaltodextrin glucanotransferase precursor       50.1    5e-04   Haloferax mediterranei
gb|AGT45478.1|  CGTase                                                50.1    5e-04   Bacillus cereus
ref|WP_012269126.1|  MULTISPECIES: alpha-amylase                      50.1    5e-04   Thermoanaerobacter
sp|P19584.1|AMYB_THETU  RecName: Full=Thermophilic beta-amylase; ...  50.1    5e-04   Thermoanaerobacterium thermosulfurigenes
ref|XP_004366717.1|  kin17-like protein                               50.1    5e-04   Cavenderia fasciculata
gb|KDP24469.1|  hypothetical protein JCGZ_25033                       49.7    5e-04   Jatropha curcas
gb|KIY53725.1|  glycoside hydrolase family 13 protein                 50.1    5e-04   Fistulina hepatica ATCC 64428
pdb|2VN4|A  Chain A, Glycoside Hydrolase Family 15 Glucoamylase F...  50.1    5e-04   Trichoderma reesei
pdb|1CYG|A  Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.1...  50.1    6e-04   Geobacillus stearothermophilus
sp|P31797.1|CDGT_GEOSE  RecName: Full=Cyclomaltodextrin glucanotr...  50.1    6e-04   Geobacillus stearothermophilus
ref|XP_009377794.1|  PREDICTED: uncharacterized protein LOC103966354  49.7    6e-04   Pyrus x bretschneideri [bai li]
ref|WP_020710051.1|  hypothetical protein                             49.7    6e-04   Acidobacteriaceae bacterium KBS 83
ref|XP_001270422.1|  starch binding domain protein                    49.7    7e-04   Aspergillus clavatus NRRL 1
ref|XP_009344720.1|  PREDICTED: uncharacterized protein LOC103936...  49.7    7e-04   Pyrus x bretschneideri [bai li]
ref|NP_568087.1|  carbohydrate-binding domain-containing protein      49.3    7e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006576538.1|  PREDICTED: phosphoglucan, water dikinase, ch...  48.9    7e-04   
gb|KFY83798.1|  hypothetical protein V500_09893                       49.7    7e-04   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_008370075.1|  PREDICTED: uncharacterized protein LOC103433588  49.7    7e-04   
ref|XP_009344719.1|  PREDICTED: uncharacterized protein LOC103936...  49.7    7e-04   Pyrus x bretschneideri [bai li]
ref|XP_010037714.1|  PREDICTED: uncharacterized protein LOC104426...  49.3    7e-04   Eucalyptus grandis [rose gum]
ref|XP_008081828.1|  Six-hairpin glycosidase                          49.7    7e-04   Glarea lozoyensis ATCC 20868
gb|EEH40712.2|  glucoamylase                                          49.7    8e-04   Paracoccidioides lutzii Pb01
ref|WP_030462927.1|  alpha-amylase                                    49.7    8e-04   Kitasatospora sp. NRRL B-11411
ref|XP_007273214.1|  glucoamylase                                     49.3    8e-04   
ref|WP_009163304.1|  putative 4-alpha-glucanotransferase              49.7    8e-04   Prevotella saccharolytica
dbj|GAM26669.1|  hypothetical protein SAMD00019534_098440             48.5    8e-04   Acytostelium subglobosum LB1
ref|XP_010232573.1|  PREDICTED: uncharacterized protein LOC100835...  49.3    8e-04   Brachypodium distachyon [annual false brome]
ref|XP_011047441.1|  PREDICTED: uncharacterized protein LOC105141784  49.3    8e-04   Populus euphratica
ref|XP_003564648.1|  PREDICTED: uncharacterized protein LOC100835...  49.3    8e-04   Brachypodium distachyon [annual false brome]
ref|WP_018783963.1|  alpha-amylase                                    49.3    9e-04   Micromonospora sp. CNB394
ref|XP_001696233.1|  hypothetical protein CHLREDRAFT_182288           48.9    9e-04   Chlamydomonas reinhardtii
sp|O30565.1|CDGT_BREBE  RecName: Full=Cyclomaltodextrin glucanotr...  49.3    9e-04   Brevibacillus brevis
gb|KDO36025.1|  hypothetical protein CISIN_1g012471mg                 49.3    9e-04   Citrus sinensis [apfelsine]
ref|XP_008858930.1|  starch binding domain containing protein         46.6    0.001   Entamoeba nuttalli P19
emb|CAH61550.1|  cyclodextrin glycosyltransferase                     49.3    0.001   Anaerobranca gottschalkii
ref|XP_010037713.1|  PREDICTED: uncharacterized protein LOC104426...  49.3    0.001   Eucalyptus grandis [rose gum]
ref|XP_011077571.1|  PREDICTED: uncharacterized protein LOC105161548  49.3    0.001   Sesamum indicum [beniseed]
ref|WP_012807740.1|  alpha-amylase                                    49.3    0.001   Halomicrobium mukohataei
emb|CDX80780.1|  BnaC03g00340D                                        48.9    0.001   



>ref|XP_004248008.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Solanum 
lycopersicum]
Length=1202

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 120/153 (78%), Gaps = 5/153 (3%)
 Frame = +1

Query  148  LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQV  327
            L L P    G  M+R  +G+    +C VSSVETRE + KGK K S+ E ++L+  LDHQV
Sbjct  46   LTLLPATNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNK-SSSEKVQLRFRLDHQV  100

Query  328  EYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWET  507
            EYGEHIA++GS KELGSWKKN+MMDWTE GW+ E+E++ GE +E+KFVIVGKDKN+LWE 
Sbjct  101  EYGEHIAVLGSAKELGSWKKNIMMDWTENGWIGELEVRSGEILEYKFVIVGKDKNMLWEN  160

Query  508  GDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            G NR+LKLP GGSF++VCQWNVTD+P+ LL LD
Sbjct  161  GSNRILKLPEGGSFELVCQWNVTDEPVNLLSLD  193



>ref|XP_009777858.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Nicotiana 
sylvestris]
Length=1200

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 140/195 (72%), Gaps = 10/195 (5%)
 Frame = +1

Query  40   MDSLRALH-----NAKYAYPYRHIPSARRTSLGKL-KFSEPRLILEPQGIPGSIMNRPTR  201
            MDSL   H     NAK   P+  I S + T L +L + S    IL P+   G +M+   R
Sbjct  1    MDSLHFTHCYSTLNAKKRQPHNQI-SKQFTVLPQLSQTSVKNSILLPRKKLGFLMDYKGR  59

Query  202  GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  381
            G  +  + AVSSVETRE ++KGK  +++ E ++L++ L HQVE+GEHIA++GS KELGSW
Sbjct  60   G--TGIVRAVSSVETREKQQKGKNNKNS-EKVQLRVRLKHQVEFGEHIAVLGSAKELGSW  116

Query  382  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  561
            KKN+MMDWTE GW+SE+EL  GE +E+KFVIVGKDKN+LWE G NR+L LP GGSF++VC
Sbjct  117  KKNIMMDWTENGWISELELPAGESLEYKFVIVGKDKNMLWENGSNRILMLPEGGSFELVC  176

Query  562  QWNVTDKPLELLPLD  606
            QWNVTD+P+ LL LD
Sbjct  177  QWNVTDEPVNLLQLD  191



>ref|XP_009599199.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=1202

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 137/195 (70%), Gaps = 8/195 (4%)
 Frame = +1

Query  40   MDSLRALH-----NAKYAYPYRHIPSARRTSLGKLKFSEPR-LILEPQGIPGSIMNRPTR  201
            MDSL   +     NAK   P+ HI S + T L +L  +  +  IL P+     +M+   +
Sbjct  1    MDSLHFSYCYSTLNAKKKQPHNHI-SKKFTVLPQLSHTSVKNSILFPRKKLVFLMDCRIK  59

Query  202  GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  381
            G  +  + A SSVE RE ++KGK  +++ E ++L++ L HQVE+GEHIA++GS KELGSW
Sbjct  60   GRGTGIVRAASSVEIREKQQKGKNNKNS-EKVQLRVRLKHQVEFGEHIAVLGSAKELGSW  118

Query  382  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  561
            KKN+MMDWTE GW+SE+E   GE +E+KFVIVGKDKN+LWE G NR+LKLP GGSF++ C
Sbjct  119  KKNIMMDWTENGWISELEFPAGESLEYKFVIVGKDKNMLWENGSNRILKLPEGGSFELDC  178

Query  562  QWNVTDKPLELLPLD  606
            QWNVTD+P+ LL LD
Sbjct  179  QWNVTDEPVNLLQLD  193



>ref|XP_006358812.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Solanum tuberosum]
Length=1206

 Score =   191 bits (485),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 119/156 (76%), Gaps = 7/156 (4%)
 Frame = +1

Query  148  LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH---ENLKLKIWLD  318
            L L P    G  M+R  +G+    +C VSSVETRE + KGK K ++    E ++L+  LD
Sbjct  42   LTLLPTRNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNKNNSGSSTEKVQLRFRLD  97

Query  319  HQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLL  498
            HQVEYGEHIA++GS KELGSWKKN+MMDWTE GW+ E+E++ GE +E+KFVIVGKDK +L
Sbjct  98   HQVEYGEHIAVLGSAKELGSWKKNIMMDWTENGWIGELEVRSGETLEYKFVIVGKDKKML  157

Query  499  WETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            WE G NR+LKLP GG F++VCQWNVTD+P+ LLPLD
Sbjct  158  WENGSNRILKLPEGGGFELVCQWNVTDEPVNLLPLD  193



>ref|XP_006358813.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Solanum tuberosum]
Length=1202

 Score =   191 bits (485),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 119/156 (76%), Gaps = 7/156 (4%)
 Frame = +1

Query  148  LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH---ENLKLKIWLD  318
            L L P    G  M+R  +G+    +C VSSVETRE + KGK K ++    E ++L+  LD
Sbjct  42   LTLLPTRNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNKNNSGSSTEKVQLRFRLD  97

Query  319  HQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLL  498
            HQVEYGEHIA++GS KELGSWKKN+MMDWTE GW+ E+E++ GE +E+KFVIVGKDK +L
Sbjct  98   HQVEYGEHIAVLGSAKELGSWKKNIMMDWTENGWIGELEVRSGETLEYKFVIVGKDKKML  157

Query  499  WETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            WE G NR+LKLP GG F++VCQWNVTD+P+ LLPLD
Sbjct  158  WENGSNRILKLPEGGGFELVCQWNVTDEPVNLLPLD  193



>ref|NP_001274870.1| glucan/water dikinase [Solanum tuberosum]
 gb|ACZ66259.1| glucan/water dikinase [Solanum tuberosum]
Length=1202

 Score =   191 bits (485),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 119/156 (76%), Gaps = 7/156 (4%)
 Frame = +1

Query  148  LILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH---ENLKLKIWLD  318
            L L P    G  M+R  +G+    +C VSSVETRE + KGK K ++    E ++L+  LD
Sbjct  42   LTLLPTRNLGFFMDRRVKGI----VCGVSSVETRENQNKGKNKNNSGSSTEKVQLRFRLD  97

Query  319  HQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLL  498
            HQVEYGEHIA++GS KELGSWKKN+MMDWTE GW+ E+E++ GE +E+KFVIVGKDK +L
Sbjct  98   HQVEYGEHIAVLGSAKELGSWKKNIMMDWTENGWIGELEVRSGETLEYKFVIVGKDKKML  157

Query  499  WETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            WE G NR+LKLP GG F++VCQWNVTD+P+ LLPLD
Sbjct  158  WENGSNRILKLPEGGGFELVCQWNVTDEPVNLLPLD  193



>emb|CBI39424.3| unnamed protein product [Vitis vinifera]
Length=1149

 Score =   173 bits (438),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 126/195 (65%), Gaps = 21/195 (11%)
 Frame = +1

Query  40   MDSLRALH---NAKYAYPYR---HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTR  201
            MDSLR L    +A+Y Y  R     P   R++     F +PR+         S   R   
Sbjct  1    MDSLRVLQCSTSAQYQYHLRKQLEFPLQCRSN-----FLKPRI---------SHSFRNLG  46

Query  202  GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  381
             L+ R +C VSSV TRE EKK +  R+    +KL I L HQV++GEH+ ++GSTKELGSW
Sbjct  47   FLNRRILCGVSSVLTREEEKKMR-TRTGSGKVKLSILLKHQVKFGEHVVMLGSTKELGSW  105

Query  382  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  561
            KKNV M+WTE GWV ++EL+G E +E+KFVIV +DK++ WE  +NRVLKLP GGSF +VC
Sbjct  106  KKNVPMNWTENGWVCKLELRGDESIEYKFVIVKRDKSMTWEGANNRVLKLPKGGSFGVVC  165

Query  562  QWNVTDKPLELLPLD  606
             WN T + ++LLPLD
Sbjct  166  LWNATGEAVDLLPLD  180



>ref|XP_002265211.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Vitis 
vinifera]
Length=1188

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 126/195 (65%), Gaps = 21/195 (11%)
 Frame = +1

Query  40   MDSLRALH---NAKYAYPYR---HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTR  201
            MDSLR L    +A+Y Y  R     P   R++     F +PR+         S   R   
Sbjct  1    MDSLRVLQCSTSAQYQYHLRKQLEFPLQCRSN-----FLKPRI---------SHSFRNLG  46

Query  202  GLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  381
             L+ R +C VSSV TRE EKK +  R+    +KL I L HQV++GEH+ ++GSTKELGSW
Sbjct  47   FLNRRILCGVSSVLTREEEKKMR-TRTGSGKVKLSILLKHQVKFGEHVVMLGSTKELGSW  105

Query  382  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  561
            KKNV M+WTE GWV ++EL+G E +E+KFVIV +DK++ WE  +NRVLKLP GGSF +VC
Sbjct  106  KKNVPMNWTENGWVCKLELRGDESIEYKFVIVKRDKSMTWEGANNRVLKLPKGGSFGVVC  165

Query  562  QWNVTDKPLELLPLD  606
             WN T + ++LLPLD
Sbjct  166  LWNATGEAVDLLPLD  180



>ref|XP_002518612.1| chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
 gb|EEF43754.1| chloroplast alpha-glucan water dikinase, putative [Ricinus communis]
Length=1174

 Score =   171 bits (432),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 125/193 (65%), Gaps = 18/193 (9%)
 Frame = +1

Query  40   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSS-R  216
            MDSLR LH +  +     IPS  R       F  P +              P R  SS R
Sbjct  1    MDSLRVLHLSNSSPKIIQIPS--RNQFHPFVFFNPGISF------------PLRQSSSFR  46

Query  217  TI-CAVSSVETR--EVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKK  387
            TI C VSS ETR  E + K  + +S    ++L + LDHQVEYGEH+AI+GSTKELG WKK
Sbjct  47   TIICGVSSTETRGEEKKMKKTKSKSGRGKVRLFVHLDHQVEYGEHVAILGSTKELGLWKK  106

Query  388  NVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  567
            NV+M+WTE GWV ++ELKG + + FKFV++  DK+++WE GDNR++KLP GGS+K+VC+W
Sbjct  107  NVLMNWTESGWVCDLELKGDDSIGFKFVVLRTDKSVVWEGGDNRIIKLPKGGSYKIVCRW  166

Query  568  NVTDKPLELLPLD  606
            + T +P++LLP D
Sbjct  167  HATAEPIDLLPWD  179



>ref|XP_002301739.2| hypothetical protein POPTR_0002s23550g [Populus trichocarpa]
 gb|EEE81012.2| hypothetical protein POPTR_0002s23550g [Populus trichocarpa]
Length=1138

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 120/194 (62%), Gaps = 17/194 (9%)
 Frame = +1

Query  40   MDSLRALHNAKYAY--PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSS  213
            MDSLRAL  + + Y  P R+            +F     +    G      N        
Sbjct  1    MDSLRALLRSDFIYLTPTRN------------QFQSLHKVAPAGGTSTPFFNPRISIPIR  48

Query  214  RT-ICAVSSVETREVEKKGKEKRSAHEN--LKLKIWLDHQVEYGEHIAIMGSTKELGSWK  384
            R  +C VSS ++RE EK  ++ RS  E   ++L + +DHQVE+GE I I+GSTKELGSWK
Sbjct  49   RRIVCGVSSTQSREQEKAMRKSRSRLERGKVRLNVRVDHQVEFGEQIVILGSTKELGSWK  108

Query  385  KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  564
            K V M+WTE GWV ++E+KGG  VEFKFVIV KD++ +WE+GDNR L+LP GGSF +VC+
Sbjct  109  KRVPMNWTENGWVCDLEMKGGGIVEFKFVIVSKDRSFVWESGDNRALRLPRGGSFAVVCK  168

Query  565  WNVTDKPLELLPLD  606
            W+ T + + LLPL+
Sbjct  169  WDATGEAVNLLPLE  182



>emb|CDP10310.1| unnamed protein product [Coffea canephora]
Length=1144

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 102/137 (74%), Gaps = 4/137 (3%)
 Frame = +1

Query  208  SSRTICAVSSVETREVEKKGKE----KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  375
            SSR +  VSSVET   E+K ++     R   E + +K+ L+HQVE+GEHIA++GS KELG
Sbjct  5    SSRILSGVSSVETSRKEEKKQKKTKQSRQGQEKVLMKVLLNHQVEFGEHIALLGSAKELG  64

Query  376  SWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  555
            SWKK +MMDWTE GWV E+ELKGGEPVE KFVIV KDK   WE+GDNRVL LP GGSFK 
Sbjct  65   SWKKELMMDWTEDGWVCELELKGGEPVECKFVIVRKDKRRAWESGDNRVLMLPEGGSFKT  124

Query  556  VCQWNVTDKPLELLPLD  606
            V +W+ T + +E LPLD
Sbjct  125  VFRWDRTGEAVEFLPLD  141



>ref|XP_011000022.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan, water dikinase, 
chloroplastic-like [Populus euphratica]
Length=1172

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 114/198 (58%), Gaps = 31/198 (16%)
 Frame = +1

Query  40   MDSLRALH--------NAKYAYPYRHIPSARRT-SLGKLKFSEPRLILEPQGIPGSIMNR  192
            MDSLR LH          ++ + + H   AR         F  PR+ +            
Sbjct  1    MDSLRLLHFVIPTPTRRNQFHHSHSHHKLARPPGQCATTTFFNPRISI------------  48

Query  193  PTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKEL  372
            P RG   R +CAVSS +TRE E+       A    KL + +DHQVE+GEHI I+GS+KE+
Sbjct  49   PIRG---RIVCAVSSTQTREEER-------ATMKSKLNVRIDHQVEFGEHIVIVGSSKEM  98

Query  373  GSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFK  552
            GSWKK V M WTE GWV E+ELKGGE VEFKF IV KD  L+WE G NR LKLP  GSF 
Sbjct  99   GSWKKKVPMKWTENGWVCELELKGGEAVEFKFAIVSKDNGLVWENGHNRALKLPREGSFA  158

Query  553  MVCQWNVTDKPLELLPLD  606
            +VC+W  T + +  LPL+
Sbjct  159  IVCRWGATGEAVNFLPLE  176



>ref|XP_011042749.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Populus euphratica]
Length=1178

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 119/194 (61%), Gaps = 17/194 (9%)
 Frame = +1

Query  40   MDSLRALHNAKYAY--PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSS  213
            MDSLRAL  + + Y  P R+            +F     +    G      N        
Sbjct  1    MDSLRALLRSDFMYLTPTRN------------QFQSLHKVAPAGGTSTPFFNPRISIPIR  48

Query  214  RT-ICAVSSVETREVEKKGKEKRSAHEN--LKLKIWLDHQVEYGEHIAIMGSTKELGSWK  384
            R  +C VSS ++RE EK  K+ RS  E   ++L + +DHQVE+GE I I+GS KELGSWK
Sbjct  49   RRIVCGVSSPQSREQEKAMKKSRSRSERGKVRLNVRVDHQVEFGEQIVILGSDKELGSWK  108

Query  385  KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  564
            K V M+WTE GWV ++++KGG  VEFKFVIV KD++ +WE+GDNR L+LP GGSF +VC+
Sbjct  109  KRVPMNWTESGWVCDLKMKGGGIVEFKFVIVRKDRSFVWESGDNRALRLPRGGSFAVVCK  168

Query  565  WNVTDKPLELLPLD  606
            W+ T + + LLPLD
Sbjct  169  WDATGEAVNLLPLD  182



>gb|EYU23932.1| hypothetical protein MIMGU_mgv1a000391mg [Erythranthe guttata]
Length=1190

 Score =   162 bits (410),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 100/148 (68%), Gaps = 9/148 (6%)
 Frame = +1

Query  190  RPTRGLSSR-TICAVSSVETREVEKKG------KEKRSAHENLKLKIWLDHQVEYGEHIA  348
            R TR  S R T+ AVSS ETRE E K       + K+S    + LK+ L HQVEYGEH+A
Sbjct  51   RHTRKASVRMTVSAVSSTETREKESKNENNKERQSKKSGGNKVNLKLRLAHQVEYGEHVA  110

Query  349  IMGSTKELGSWKKNVMMDWTEKGWVSEMELKGG-EPVEFKFVIVGKDKN-LLWETGDNRV  522
            I+GS KE GSWK  VMMDWTE GWV  MEL    EPVE+KFVIVG DK  L WE GDNR 
Sbjct  111  ILGSAKEFGSWKNKVMMDWTENGWVCTMELSNKEEPVEYKFVIVGNDKERLTWENGDNRT  170

Query  523  LKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            LK P  GSF +VC+W+ T++ +ELLP D
Sbjct  171  LKFPENGSFNVVCKWDKTNEQVELLPWD  198



>ref|XP_002320442.2| hypothetical protein POPTR_0014s14510g [Populus trichocarpa]
 gb|EEE98757.2| hypothetical protein POPTR_0014s14510g [Populus trichocarpa]
Length=1159

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 116/198 (59%), Gaps = 31/198 (16%)
 Frame = +1

Query  40   MDSLRALH--------NAKYAYPYRHIPSARRTSL-GKLKFSEPRLILEPQGIPGSIMNR  192
            MDSLR LH          ++ + + H   AR   L     F  PR+ +            
Sbjct  1    MDSLRLLHFVTPTPTRRNQFHHSHSHHKLARPPGLRATTTFFNPRISI------------  48

Query  193  PTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKEL  372
            P RG   R +CAVSS +TRE E+  K+         L + +DHQVE+GE+I I+GS+KE+
Sbjct  49   PIRG---RIVCAVSSTQTREEERATKKS-------MLNVRIDHQVEFGENIVIVGSSKEM  98

Query  373  GSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFK  552
            GSWKK V M WTE GWV ++ELKGGE VEFKF I  KD +L+WE+GDNR LKLP  GSF 
Sbjct  99   GSWKKKVPMKWTENGWVCKLELKGGEVVEFKFAIASKDNSLVWESGDNRALKLPREGSFA  158

Query  553  MVCQWNVTDKPLELLPLD  606
            +VC+W  T + +   PL+
Sbjct  159  IVCRWGATGEAINFSPLE  176



>ref|XP_010069404.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW57742.1| hypothetical protein EUGRSUZ_H00494 [Eucalyptus grandis]
Length=1189

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 104/139 (75%), Gaps = 2/139 (1%)
 Frame = +1

Query  196  TRGLSSRTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKE  369
             RG  S  +  VSS ETRE EKKGK+ +S    E + L + LDHQVE+GE +AI+GS +E
Sbjct  59   ARGRPSTVVRGVSSTETREGEKKGKKIKSKPGGEKVHLSVRLDHQVEFGESVAILGSARE  118

Query  370  LGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSF  549
            LGSWKK V MDWT+ GWV E+ELKGGE VE+KFVI  KDK++ WE+GDNRVLKLP GG +
Sbjct  119  LGSWKKKVAMDWTKSGWVCELELKGGESVEYKFVIDRKDKSVAWESGDNRVLKLPKGGKY  178

Query  550  KMVCQWNVTDKPLELLPLD  606
             MVC WN T + ++L+P+D
Sbjct  179  GMVCMWNATKEAVKLMPMD  197



>gb|KJB37917.1| hypothetical protein B456_006G226300 [Gossypium raimondii]
Length=1161

 Score =   160 bits (404),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +1

Query  220  ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMM  399
            + AVS+  T E E+K + K SA   + L I LDHQV+YGEH+  +GS KELGSWKK V M
Sbjct  53   VFAVSAAPTIE-EEKTRMKLSAPGKVCLNICLDHQVKYGEHVVFLGSAKELGSWKKQVPM  111

Query  400  DWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTD  579
             W+E+GWV + E  GG+  EFKFVIVG DK L+WETG+NR+LKLP GGS+ +VC WN T 
Sbjct  112  SWSERGWVCDFEFDGGQSAEFKFVIVGNDKTLVWETGNNRILKLPEGGSYVIVCHWNSTG  171

Query  580  KPLELLPL  603
            +P++LLPL
Sbjct  172  EPVKLLPL  179



>gb|KJB37918.1| hypothetical protein B456_006G226300 [Gossypium raimondii]
Length=872

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +1

Query  220  ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMM  399
            + AVS+  T E E+K + K SA   + L I LDHQV+YGEH+  +GS KELGSWKK V M
Sbjct  53   VFAVSAAPTIE-EEKTRMKLSAPGKVCLNICLDHQVKYGEHVVFLGSAKELGSWKKQVPM  111

Query  400  DWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTD  579
             W+E+GWV + E  GG+  EFKFVIVG DK L+WETG+NR+LKLP GGS+ +VC WN T 
Sbjct  112  SWSERGWVCDFEFDGGQSAEFKFVIVGNDKTLVWETGNNRILKLPEGGSYVIVCHWNSTG  171

Query  580  KPLELLPL  603
            +P++LLPL
Sbjct  172  EPVKLLPL  179



>gb|KHF99077.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=1169

 Score =   159 bits (403),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 123/196 (63%), Gaps = 26/196 (13%)
 Frame = +1

Query  46   SLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQ------GIPGSIMNRPTRGL  207
            SLR+LH   +  P R           +LKF     I  P+        PG  +NR  R  
Sbjct  5    SLRSLH---FQIPARK----------QLKFLPDATIFSPRISFPFPFPPG--INR-HRKH  48

Query  208  SSRTICAVSSVETREVEKKGKEKR----SAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  375
            S   + AVSS  TRE EKK K  +    S    + L + LDHQV++GEH+ I+GSTKELG
Sbjct  49   SHSLVFAVSSTPTREEEKKKKMTKVKPMSGSGKVGLNVCLDHQVQFGEHVVILGSTKELG  108

Query  376  SWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  555
            SWKK V M+W+E GW+ ++ELKGGE VEFKFV+V KDK++ WE G+NRVLKLP GG+F M
Sbjct  109  SWKKQVPMNWSEDGWICDLELKGGESVEFKFVVVSKDKSVAWEGGNNRVLKLPQGGNFGM  168

Query  556  VCQWNVTDKPLELLPL  603
            +C WN T++ LELLPL
Sbjct  169  ICHWNSTEETLELLPL  184



>gb|KJB71923.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1127

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +1

Query  301  LKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVG  480
            L I LDHQV++GEH+ I+GSTKELGSWKK V M+W+E GW+ ++ELKGGE VEFKFV+V 
Sbjct  25   LNICLDHQVQFGEHVVILGSTKELGSWKKQVPMNWSEDGWICDLELKGGESVEFKFVVVS  84

Query  481  KDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL  603
            KDK++ WE G+NRVLKLP GGSF M+C WN T++ LELLPL
Sbjct  85   KDKSVAWEGGNNRVLKLPQGGSFGMICHWNSTEETLELLPL  125



>gb|KJB71922.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1186

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +1

Query  301  LKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVG  480
            L I LDHQV++GEH+ I+GSTKELGSWKK V M+W+E GW+ ++ELKGGE VEFKFV+V 
Sbjct  84   LNICLDHQVQFGEHVVILGSTKELGSWKKQVPMNWSEDGWICDLELKGGESVEFKFVVVS  143

Query  481  KDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL  603
            KDK++ WE G+NRVLKLP GGSF M+C WN T++ LELLPL
Sbjct  144  KDKSVAWEGGNNRVLKLPQGGSFGMICHWNSTEETLELLPL  184



>gb|KJB71921.1| hypothetical protein B456_011G147600 [Gossypium raimondii]
Length=1186

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +1

Query  301  LKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVG  480
            L I LDHQV++GEH+ I+GSTKELGSWKK V M+W+E GW+ ++ELKGGE VEFKFV+V 
Sbjct  84   LNICLDHQVQFGEHVVILGSTKELGSWKKQVPMNWSEDGWICDLELKGGESVEFKFVVVS  143

Query  481  KDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL  603
            KDK++ WE G+NRVLKLP GGSF M+C WN T++ LELLPL
Sbjct  144  KDKSVAWEGGNNRVLKLPQGGSFGMICHWNSTEETLELLPL  184



>ref|XP_011074900.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Sesamum 
indicum]
Length=1209

 Score =   159 bits (402),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 101/138 (73%), Gaps = 8/138 (6%)
 Frame = +1

Query  217  TICAVSSVETREVEKKG------KEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  378
            T+ AVSSVETRE E K       + K S  + +KLK+ LDHQVE+GEH+AI+GS  ELGS
Sbjct  66   TVSAVSSVETREEEMKKDKKKKRQSKTSGADKVKLKVRLDHQVEFGEHVAILGSAIELGS  125

Query  379  WKKNVMMDWTEKGWVSEMELKGG-EPVEFKFVIVGKDKN-LLWETGDNRVLKLPAGGSFK  552
            WK  VMMDWTE GWV ++EL    EPVE+KFVIV KDK  L+WE+GDNR+LK    G+F 
Sbjct  126  WKNKVMMDWTENGWVCDLELNSNEEPVEYKFVIVSKDKGKLVWESGDNRILKFSGNGNFN  185

Query  553  MVCQWNVTDKPLELLPLD  606
            +VC+WN T++ +E+LP D
Sbjct  186  IVCRWNKTNEQVEVLPWD  203



>ref|XP_010244064.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Nelumbo nucifera]
 ref|XP_010244065.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Nelumbo nucifera]
Length=1197

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = +1

Query  208  SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKK  387
            SSR  C VSSVE R+ EKK + ++   + L L + L+HQVE+GEH+A++GS+KELGSWKK
Sbjct  59   SSRITCGVSSVEERKEEKKMESRKRRGKVL-LSVRLNHQVEFGEHVAMLGSSKELGSWKK  117

Query  388  NVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  567
             V +DWTE GWV ++E+KGGE VE+KFVI+ KDK+++WE GDNR LKLP GG F+M+C W
Sbjct  118  KVNLDWTENGWVCDLEMKGGEEVEYKFVILRKDKSIIWENGDNRSLKLPEGGRFEMICHW  177

Query  568  NVTDKPLELLPL  603
            N T + + LLPL
Sbjct  178  NKTGEAVNLLPL  189



>ref|XP_007034117.1| Catalytics,carbohydrate kinases,phosphoglucan [Theobroma cacao]
 gb|EOY05043.1| Catalytics,carbohydrate kinases,phosphoglucan [Theobroma cacao]
Length=1180

 Score =   156 bits (395),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 98/128 (77%), Gaps = 2/128 (2%)
 Frame = +1

Query  226  AVSSVETREVEKKGKEKR--SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMM  399
            AVSS  TRE EKK  + +  S    + L + LDHQVE+GEH+AI+GSTKELGSWKK V M
Sbjct  53   AVSSTLTREEEKKKMKAKPKSGRGKVGLNVCLDHQVEFGEHVAILGSTKELGSWKKQVPM  112

Query  400  DWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTD  579
            +WTE GWV ++ELKG E VE+KFVIV KDK+++WE GDNRVLKLP  G+F MVC WN T 
Sbjct  113  NWTEGGWVCDLELKGDESVEYKFVIVRKDKSVVWEGGDNRVLKLPQSGNFGMVCHWNSTG  172

Query  580  KPLELLPL  603
            + +ELLPL
Sbjct  173  ETVELLPL  180



>ref|XP_010673296.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673297.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=1189

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 104/148 (70%), Gaps = 10/148 (7%)
 Frame = +1

Query  169  IPGSIMNRPTRGLSSRTICAVSSVETREVEK--KGKEKRSAHEN--LKLKIWLDHQVEYG  336
            +P S  +R      S+  C +SSV+TRE E+     + RS  EN  ++L I L HQV++G
Sbjct  44   LPSSTTSR------SQIFCGISSVQTREEEEIMNNNKTRSRRENGKVQLSILLKHQVQFG  97

Query  337  EHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDN  516
            E + I GS+KE+GSW+K V M+WT+ GWV ++ELKGG+  EFKFVI+GKDK+L WE+GDN
Sbjct  98   ECVVIFGSSKEMGSWEKPVTMNWTDNGWVLDLELKGGDSGEFKFVIMGKDKSLTWESGDN  157

Query  517  RVLKLPAGGSFKMVCQWNVTDKPLELLP  600
            R L++P GG F + C WN+T + LE+LP
Sbjct  158  RKLQIPGGGKFTLFCHWNMTAEALEILP  185



>ref|XP_010546804.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=1174

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 109/155 (70%), Gaps = 4/155 (3%)
 Frame = +1

Query  136  SEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVE--KKGKEKRSAHENLKLKI  309
            S PRL+   + +P     R     S R  C VS+  +  +E  ++ K+ RS  + + LK+
Sbjct  21   SLPRLVFFSRRVPFGRSQRFNHS-SCRITCTVSASASSTIEEQRQKKDDRSG-KKVMLKL  78

Query  310  WLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDK  489
             LDHQV++GEH+AI+GS+KE+GSWKK V + WTEKGWV E+EL GG+ +E+KFVIV KD 
Sbjct  79   RLDHQVKFGEHVAILGSSKEIGSWKKKVPLIWTEKGWVCELELSGGQVLEYKFVIVRKDG  138

Query  490  NLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
            +L WE+G+NRVL+LP  GSF +VC+W+ T +PL+L
Sbjct  139  SLAWESGENRVLQLPNSGSFSVVCRWDATREPLDL  173



>ref|XP_010546803.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=1176

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 109/155 (70%), Gaps = 4/155 (3%)
 Frame = +1

Query  136  SEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVE--KKGKEKRSAHENLKLKI  309
            S PRL+   + +P     R     S R  C VS+  +  +E  ++ K+ RS  + + LK+
Sbjct  21   SLPRLVFFSRRVPFGRSQRFNHS-SCRITCTVSASASSTIEEQRQKKDDRSG-KKVMLKL  78

Query  310  WLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDK  489
             LDHQV++GEH+AI+GS+KE+GSWKK V + WTEKGWV E+EL GG+ +E+KFVIV KD 
Sbjct  79   RLDHQVKFGEHVAILGSSKEIGSWKKKVPLIWTEKGWVCELELSGGQVLEYKFVIVRKDG  138

Query  490  NLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
            +L WE+G+NRVL+LP  GSF +VC+W+ T +PL+L
Sbjct  139  SLAWESGENRVLQLPNSGSFSVVCRWDATREPLDL  173



>ref|XP_008393849.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Malus domestica]
Length=965

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 116/192 (60%), Gaps = 16/192 (8%)
 Frame = +1

Query  40   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPR--LILEPQGIPGSIMNRPTRGL--  207
            MD + ALH +  A P  H    RR    +L+   PR   +     +P     R  R L  
Sbjct  1    MDCVHALHTSSSA-PQLH----RRK---QLRCLHPRHQCLGSLAVVPFFAHKRGFRPLYH  52

Query  208  ---SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  378
               + + IC VSS ++ + E+K    +S    ++L I LDHQVE+GE +AI+GS KELGS
Sbjct  53   KSNTCQIICGVSSAQSID-EEKDSMMKSESGKVRLNIRLDHQVEFGESVAILGSVKELGS  111

Query  379  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  558
            WKK V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE G NRVLKLP GGSF+MV
Sbjct  112  WKKKVPMNWTESGWVCTLEFKGGESVEYKFLTVRADKSMLWEGGHNRVLKLPNGGSFEMV  171

Query  559  CQWNVTDKPLEL  594
            C WN T + + L
Sbjct  172  CHWNATTEAVGL  183



>ref|XP_008393850.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Malus domestica]
Length=937

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 116/192 (60%), Gaps = 16/192 (8%)
 Frame = +1

Query  40   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPR--LILEPQGIPGSIMNRPTRGL--  207
            MD + ALH +  A P  H    RR    +L+   PR   +     +P     R  R L  
Sbjct  1    MDCVHALHTSSSA-PQLH----RRK---QLRCLHPRHQCLGSLAVVPFFAHKRGFRPLYH  52

Query  208  ---SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  378
               + + IC VSS ++ + E+K    +S    ++L I LDHQVE+GE +AI+GS KELGS
Sbjct  53   KSNTCQIICGVSSAQSID-EEKDSMMKSESGKVRLNIRLDHQVEFGESVAILGSVKELGS  111

Query  379  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  558
            WKK V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE G NRVLKLP GGSF+MV
Sbjct  112  WKKKVPMNWTESGWVCTLEFKGGESVEYKFLTVRADKSMLWEGGHNRVLKLPNGGSFEMV  171

Query  559  CQWNVTDKPLEL  594
            C WN T + + L
Sbjct  172  CHWNATTEAVGL  183



>gb|KDO57834.1| hypothetical protein CISIN_1g015140mg [Citrus sinensis]
Length=412

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFV  471
            N+++   LDHQVE+GEH+ I+GSTKELGSWKKNV M W+E GW+ ++E KGGE +E+KFV
Sbjct  10   NVRISFRLDHQVEFGEHVVILGSTKELGSWKKNVPMKWSESGWLCDLEFKGGESIEYKFV  69

Query  472  IVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL  603
            IV  DK+  WE GDNR+LKLP GGSF++VC WN T + ++LL L
Sbjct  70   IVRNDKSKAWEAGDNRILKLPKGGSFEIVCHWNKTGEAVDLLHL  113



>ref|XP_009371117.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
Length=965

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 116/192 (60%), Gaps = 16/192 (8%)
 Frame = +1

Query  40   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPR--LILEPQGIPGSIMNRPTRGL--  207
            MD + ALH +  A P  H    RR    +L+   PR   +     +P     R  R L  
Sbjct  1    MDCVHALHTSSSA-PQLH----RRK---QLRCLHPRHQFLGSLAVVPFFAHKRGFRPLYH  52

Query  208  ---SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  378
               + + IC VSS ++ + EK    K  + + ++L I LDHQVE+GE +AI+GS KELGS
Sbjct  53   KSNTCQIICGVSSAQSIDEEKDNMMKPESGK-VRLNIRLDHQVEFGESVAILGSVKELGS  111

Query  379  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  558
            WKK V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE G NR+LKLP GGSF+MV
Sbjct  112  WKKKVPMNWTESGWVCTLEFKGGESVEYKFLTVRADKSMLWEGGQNRILKLPKGGSFEMV  171

Query  559  CQWNVTDKPLEL  594
            C WN T + + L
Sbjct  172  CHWNATTEAVGL  183



>ref|XP_009371116.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
Length=1185

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 116/192 (60%), Gaps = 16/192 (8%)
 Frame = +1

Query  40   MDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPR--LILEPQGIPGSIMNRPTRGL--  207
            MD + ALH +  A P  H    RR    +L+   PR   +     +P     R  R L  
Sbjct  1    MDCVHALHTSSSA-PQLH----RRK---QLRCLHPRHQFLGSLAVVPFFAHKRGFRPLYH  52

Query  208  ---SSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  378
               + + IC VSS ++ + EK    K  + + ++L I LDHQVE+GE +AI+GS KELGS
Sbjct  53   KSNTCQIICGVSSAQSIDEEKDNMMKPESGK-VRLNIRLDHQVEFGESVAILGSVKELGS  111

Query  379  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  558
            WKK V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE G NR+LKLP GGSF+MV
Sbjct  112  WKKKVPMNWTESGWVCTLEFKGGESVEYKFLTVRADKSMLWEGGQNRILKLPKGGSFEMV  171

Query  559  CQWNVTDKPLEL  594
            C WN T + + L
Sbjct  172  CHWNATTEAVGL  183



>gb|KHG00248.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=1052

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +1

Query  274  KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEP  453
            K SA   + L I LD QV+YGEH+ I+GS KELGSWKK V M W+E+GWV + E  GG+ 
Sbjct  4    KLSAPGKVCLNICLDLQVKYGEHVVILGSAKELGSWKKQVPMSWSERGWVCDFEFDGGQS  63

Query  454  VEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL  603
             EFKFVIVG DK L+WETG+NR+LKLP GGS+ +VC WN T +P +LLPL
Sbjct  64   AEFKFVIVGNDKTLVWETGNNRILKLPEGGSYVIVCHWNSTGEPAKLLPL  113



>ref|XP_004296959.2| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=1191

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 94/138 (68%), Gaps = 5/138 (4%)
 Frame = +1

Query  208  SSRTICAV-----SSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKEL  372
            S R +C V      S+E  +  K   + +  H  + L I LDHQVE+GE IA++GS+KEL
Sbjct  57   SLRILCGVGVSPPQSIEEEKETKMKSKSKDRHGKVWLNIRLDHQVEFGESIAVLGSSKEL  116

Query  373  GSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFK  552
            GSWKK V ++WTE GWV ++E KG E +E+KFV V  DK++LWE GDNRVLKLP+ GSF 
Sbjct  117  GSWKKKVPLNWTESGWVCQLEFKGDEVIEYKFVTVRADKSMLWEGGDNRVLKLPSRGSFG  176

Query  553  MVCQWNVTDKPLELLPLD  606
            MVC WN   + ++L PLD
Sbjct  177  MVCHWNAIGENVDLFPLD  194



>ref|XP_010454991.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=895

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 109/168 (65%), Gaps = 0/168 (0%)
 Frame = +1

Query  91   HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGK  270
            H  S+  T + +   + P+L+   + +  S  +   R  SSR  C  SS  +  +E++ K
Sbjct  8    HCCSSPFTFITRNSSTLPKLVNFTRRVHLSHQSHRLRNSSSRLTCTASSSSSSTIEEQRK  67

Query  271  EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGE  450
            +K  +   +KL + LDHQV +GEH+A+ GS KE+GSWKK   ++WTEKGWV E+EL GG+
Sbjct  68   KKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGSWKKKSPLNWTEKGWVCELELDGGQ  127

Query  451  PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
             +E+KFVIV  D +L WE+GDNRVLKLP  G+F +VC W+ T + L+L
Sbjct  128  VLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVVCHWDATRETLDL  175



>ref|XP_006493516.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Citrus sinensis]
Length=1190

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +1

Query  292  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFV  471
            N+++   LDHQVE+GEH+ I+GSTKELGSWKKNV M W+E GW+ ++E KGGE +E+KFV
Sbjct  88   NVRISFRLDHQVEFGEHVVILGSTKELGSWKKNVPMKWSESGWLCDLEFKGGESIEYKFV  147

Query  472  IVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL  603
            IV  DK+  WE GDNR+LKLP GGSF++VC WN T + ++LL L
Sbjct  148  IVRNDKSKAWEAGDNRILKLPKGGSFEIVCHWNKTGEAVDLLHL  191



>gb|KDP32558.1| hypothetical protein JCGZ_13108 [Jatropha curcas]
Length=1114

 Score =   149 bits (376),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 86/115 (75%), Gaps = 0/115 (0%)
 Frame = +1

Query  262  KGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELK  441
            K  + +S    ++L   LDHQVE+G+H+ I+GSTKELG WKKN+ M WTE GWV ++ LK
Sbjct  2    KTNKSKSGSGKVRLNFRLDHQVEFGDHVVILGSTKELGLWKKNLPMTWTESGWVCDLVLK  61

Query  442  GGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            GGE +EFKFVI  KDK L+WE GDNR LKLP GG +++VC+WN T + ++LL LD
Sbjct  62   GGESIEFKFVIARKDKTLVWEGGDNRTLKLPKGGHYEIVCKWNATAEHIDLLTLD  116



>ref|XP_010551754.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Tarenaya hassleriana]
Length=1183

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 95/131 (73%), Gaps = 2/131 (2%)
 Frame = +1

Query  208  SSRTICAVSSVETREVE--KKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  381
            S R  C VS+  +  +E  +K K    + + +KL + LDHQVE+GEH++I GS++E+GSW
Sbjct  44   SCRITCTVSASASSTIEEQRKSKGDDKSGKTVKLNLRLDHQVEFGEHVSIFGSSEEIGSW  103

Query  382  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  561
            KK V + WTE GWV E+EL GG+ +E+KFVIV KD +L WE+GDNRVL+LP  GSF + C
Sbjct  104  KKKVPLAWTENGWVCELELSGGQVLEYKFVIVRKDGSLAWESGDNRVLQLPNSGSFSVSC  163

Query  562  QWNVTDKPLEL  594
            +W+ T +PL+L
Sbjct  164  RWDATREPLDL  174



>ref|XP_010454990.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=1182

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 109/168 (65%), Gaps = 0/168 (0%)
 Frame = +1

Query  91   HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGK  270
            H  S+  T + +   + P+L+   + +  S  +   R  SSR  C  SS  +  +E++ K
Sbjct  8    HCCSSPFTFITRNSSTLPKLVNFTRRVHLSHQSHRLRNSSSRLTCTASSSSSSTIEEQRK  67

Query  271  EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGE  450
            +K  +   +KL + LDHQV +GEH+A+ GS KE+GSWKK   ++WTEKGWV E+EL GG+
Sbjct  68   KKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGSWKKKSPLNWTEKGWVCELELDGGQ  127

Query  451  PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
             +E+KFVIV  D +L WE+GDNRVLKLP  G+F +VC W+ T + L+L
Sbjct  128  VLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVVCHWDATRETLDL  175



>ref|XP_006421076.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34316.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=356

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +1

Query  292  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFV  471
            N+++   LDHQVE+GEH+ I+GSTKELGSWKKNV M W+E GW+ ++E KGGE +E+KFV
Sbjct  88   NVRISFRLDHQVEFGEHVVILGSTKELGSWKKNVPMKWSECGWLCDLEFKGGESIEYKFV  147

Query  472  IVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            IV  DK+  WE G NR+LKLP GGSF++VC WN T + ++LL L+
Sbjct  148  IVRNDKSKAWEAGANRILKLPKGGSFEIVCHWNKTGEAVDLLHLE  192



>ref|XP_006421074.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34314.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=353

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +1

Query  292  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFV  471
            N+++   LDHQVE+GEH+ I+GSTKELGSWKKNV M W+E GW+ ++E KGGE +E+KFV
Sbjct  88   NVRISFRLDHQVEFGEHVVILGSTKELGSWKKNVPMKWSECGWLCDLEFKGGESIEYKFV  147

Query  472  IVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            IV  DK+  WE G NR+LKLP GGSF++VC WN T + ++LL L+
Sbjct  148  IVRNDKSKAWEAGANRILKLPKGGSFEIVCHWNKTGEAVDLLHLE  192



>ref|XP_006421075.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
 gb|ESR34315.1| hypothetical protein CICLE_v10004968mg [Citrus clementina]
Length=445

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = +1

Query  292  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFV  471
            N+++   LDHQVE+GEH+ I+GSTKELGSWKKNV M W+E GW+ ++E KGGE +E+KFV
Sbjct  88   NVRISFRLDHQVEFGEHVVILGSTKELGSWKKNVPMKWSECGWLCDLEFKGGESIEYKFV  147

Query  472  IVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            IV  DK+  WE G NR+LKLP GGSF++VC WN T + ++LL L+
Sbjct  148  IVRNDKSKAWEAGANRILKLPKGGSFEIVCHWNKTGEAVDLLHLE  192



>gb|AFO83531.1| glucan water dikinase 3, partial [Manihot esculenta]
Length=1084

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +1

Query  280  SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVE  459
            S +  ++L + L  +VE+GEH+ I+GS KELG WKK V M+WTE GWV  +EL+GGE +E
Sbjct  8    SGNGKVRLNVRLGCEVEFGEHVVILGSAKELGLWKKKVPMNWTESGWVCNVELRGGESIE  67

Query  460  FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            FKFV+V KD+++LWE G NR LKLP GGS+++VCQWN T +P+ LLPLD
Sbjct  68   FKFVVVKKDESMLWEGGGNRTLKLPKGGSYEIVCQWNATVEPMNLLPLD  116



>ref|XP_010493901.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Camelina sativa]
Length=1194

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 94/132 (71%), Gaps = 2/132 (2%)
 Frame = +1

Query  199  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  378
            R  SSR  C  SS  T  +E++ K+K  +   +KL + LDHQV +GEH+A+ GS KE+GS
Sbjct  44   RNSSSRLTCTASSSST--IEEQRKKKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGS  101

Query  379  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  558
            WKK   ++WT+KGWV ++EL GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +V
Sbjct  102  WKKKSPLNWTDKGWVCQLELDGGQVLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVV  161

Query  559  CQWNVTDKPLEL  594
            C W+ T + L+L
Sbjct  162  CHWDATRETLDL  173



>ref|XP_010493900.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Camelina sativa]
Length=1194

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 94/132 (71%), Gaps = 2/132 (2%)
 Frame = +1

Query  199  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  378
            R  SSR  C  SS  T  +E++ K+K  +   +KL + LDHQV +GEH+A+ GS KE+GS
Sbjct  44   RNSSSRLTCTASSSST--IEEQRKKKDGSGTKVKLNVRLDHQVNFGEHVAMFGSAKEIGS  101

Query  379  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  558
            WKK   ++WT+KGWV ++EL GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +V
Sbjct  102  WKKKSPLNWTDKGWVCQLELDGGQVLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVV  161

Query  559  CQWNVTDKPLEL  594
            C W+ T + L+L
Sbjct  162  CHWDATRETLDL  173



>ref|XP_010107197.1| Phosphoglucan, water dikinase [Morus notabilis]
 gb|EXC14221.1| Phosphoglucan, water dikinase [Morus notabilis]
Length=894

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +1

Query  280  SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVE  459
            S  + ++L I LDHQV++GEH+ I+GSTKELGSWKK V ++WTE+GWV ++ELKGG  +E
Sbjct  5    SGRDKVQLSIRLDHQVKFGEHVVILGSTKELGSWKKKVHLNWTERGWVCQLELKGGNSIE  64

Query  460  FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            +KFVI+GKD++LLWE+G+NRVL LP  G + +VC WN T + ++LL L+
Sbjct  65   YKFVILGKDESLLWESGENRVLGLPERGIYGIVCHWNKTGEAVDLLALE  113



>gb|AAC26245.1| contains similarity glycosyl hydrolases [Arabidopsis thaliana]
Length=491

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 101/153 (66%), Gaps = 2/153 (1%)
 Frame = +1

Query  136  SEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWL  315
            S PRL+     +  S  +   R  +SR  C  +S  T  +E++ K+K  +   ++L + L
Sbjct  23   SLPRLVNITHRVNLSHQSHRLRNSNSRLTCTATSSST--IEEQRKKKDGSGTKVRLNVRL  80

Query  316  DHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  495
            DHQV +G+H+A+ GS KE+GSWKK   ++W+E GWV E+EL GG+ +E+KFVIV  D +L
Sbjct  81   DHQVNFGDHVAMFGSAKEIGSWKKKSPLNWSENGWVCELELDGGQVLEYKFVIVKNDGSL  140

Query  496  LWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
             WE+GDNRVLK+P  G+F +VC W+ T + L+L
Sbjct  141  SWESGDNRVLKVPNSGNFSVVCHWDATRETLDL  173



>ref|XP_008222722.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Prunus 
mume]
Length=1190

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 95/134 (71%), Gaps = 0/134 (0%)
 Frame = +1

Query  205  LSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  384
            L S  + +  S+E  +  K   + +S +E ++L + LDHQVE+GE + I+GS KELGSWK
Sbjct  59   LCSAGVSSAQSIEEEKESKMKSKSKSGNEKVRLNVRLDHQVEFGESVVILGSIKELGSWK  118

Query  385  KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  564
            K V M+WTE GWV  +E KGGE VE+KF+ V  DK++LWE GDNRVLKLP GG+F +V  
Sbjct  119  KRVPMNWTESGWVCSLEFKGGESVEYKFLTVRADKSVLWEGGDNRVLKLPKGGNFGIVSH  178

Query  565  WNVTDKPLELLPLD  606
            WN T + ++LLPL+
Sbjct  179  WNATGEAVDLLPLE  192



>ref|XP_007225436.1| hypothetical protein PRUPE_ppa000429mg [Prunus persica]
 gb|EMJ26635.1| hypothetical protein PRUPE_ppa000429mg [Prunus persica]
Length=1191

 Score =   145 bits (365),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +1

Query  283  AHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEF  462
             +E ++L + LDHQVE+GE + I+GS KELGSWKK V M+WTE GWV  +E KGGE VE+
Sbjct  85   GNEKVRLNVRLDHQVEFGESVVILGSIKELGSWKKKVPMNWTESGWVCSLEFKGGESVEY  144

Query  463  KFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            KF+ V  DK +LWE GDNRVLKLP GG+F +V  WN T + ++LLPL+
Sbjct  145  KFLTVRADKTVLWEGGDNRVLKLPKGGNFGIVSHWNATGEAVDLLPLE  192



>ref|XP_002872212.1| hypothetical protein ARALYDRAFT_489476 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48471.1| hypothetical protein ARALYDRAFT_489476 [Arabidopsis lyrata subsp. 
lyrata]
Length=1193

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 109/168 (65%), Gaps = 2/168 (1%)
 Frame = +1

Query  91   HIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGK  270
            H  S+  T + +   S P+L+   + +  S  +   R  SSR  C  +S  T  +E++ K
Sbjct  7    HCCSSPFTFITRNTSSLPKLVNFTRRVNLSHQSHRLRNSSSRLTCTATSSST--IEEQRK  64

Query  271  EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGE  450
            +K  +   +KL + LD+QV++GEH+A+ GS KE+GSWKK   ++WTE GWV E+EL GG+
Sbjct  65   KKDGSGTKVKLNVRLDYQVKFGEHVAMFGSAKEIGSWKKKSPLNWTENGWVCELELDGGQ  124

Query  451  PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
             +E+KFVIV  D +L WE+GDNRVLK+P  G+F +VC W+ T + L+L
Sbjct  125  VLEYKFVIVKDDGSLSWESGDNRVLKVPNSGNFSVVCHWDATRETLDL  172



>ref|XP_006845104.1| hypothetical protein AMTR_s00005p00168970 [Amborella trichopoda]
 gb|ERN06779.1| hypothetical protein AMTR_s00005p00168970 [Amborella trichopoda]
Length=1176

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 110/194 (57%), Gaps = 14/194 (7%)
 Frame = +1

Query  13   LCSFTLFSFMDSLRALHNAKYAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNR  192
            + SF LFS   S            Y     +  +SL  LK   PR  L P    GS  + 
Sbjct  1    MASFRLFSCSSS----------SLYTDYDESSSSSLHILKL-RPRFFLLP-CFEGSRFSS  48

Query  193  PTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKEL  372
                     +    SV  RE +    +++     + ++I LDHQV++GEHIAI GS+KEL
Sbjct  49   HVLSRRLYPVVCRGSVSEREAKMAPVDRKKG--KVAIRIRLDHQVKFGEHIAITGSSKEL  106

Query  373  GSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFK  552
            GSWKKNV M WTE GWV++++LKGGE VE+KFVI+ K+K  +WE GDNR LKLP  G F+
Sbjct  107  GSWKKNVDMSWTEDGWVADLKLKGGENVEYKFVILAKEKTTIWEEGDNRALKLPKEGKFE  166

Query  553  MVCQWNVTDKPLEL  594
            MVC WN T + + L
Sbjct  167  MVCHWNQTREAVNL  180



>ref|XP_004497421.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=1212

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = +1

Query  211  SRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN  390
            S T+  +S+  + + + +  +     EN+ L + LDHQV++G+H+A++GSTK+LGSWK N
Sbjct  47   SHTLPLLSAFSSTQTQPRKSKNNIKIENVHLHVRLDHQVQFGDHVALLGSTKQLGSWKTN  106

Query  391  VMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWN  570
            V ++WT+ GWV +++ KGG+ +EFKF+IV  D  ++WE G NR+L LPA G F+ V  WN
Sbjct  107  VPLNWTQNGWVCDLDFKGGDHIEFKFLIVTNDGTVVWEAGQNRLLNLPAAGHFQTVATWN  166

Query  571  VTDKPLELLPLD  606
             T++ +ELLPL+
Sbjct  167  TTNQIMELLPLN  178



>ref|XP_004497422.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=1180

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = +1

Query  211  SRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN  390
            S T+  +S+  + + + +  +     EN+ L + LDHQV++G+H+A++GSTK+LGSWK N
Sbjct  47   SHTLPLLSAFSSTQTQPRKSKNNIKIENVHLHVRLDHQVQFGDHVALLGSTKQLGSWKTN  106

Query  391  VMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWN  570
            V ++WT+ GWV +++ KGG+ +EFKF+IV  D  ++WE G NR+L LPA G F+ V  WN
Sbjct  107  VPLNWTQNGWVCDLDFKGGDHIEFKFLIVTNDGTVVWEAGQNRLLNLPAAGHFQTVATWN  166

Query  571  VTDKPLELLPLD  606
             T++ +ELLPL+
Sbjct  167  TTNQIMELLPLN  178



>ref|XP_006394878.1| hypothetical protein EUTSA_v10003634mg [Eutrema salsugineum]
 gb|ESQ32164.1| hypothetical protein EUTSA_v10003634mg [Eutrema salsugineum]
Length=880

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 99/153 (65%), Gaps = 4/153 (3%)
 Frame = +1

Query  136  SEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWL  315
            S PR++   + +     ++  R   SR  CA SS     +E++ K+K  +   +KL + L
Sbjct  21   SLPRIVNFTRSVHLGRQSQRLRNSPSRLTCAASST----IEEQRKKKDGSGTKVKLNVRL  76

Query  316  DHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  495
            +HQV +GEH+A+ GS KE+GSWKK   + WTE GWV E+EL GG+ +E+KFVIV  D +L
Sbjct  77   NHQVNFGEHVAMFGSAKEIGSWKKKSPLTWTENGWVCELELSGGQVLEYKFVIVHNDGSL  136

Query  496  LWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
             WE+GDNRVLKLP  GSF +VC W+ T + L+ 
Sbjct  137  SWESGDNRVLKLPNSGSFSVVCHWDATGETLDF  169



>ref|NP_001119280.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
 gb|AED93556.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
Length=865

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 101/153 (66%), Gaps = 2/153 (1%)
 Frame = +1

Query  136  SEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWL  315
            S PRL+     +  S  +   R  +SR  C  +S  T  +E++ K+K  +   ++L + L
Sbjct  23   SLPRLVNITHRVNLSHQSHRLRNSNSRLTCTATSSST--IEEQRKKKDGSGTKVRLNVRL  80

Query  316  DHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  495
            DHQV +G+H+A+ GS KE+GSWKK   ++W+E GWV E+EL GG+ +E+KFVIV  D +L
Sbjct  81   DHQVNFGDHVAMFGSAKEIGSWKKKSPLNWSENGWVCELELDGGQVLEYKFVIVKNDGSL  140

Query  496  LWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
             WE+GDNRVLK+P  G+F +VC W+ T + L+L
Sbjct  141  SWESGDNRVLKVPNSGNFSVVCHWDATRETLDL  173



>ref|XP_009416602.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=1264

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 86/103 (83%), Gaps = 3/103 (3%)
 Frame = +1

Query  295  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  474
            +++++ LDHQVE+GEH+A++GSTKELGSW+K+VMM+WT  GWV ++EL+GGE VEFKFV+
Sbjct  158  VRVRVRLDHQVEFGEHVAVLGSTKELGSWRKHVMMEWTPDGWVQDIELRGGESVEFKFVV  217

Query  475  V--GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  597
            +  GK K+++WE G NRVL LP  G+F MVC WN TD+ LELL
Sbjct  218  LLRGK-KDVVWEGGGNRVLTLPEKGAFDMVCHWNRTDEALELL  259



>ref|NP_198009.3| phosphoglucan, water dikinase [Arabidopsis thaliana]
 sp|Q6ZY51.1|PWD_ARATH RecName: Full=Phosphoglucan, water dikinase, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAG25776.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
 gb|AED93555.1| phosphoglucan, water dikinase [Arabidopsis thaliana]
Length=1196

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 101/153 (66%), Gaps = 2/153 (1%)
 Frame = +1

Query  136  SEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWL  315
            S PRL+     +  S  +   R  +SR  C  +S  T  +E++ K+K  +   ++L + L
Sbjct  23   SLPRLVNITHRVNLSHQSHRLRNSNSRLTCTATSSST--IEEQRKKKDGSGTKVRLNVRL  80

Query  316  DHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  495
            DHQV +G+H+A+ GS KE+GSWKK   ++W+E GWV E+EL GG+ +E+KFVIV  D +L
Sbjct  81   DHQVNFGDHVAMFGSAKEIGSWKKKSPLNWSENGWVCELELDGGQVLEYKFVIVKNDGSL  140

Query  496  LWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
             WE+GDNRVLK+P  G+F +VC W+ T + L+L
Sbjct  141  SWESGDNRVLKVPNSGNFSVVCHWDATRETLDL  173



>ref|XP_010907528.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Elaeis 
guineensis]
Length=926

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 91/122 (75%), Gaps = 4/122 (3%)
 Frame = +1

Query  253  VEKKGKEKRSA---HENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWV  423
            VE+  +EKR A      +++++ LDHQVE+GEH+A++GSTKELG WK+ V MDWT +GWV
Sbjct  57   VERIEEEKRKASGKRRKVRMRVQLDHQVEFGEHVAVLGSTKELGLWKRQVPMDWTPEGWV  116

Query  424  SEMELKGGEPVEFKFVIVGKDK-NLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLP  600
             E+EL GGE +E+KFVI+ K K  ++WE GDNRVLKLP  G F MVC+WN T + ++LL 
Sbjct  117  CELELCGGEVLEYKFVILRKGKMGMIWEDGDNRVLKLPEEGMFDMVCRWNKTGEAVDLLG  176

Query  601  LD  606
             D
Sbjct  177  AD  178



>gb|KFK26410.1| hypothetical protein AALP_AA8G245000 [Arabis alpina]
Length=1180

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 93/133 (70%), Gaps = 4/133 (3%)
 Frame = +1

Query  199  RGLSSRTIC-AVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  375
            R   SR  C A SS  T E ++K   K ++   +KLK+ LDHQV +GEH+A+ GS KE+G
Sbjct  42   RNSHSRLTCTASSSSSTIEDQRK---KDASGTKVKLKVRLDHQVNFGEHVAMFGSAKEIG  98

Query  376  SWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  555
            SWKK   ++WTE GWV ++EL GG+ +E+KFVIV  D +L WE+GDNRVL+LP  GSF +
Sbjct  99   SWKKKSPLNWTENGWVCDLELSGGQVLEYKFVIVQNDGSLSWESGDNRVLRLPNSGSFSV  158

Query  556  VCQWNVTDKPLEL  594
            VC WN T + L++
Sbjct  159  VCHWNATGETLDV  171



>ref|XP_009111699.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Brassica 
rapa]
Length=1184

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 93/130 (72%), Gaps = 2/130 (2%)
 Frame = +1

Query  217  TICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM  396
            T C+ +S  T  +E++ K +  +   ++L + LD QV++GEH+A+ GS KE+GSWK+   
Sbjct  51   TCCSSASSST--IEEQRKNRDGSGPKVRLNVRLDRQVKFGEHVAVFGSAKEIGSWKEKSP  108

Query  397  MDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVT  576
            + W+EKGWV E+EL GGE +EFKFV+V KD +L WE+GDNRVLKLP  GSF +VC W+ T
Sbjct  109  LAWSEKGWVCELELSGGEALEFKFVVVKKDGSLSWESGDNRVLKLPKSGSFSVVCHWDAT  168

Query  577  DKPLELLPLD  606
             + L+L  +D
Sbjct  169  GETLDLPLVD  178



>ref|XP_010424348.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Camelina sativa]
Length=1126

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +1

Query  256  EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEME  435
            E++ K+K  +   +KL + LDHQV++GEH+A+ GS KE+GSWKK   ++WT+KGWV E+E
Sbjct  50   EEQRKKKDGSGTKVKLNVRLDHQVQFGEHVAMFGSAKEIGSWKKKSPLNWTDKGWVCEIE  109

Query  436  LKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
            L GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +VC W+ T + L+L
Sbjct  110  LDGGQVLEYKFVIVKNDGSLSWESGDNRVLKLPNSGNFSVVCHWDATRETLDL  162



>emb|CDY19771.1| BnaA09g04240D [Brassica napus]
Length=1179

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = +1

Query  217  TICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM  396
            T C+ +S  T  +E++ K +  +   ++L + LD QV++GEH+A+ GS KE+GSWK+   
Sbjct  51   TCCSSASSST--IEEQRKNRDGSGPKVRLNVRLDRQVKFGEHVAVFGSAKEIGSWKEKSP  108

Query  397  MDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVT  576
            + W+EKGWV E+EL GGE +EFKFV+V KD +L WE+GDNRVLKLP  GSF +VC W+ T
Sbjct  109  LAWSEKGWVCELELNGGEALEFKFVVVKKDGSLSWESGDNRVLKLPKSGSFSVVCHWDAT  168

Query  577  DKPLEL  594
             + L+L
Sbjct  169  GETLDL  174



>ref|XP_006286926.1| hypothetical protein CARUB_v10000070mg [Capsella rubella]
 gb|EOA19824.1| hypothetical protein CARUB_v10000070mg [Capsella rubella]
Length=1195

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +1

Query  199  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  378
            R  SSR  C+ +S  +   E++ KE  S  + +KL + LDHQV +GEH+A+ GS KE+GS
Sbjct  45   RNSSSRLTCSAASSSSTIEEQRKKEDGSGTK-VKLNVRLDHQVNFGEHVAMFGSAKEIGS  103

Query  379  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  558
            WKK   ++WTE GWV E+ L GG+ +E+KFVIV  D +L WE+GDNRVLKLP  G+F +V
Sbjct  104  WKKKSPLNWTENGWVCELNLDGGQVLEYKFVIVKDDGSLSWESGDNRVLKLPNSGNFSVV  163

Query  559  CQWNVTDKPLEL  594
            C W+ T + L+L
Sbjct  164  CHWDATRETLDL  175



>gb|ABK26307.1| unknown [Picea sitchensis]
Length=237

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 102/167 (61%), Gaps = 5/167 (3%)
 Frame = +1

Query  109  RTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSV-ETREVEKKGKEKRSA  285
            +T  G+ K S  RLI  P G   S +N          +C+ + +  T+  EK G   RS 
Sbjct  25   KTIFGR-KCSGKRLIFLPSG-GFSPLNTSFSANRGSILCSSAGIASTQRSEKMGI--RSG  80

Query  286  HENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFK  465
               ++L   LDHQV +GE+ AI+GS+K LG+WKK +MM W+E GW+ ++E  GGE VE+K
Sbjct  81   EGKVQLHFRLDHQVRFGENHAILGSSKALGAWKKKLMMSWSESGWILDLETGGGEKVEYK  140

Query  466  FVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            F+IV +D  ++WE G NRVL+LP  G+F++VC W+ T + L L   D
Sbjct  141  FLIVSRDGKIIWEGGCNRVLELPKEGNFEIVCHWDKTQEALNLQGTD  187



>emb|CDX87051.1| BnaC09g03660D [Brassica napus]
Length=1182

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +1

Query  253  VEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEM  432
            +E++ K +  +   +KL + LD QV++GEH+A+ GS KE+G WK+   + W+EKGWV E+
Sbjct  65   IEEQRKNRDGSGGKVKLNVRLDRQVKFGEHVAMFGSAKEIGCWKEKSPLAWSEKGWVCEL  124

Query  433  ELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            EL GGE +EFKFV+V KD +L WE+GDNRVLKLP  GSF +VC W+ T + L+L  +D
Sbjct  125  ELSGGEALEFKFVVVKKDGSLSWESGDNRVLKLPDSGSFSVVCHWDATGEALDLPLVD  182



>ref|XP_007142602.1| hypothetical protein PHAVU_007G001400g [Phaseolus vulgaris]
 gb|ESW14596.1| hypothetical protein PHAVU_007G001400g [Phaseolus vulgaris]
Length=952

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 89/135 (66%), Gaps = 6/135 (4%)
 Frame = +1

Query  220  ICAVSSVETREVEKKGKE------KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  381
            + AVSS E++  +++ +E        S    ++L++ LDHQV++G+H+AI GSTKELGSW
Sbjct  54   LSAVSSPESQTRDEQQQEGDNNPSSVSMDRKVRLQVRLDHQVQFGDHVAIRGSTKELGSW  113

Query  382  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  561
            K NV + WT+ GWV  +E KG + +EFKF+ V KD  ++WE G NRVLKLP  G F  V 
Sbjct  114  KTNVPLSWTKNGWVCLLEFKGTDHIEFKFITVKKDSTMVWEAGQNRVLKLPVAGHFTTVA  173

Query  562  QWNVTDKPLELLPLD  606
             W+ T   LEL PLD
Sbjct  174  TWDATQTNLELHPLD  188



>gb|AAU93516.1| chloroplast alpha-glucan water dikinase isoform 3 [Arabidopsis 
thaliana]
Length=1196

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 99/153 (65%), Gaps = 2/153 (1%)
 Frame = +1

Query  136  SEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWL  315
            S PRL+     +  S  +   R  +SR     +S  T  +E++ K+K  +   ++L + L
Sbjct  23   SLPRLVNITHRVNLSHQSHRLRNSNSRLTRTATSSST--IEEQRKKKDGSGTKVRLNVRL  80

Query  316  DHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  495
            DHQV +G+H+A+ GS KE+GSWKK   ++W+E GWV E+EL GG+ +E KFVIV  D +L
Sbjct  81   DHQVNFGDHVAMFGSAKEIGSWKKKSPLNWSENGWVCELELDGGQVLECKFVIVKNDGSL  140

Query  496  LWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
             WE+GDNRVLK+P  G+F +VC W+ T + L+L
Sbjct  141  SWESGDNRVLKVPNSGNFSVVCHWDATRETLDL  173



>ref|XP_008454006.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X1 [Cucumis melo]
Length=1237

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 95/136 (70%), Gaps = 4/136 (3%)
 Frame = +1

Query  208  SSRTICAVSSVETREVEKKGKE----KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  375
            S R +C VSS     + +  ++    K  +   + LK+ LDHQV++GE + I+GS++ELG
Sbjct  55   SRRIVCGVSSASQETIREDEEQMMTGKLGSGGKVLLKVRLDHQVQFGESVVILGSSEELG  114

Query  376  SWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  555
            SWK   +++W++ GWV ++E +G E VEFKFVI+GKD ++LWE+GDNRVL+LP  G F +
Sbjct  115  SWKNYTLLNWSKDGWVCDLEHRGDERVEFKFVILGKDGSVLWESGDNRVLQLPKVGKFSL  174

Query  556  VCQWNVTDKPLELLPL  603
            V +WN T + +++LPL
Sbjct  175  VYKWNKTGEAVDMLPL  190



>emb|CDY65142.1| BnaC02g48400D [Brassica napus]
Length=1315

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 101/172 (59%), Gaps = 13/172 (8%)
 Frame = +1

Query  82   PYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEK  261
            P+  I   R +SL +L    PR           + +  ++  S R  C+ SS    E   
Sbjct  12   PFTSI--TRNSSLPRLVHFTPR-----------VFHIRSQSDSRRLTCSASSSTIEEQRM  58

Query  262  KGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELK  441
                   + + +KL + L+HQV++GEH+AI GS +E+GSWK+   + WTE GWV E+ L 
Sbjct  59   NKDGSGPSRKKVKLNVRLNHQVKFGEHVAIFGSAEEIGSWKEKSPLTWTETGWVCELHLN  118

Query  442  GGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  597
            GG+P+EFKFVI+  D +L WE+GDNRVL LP  G+F +VC W+ T + L+++
Sbjct  119  GGQPLEFKFVIMKTDGSLSWESGDNRVLNLPKSGAFSVVCHWDATREALDVV  170



>ref|XP_008799788.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Phoenix dactylifera]
Length=758

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 4/118 (3%)
 Frame = +1

Query  253  VEKKGKEKRSA---HENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWV  423
            VE+  +EKR A      + +++ LDHQVE+GE +A++GSTKELG WKK V MDWT +GWV
Sbjct  58   VERVEEEKRKASGKRRRVHIRVRLDHQVEFGEQVAVLGSTKELGLWKKQVPMDWTPEGWV  117

Query  424  SEMELKGGEPVEFKFVIVGKD-KNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
             E+EL GGE +E+KFVI+ K  K ++WE GDNRVLKLP  G F MVC+WN T + ++L
Sbjct  118  CELELCGGEVLEYKFVILMKGRKGMIWEDGDNRVLKLPEEGMFDMVCRWNKTGEAVDL  175



>gb|ABR17706.1| unknown [Picea sitchensis]
Length=328

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 103/177 (58%), Gaps = 8/177 (5%)
 Frame = +1

Query  88   RHIPSARRTSLGKL--KFSEPRLILEP-QGIPGSIMNRPTRGLSSRTICAVSSVET-REV  255
            RH P   + +  KL  K+SE RLI  P +G     +N       +  +C+ + + +    
Sbjct  23   RHNPDEPKVTCMKLGRKYSEKRLIFLPYEGF--RPLNTSFSANRASILCSNTGIASPHRD  80

Query  256  EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEME  435
            EK G   R     + L   LDHQV +GEH A++GS+K  G+WKK +MM W+E  W+ ++E
Sbjct  81   EKMGI--RCGERKVNLYFKLDHQVSFGEHHAVLGSSKAFGAWKKKLMMSWSESEWILDLE  138

Query  436  LKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
             +GGE VE+KFVIV  D  ++WE G NRVL LP  G F++VC W+ T + L+L  +D
Sbjct  139  TRGGEKVEYKFVIVSGDGKIIWEGGHNRVLALPKEGRFEIVCHWDKTQEALDLQRMD  195



>gb|ABG21981.1| chloroplast alpha-glucan water dikinase isoform 3, putative, 
expressed [Oryza sativa Japonica Group]
Length=728

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 105/164 (64%), Gaps = 16/164 (10%)
 Frame = +1

Query  142  PR--LILEPQGIPGSIMNR-------PTRGLSSRTICAVSSVETREVEKKGKEKRSAHEN  294
            PR  L+L P G+   ++ R         RG + R   A S+ E R  EKK ++  S    
Sbjct  17   PRRGLVLPPPGVGAGVLLRRGAMALPGRRGFACRGRSAASAAE-RTKEKKRRDS-SKQPL  74

Query  295  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  474
            + L++ L+HQV++GEH+ I+GSTKELGSW++ V ++WT  GWV +++L G   VEFKFVI
Sbjct  75   VHLQVCLEHQVKFGEHVGIIGSTKELGSWEEQVELEWTTNGWVCQLKLPGETLVEFKFVI  134

Query  475  V---GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  597
                GKDK  +WE G+NRV++LP  G F +VC WN T++PLELL
Sbjct  135  FLVGGKDK--IWEDGNNRVVELPKDGKFDIVCHWNRTEEPLELL  176



>ref|NP_001066613.1| Os12g0297500 [Oryza sativa Japonica Group]
 sp|Q2QTC2.2|PWD_ORYSJ RecName: Full=Phosphoglucan, water dikinase, chloroplastic; Flags: 
Precursor [Oryza sativa Japonica Group]
 gb|ABA97816.2| chloroplast alpha-glucan water dikinase isoform 3, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29632.1| Os12g0297500 [Oryza sativa Japonica Group]
Length=1206

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 105/164 (64%), Gaps = 16/164 (10%)
 Frame = +1

Query  142  PR--LILEPQGIPGSIMNR-------PTRGLSSRTICAVSSVETREVEKKGKEKRSAHEN  294
            PR  L+L P G+   ++ R         RG + R   A S+ E R  EKK ++  S    
Sbjct  17   PRRGLVLPPPGVGAGVLLRRGAMALPGRRGFACRGRSAASAAE-RTKEKKRRDS-SKQPL  74

Query  295  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  474
            + L++ L+HQV++GEH+ I+GSTKELGSW++ V ++WT  GWV +++L G   VEFKFVI
Sbjct  75   VHLQVCLEHQVKFGEHVGIIGSTKELGSWEEQVELEWTTNGWVCQLKLPGETLVEFKFVI  134

Query  475  V---GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  597
                GKDK  +WE G+NRV++LP  G F +VC WN T++PLELL
Sbjct  135  FLVGGKDK--IWEDGNNRVVELPKDGKFDIVCHWNRTEEPLELL  176



>ref|XP_009129923.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Brassica rapa]
Length=1156

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 104/176 (59%), Gaps = 14/176 (8%)
 Frame = +1

Query  73   YAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETRE  252
            Y  P+  I   R +SL +L    PR I           +  ++  S R +   +S  T E
Sbjct  9    YTSPFASI--TRNSSLPRLLHFTPRAI-----------HIRSQSDSRRLLTCSASSSTIE  55

Query  253  VEKKGKEKRS-AHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSE  429
              +K K+    + + +KL + L+HQV++GEH+AI GS +E+GSWK+   + WTE GWV E
Sbjct  56   EHRKNKDGSGPSRKKVKLNVRLNHQVKFGEHVAIFGSAEEIGSWKEKSPLTWTETGWVCE  115

Query  430  MELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  597
            + L G + +EFKFVIV  D +L WE+GDNRVL LP  G+F +VC W+ T + L+++
Sbjct  116  LHLNGDQALEFKFVIVKTDGSLSWESGDNRVLNLPKSGAFSVVCHWDATREALDVV  171



>emb|CDY05529.1| BnaA02g31620D [Brassica napus]
Length=1312

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 104/176 (59%), Gaps = 14/176 (8%)
 Frame = +1

Query  73   YAYPYRHIPSARRTSLGKLKFSEPRLILEPQGIPGSIMNRPTRGLSSRTICAVSSVETRE  252
            Y  P+  I   R +SL +L    PR I           +  ++  S R +   +S  T E
Sbjct  9    YTSPFASI--TRNSSLPRLLHFTPRAI-----------HIRSQSDSRRLLTCSASSSTIE  55

Query  253  VEKKGKEKRS-AHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSE  429
              +K K+    + + +KL + L+HQV++GEH+AI GS +E+GSWK+   + WTE GWV E
Sbjct  56   EHRKNKDGSGPSRKKVKLNVRLNHQVKFGEHVAIFGSAEEIGSWKEKSPLTWTETGWVCE  115

Query  430  MELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  597
            + L G + +EFKFVIV  D +L WE+GDNRVL LP  G+F +VC W+ T + L+++
Sbjct  116  LHLNGDQALEFKFVIVKTDGSLSWESGDNRVLNLPKSGAFSVVCHWDATREALDVV  171



>gb|KGN53052.1| hypothetical protein Csa_4G012480 [Cucumis sativus]
Length=1241

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 91/134 (68%), Gaps = 4/134 (3%)
 Frame = +1

Query  214  RTICAVSSVETREV----EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  381
            R +C VSS     +    E+K   K  +   + LK+ L HQVE+GE + I+GS++ELGSW
Sbjct  57   RIVCGVSSASQETIREDEEQKMTGKLGSGGKVLLKLRLAHQVEFGESVVILGSSEELGSW  116

Query  382  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  561
            K   +++W++ GWV ++E +G E VEFKFVI+GKD ++ WE+GDNRVL+LP  G F +  
Sbjct  117  KNYTLLNWSKDGWVCDLEHRGDERVEFKFVILGKDGSVSWESGDNRVLQLPKVGKFSLAY  176

Query  562  QWNVTDKPLELLPL  603
            QWN T + +E+LPL
Sbjct  177  QWNKTGEVVEMLPL  190



>gb|KEH27294.1| phosphoglucan, water dikinase [Medicago truncatula]
Length=1202

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 86/130 (66%), Gaps = 1/130 (1%)
 Frame = +1

Query  217  TICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM  396
            ++ A SS +T+        K+    N+ L + LDHQV++G+H+ ++GSTK+LGSW  +V 
Sbjct  63   SVAASSSTQTQP-RNNTNNKKEEDINVHLHLRLDHQVQFGDHVVLLGSTKQLGSWTTHVP  121

Query  397  MDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVT  576
            ++WT  GWV +     G+ +EFKF+IV +D  L WE+GDNRVL LP  G F+ + +WN T
Sbjct  122  LNWTPNGWVCDFHFNAGDHLEFKFIIVHQDGTLHWESGDNRVLNLPNAGHFQTIAKWNKT  181

Query  577  DKPLELLPLD  606
             + +ELLPL+
Sbjct  182  HQTMELLPLN  191



>gb|EEE53074.1| hypothetical protein OsJ_35828 [Oryza sativa Japonica Group]
Length=1188

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 94/136 (69%), Gaps = 7/136 (5%)
 Frame = +1

Query  199  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  378
            RG + R   A S+ E R  EKK ++  S    + L++ L+HQV++GEH+ I+GSTKELGS
Sbjct  7    RGFACRGRSAASAAE-RTKEKKRRDS-SKQPLVHLQVCLEHQVKFGEHVGIIGSTKELGS  64

Query  379  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSF  549
            W++ V ++WT  GWV +++L G   VEFKFVI    GKDK  +WE G+NRV++LP  G F
Sbjct  65   WEEQVELEWTTNGWVCQLKLPGETLVEFKFVIFLVGGKDK--IWEDGNNRVVELPKDGKF  122

Query  550  KMVCQWNVTDKPLELL  597
             +VC WN T++PLELL
Sbjct  123  DIVCHWNRTEEPLELL  138



>ref|XP_008454007.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic isoform 
X2 [Cucumis melo]
Length=1161

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +1

Query  301  LKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVG  480
            LK+ LDHQV++GE + I+GS++ELGSWK   +++W++ GWV ++E +G E VEFKFVI+G
Sbjct  14   LKVRLDHQVQFGESVVILGSSEELGSWKNYTLLNWSKDGWVCDLEHRGDERVEFKFVILG  73

Query  481  KDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL  603
            KD ++LWE+GDNRVL+LP  G F +V +WN T + +++LPL
Sbjct  74   KDGSVLWESGDNRVLQLPKVGKFSLVYKWNKTGEAVDMLPL  114



>ref|XP_006663965.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Oryza brachyantha]
Length=1206

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 103/170 (61%), Gaps = 15/170 (9%)
 Frame = +1

Query  109  RTSLGKLKFSEPRLIL------EPQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGK  270
            RT  G +    PR++       E   +PG       RG S R   A S+ E   +++K +
Sbjct  16   RTHRGLVLLPPPRVVAGAMFRREAIALPGR------RGFSCRGGSAASAAE--RIKEKQR  67

Query  271  EKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGE  450
               S    + L+++L+HQV++GEHI ++GSTKELGSWK+ V ++WT  GWV +++L G  
Sbjct  68   GDSSKKPLVHLQVYLEHQVKFGEHIGVIGSTKELGSWKEQVELEWTPDGWVCQLKLPGET  127

Query  451  PVEFKFVIVGKD-KNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  597
             VEFKFVI  K  K+  WE G+NRV++LP  G + +VC WN T +PLELL
Sbjct  128  LVEFKFVIFLKGIKDKTWEDGNNRVVELPKDGKYDIVCHWNRTKEPLELL  177



>ref|XP_004152111.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004156941.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Cucumis sativus]
Length=1217

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 92/138 (67%), Gaps = 7/138 (5%)
 Frame = +1

Query  214  RTICAVSSVETREV----EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW  381
            R +C VSS     +    E+K   K  +   + LK+ L HQVE+GE + I+GS++ELGSW
Sbjct  57   RIVCGVSSASQETIREDEEQKMTGKLGSGGKVLLKLRLAHQVEFGESVVILGSSEELGSW  116

Query  382  KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVC  561
            K   +++W++ GWV ++E +G E VEFKFVI+GKD ++ WE+GDNRVL+LP  G F +  
Sbjct  117  KNYTLLNWSKDGWVCDLEHRGDERVEFKFVILGKDGSVSWESGDNRVLQLPKVGKFSLAY  176

Query  562  QWNVTDKPLEL---LPLD  606
            QWN T + +E+   LPLD
Sbjct  177  QWNKTGEVVEINETLPLD  194



>ref|XP_002453659.1| hypothetical protein SORBIDRAFT_04g010020 [Sorghum bicolor]
 gb|EES06635.1| hypothetical protein SORBIDRAFT_04g010020 [Sorghum bicolor]
Length=1212

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 86/134 (64%), Gaps = 8/134 (6%)
 Frame = +1

Query  214  RTICAVSSVETREVEKKGKEKR---SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  384
            RT     +  T+ + +  +EK+   S  + ++L + LDHQV +GEH+ I+GS KELGSWK
Sbjct  53   RTRGTGVAASTKHITRTKEEKQTDPSKQDIVRLHVCLDHQVMFGEHVGIIGSAKELGSWK  112

Query  385  KNVMMDWTEKGWVSEMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSFKM  555
              V MDWT  GWV +++L G   +EFKFV+    GKDK  +WE GDNRV+ LP  GSF M
Sbjct  113  SPVEMDWTPNGWVCQLDLPGETLLEFKFVVFLNRGKDK--IWEDGDNRVVNLPKNGSFDM  170

Query  556  VCQWNVTDKPLELL  597
             C WN T +PL LL
Sbjct  171  ACHWNKTKEPLNLL  184



>ref|XP_004952076.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Setaria italica]
Length=1206

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 90/134 (67%), Gaps = 4/134 (3%)
 Frame = +1

Query  199  RGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS  378
            RG S R   A S+ +     K+ K  + + + ++L++ LDHQV++GEH+ I+GSTKE+GS
Sbjct  47   RGFSCRAGSAASAAQRT---KEKKRTKPSKDRVQLRVCLDHQVKFGEHVGIIGSTKEVGS  103

Query  379  WKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKD-KNLLWETGDNRVLKLPAGGSFKM  555
            WK  V M+WT  GWV +++L G   +EFKFVI  K+ K  +WE GDNRV+ LP  G+F +
Sbjct  104  WKSQVEMEWTPDGWVCQLDLPGETLMEFKFVIFLKEGKEKVWEDGDNRVVNLPKDGAFDI  163

Query  556  VCQWNVTDKPLELL  597
            +C WN T + L+LL
Sbjct  164  LCHWNRTKESLDLL  177



>gb|KHN37254.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=1179

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 92/140 (66%), Gaps = 11/140 (8%)
 Frame = +1

Query  220  ICAVSS---VETR-----EVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  375
            I AVSS    +TR     E E++  + +S    ++L++ LDHQV++G+H+ I GSTKELG
Sbjct  52   ISAVSSSPQTQTRDDQDQEHEQEQGKNKSLKNKVRLQVRLDHQVQFGDHVVIRGSTKELG  111

Query  376  SWKKNVMMDWTEKGWVSEMELKGGE---PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGS  546
            SW  +V ++WT+ GWV ++E + G+    +EFKFV V KD  L+WE G+NRVLK+P  G+
Sbjct  112  SWTNSVPLNWTQNGWVCDLEFEQGQGTLHIEFKFVTVNKDDTLVWEAGENRVLKVPGAGN  171

Query  547  FKMVCQWNVTDKPLELLPLD  606
            F  V  W+ T + LEL  LD
Sbjct  172  FATVATWDATQETLELHSLD  191



>ref|XP_010228078.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic [Brachypodium 
distachyon]
Length=1182

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 80/101 (79%), Gaps = 5/101 (5%)
 Frame = +1

Query  301  LKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIV-  477
            L+++L+HQV++GEH+ ++GSTKELGSWKK+V + WT+ GWV ++EL     VEFKFVI+ 
Sbjct  76   LRVFLEHQVKFGEHVGVIGSTKELGSWKKHVELVWTQDGWVGQLELPAETLVEFKFVIIL  135

Query  478  --GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
              GK K   WE G+NRV++LP GG+F +VC WN+T++PL+L
Sbjct  136  EGGKGKT--WEDGNNRVIELPKGGTFDIVCHWNMTEEPLDL  174



>gb|EMS54440.1| Phosphoglucan, water dikinase, chloroplastic [Triticum urartu]
Length=1059

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 83/124 (67%), Gaps = 4/124 (3%)
 Frame = +1

Query  220  ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMM  399
            IC      T+E   K +   S   ++ L++ L HQV+YGEH+ I+GS KELG+WK++V +
Sbjct  4    ICVSVYCRTKE---KNRADPSKSGSVLLQVCLQHQVKYGEHVGIIGSAKELGAWKQHVKL  60

Query  400  DWTEKGWVSEMELKGGEPVEFKFVIVGKDKN-LLWETGDNRVLKLPAGGSFKMVCQWNVT  576
            DW+E GWV ++EL G   VEFKFVIV K  N   WE GDNR ++LP GG+  +VC W+ T
Sbjct  61   DWSEDGWVCQLELPGEAAVEFKFVIVSKGGNDKTWEGGDNRAIQLPKGGTLDIVCNWDKT  120

Query  577  DKPL  588
            ++PL
Sbjct  121  EEPL  124



>ref|XP_006589801.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglucan, water dikinase, 
chloroplastic-like [Glycine max]
Length=1186

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 81/117 (69%), Gaps = 4/117 (3%)
 Frame = +1

Query  265  GKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKG  444
            GK K S    ++L++ LDHQV++G+H+ I GSTKELGSW  +V ++WT+ GWV ++E + 
Sbjct  78   GKNK-SLKNKVRLQVRLDHQVQFGDHVVIRGSTKELGSWTNSVPLNWTQNGWVCDLEFEQ  136

Query  445  GEP---VEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPLD  606
            G+    +EFKFV V KD  L+WE G+NRVLK+P  G+F  V  W+ T + LEL  LD
Sbjct  137  GQGTLHIEFKFVTVNKDDTLVWEAGENRVLKVPGAGNFATVATWDATQETLELHSLD  193



>gb|EEC69133.1| hypothetical protein OsI_38056 [Oryza sativa Indica Group]
Length=1191

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 88/121 (73%), Gaps = 7/121 (6%)
 Frame = +1

Query  250  EVEKKGKEKRSAHEN--LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWV  423
            ++  K K++R + +   + L++ L+HQV++GEH+ I+GSTKELGSW++ V ++WT  GWV
Sbjct  23   DILTKEKKRRDSSKQPLVHLQVCLEHQVKFGEHVGIIGSTKELGSWEEQVELEWTTNGWV  82

Query  424  SEMELKGGEPVEFKFVIV---GKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
             +++L G   VEFKFVI    GKDK  +WE G+NRV++LP  G F +VC WN T++PLEL
Sbjct  83   CQLKLPGETLVEFKFVIFLVGGKDK--IWEDGNNRVVELPKDGKFDIVCHWNRTEEPLEL  140

Query  595  L  597
            L
Sbjct  141  L  141



>gb|EPS59827.1| glucan/water dikinase, partial [Genlisea aurea]
Length=315

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 88/125 (70%), Gaps = 7/125 (6%)
 Frame = +1

Query  247  REVEKKGKEKRSAHENL----KLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEK  414
            RE E+K   K+    N+    +++  L+HQV +GEH+A++GS KELG WKK +MM+WTE 
Sbjct  1    REGEEKNLMKKERQLNVVGKVEVEFRLEHQVAFGEHVALLGSVKELGFWKKKLMMNWTEN  60

Query  415  GWVSEMELKGGEP-VEFKFVIVGKDK-NLLWETGDNRVLKLPAGG-SFKMVCQWNVTDKP  585
            GW+  + L   E  VE+KF IVGKDK NL+WE+G+NR L LP  G SF +VC+W+ TD+ 
Sbjct  61   GWICNLNLDTSEQLVEYKFAIVGKDKQNLIWESGENRTLTLPEKGRSFSVVCKWDKTDEM  120

Query  586  LELLP  600
            +++LP
Sbjct  121  VQVLP  125



>gb|EMT02873.1| Phosphoglucan, water dikinase, chloroplastic [Aegilops tauschii]
Length=998

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = +1

Query  244  TREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWV  423
            +R  ++K +   S   ++ L++ L+HQV+YGEH+ I+GS KELG+WK++V +DWT+ GWV
Sbjct  7    SRRTKEKSRADPSKSGSVLLQVCLEHQVKYGEHVGIIGSAKELGAWKQHVELDWTQDGWV  66

Query  424  SEMELKGGEPVEFKFVIVGKDKN-LLWETGDNRVLKLPAGGSFKMVCQWNVTDKPL  588
             ++EL     VEFKFVIV K  N   WE GDNR ++LP GG+  + C W+ T++PL
Sbjct  67   CQLELPSEALVEFKFVIVSKGGNDKTWEGGDNRAIQLPKGGTLDIACNWDKTEEPL  122



>ref|XP_008662597.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Zea mays]
Length=287

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 67/92 (73%), Gaps = 5/92 (5%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVIV---GKDKNLLW  501
            +GEH+ I+GSTKELGSWK  V MDWT  GWV ++++ G   +EFKFVI+   GKDK  +W
Sbjct  2    FGEHVGIIGSTKELGSWKSQVDMDWTPNGWVCQLDVPGEALLEFKFVIILNKGKDK--IW  59

Query  502  ETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  597
            E GDNRV+ LP  GSF M C WN T +PL+LL
Sbjct  60   EDGDNRVVNLPKNGSFDMPCHWNKTKEPLDLL  91



>ref|XP_002973212.1| hypothetical protein SELMODRAFT_99378 [Selaginella moellendorffii]
 gb|EFJ25586.1| hypothetical protein SELMODRAFT_99378 [Selaginella moellendorffii]
Length=1104

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 67/95 (71%), Gaps = 1/95 (1%)
 Frame = +1

Query  295  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  474
            +K ++ LDHQVE+GEH A++GS   +GSWK +V M WTE GWV+++E   G+  EFK+VI
Sbjct  10   VKFRLRLDHQVEFGEHHAVIGSADFMGSWKNHVSMTWTESGWVADIEASPGDRAEFKYVI  69

Query  475  VGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTD  579
            V  D  L WE G NRVL +P+GGS ++V QW   D
Sbjct  70   VAGDGRLTWEEGPNRVLDVPSGGS-EIVSQWENPD  103



>ref|XP_002976638.1| hypothetical protein SELMODRAFT_105597 [Selaginella moellendorffii]
 gb|EFJ22307.1| hypothetical protein SELMODRAFT_105597 [Selaginella moellendorffii]
Length=1101

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = +1

Query  295  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  474
            +KL++ LDHQV++GEH A++GS   +GSWK +V M WTE GWV+++E   G+  EFK+VI
Sbjct  10   VKLRLRLDHQVKFGEHHAVIGSADFMGSWKNHVSMTWTESGWVADIEASPGDRAEFKYVI  69

Query  475  VGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTD  579
            V  D  L WE G NRVL +P+GGS ++V QW   D
Sbjct  70   VAGDGRLTWEEGPNRVLDVPSGGS-EIVSQWENPD  103



>ref|XP_001752167.1| predicted protein [Physcomitrella patens]
 gb|EDQ82900.1| predicted protein [Physcomitrella patens]
Length=1094

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +1

Query  289  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKF  468
            E +K+++ LDHQV++GE  AI+GS K +G+W++ V M WTE GWV ++E   GE VE+K 
Sbjct  11   EKVKVRVRLDHQVQFGETHAILGSAKSIGAWQEKVPMTWTEAGWVVDLEGDSGETVEYKH  70

Query  469  VIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVT  576
            +IV  D  ++WE G NR + LP  G F++V  W  T
Sbjct  71   IIVTHDGGVIWEEGPNRTISLPDEGDFELVTHWGCT  106



>ref|XP_001758857.1| predicted protein [Physcomitrella patens]
 gb|EDQ76363.1| predicted protein [Physcomitrella patens]
Length=1126

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +1

Query  295  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSEMELKGGEPVEFKFVI  474
            +K+++ +DHQV++GE  AI+GS++  G+W++ V + WTE GWV E+E   GE  E+K +I
Sbjct  8    VKVRLRIDHQVQFGESHAILGSSQCTGAWRERVPLQWTESGWVVELEANPGETFEYKHII  67

Query  475  VGKDKNLLWETGDNRVLKLPAGGSFKMVCQWNVTDKPLEL  594
            V    +++WE G NRVL +P  G F++V  W  T + L+L
Sbjct  68   VTHGGDVIWEGGPNRVLSVPDEGEFEVVTHWGCTHEELQL  107



>ref|XP_010040448.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
[Eucalyptus grandis]
Length=147

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 2/79 (3%)
 Frame = +1

Query  247  REVEKKGKE--KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKGW  420
            RE EKK K+   +   E + L + LD+QVE GE IAI GST+ELGS KKN+ MD T+ GW
Sbjct  3    REEEKKAKKIISKLGQEKMHLSVRLDYQVEIGESIAISGSTRELGSRKKNMAMDRTKSGW  62

Query  421  VSEMELKGGEPVEFKFVIV  477
            V  ++LKGGE V+ + +I+
Sbjct  63   VCVLKLKGGESVKLEELIL  81



>gb|KIZ07735.1| hypothetical protein MNEG_0234 [Monoraphidium neglectum]
Length=832

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = +1

Query  322  QVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKN  492
            QV YG+ + ++G+   LG W   + + + W+E   W  E+EL  G  VEFK V VGKD +
Sbjct  14   QVNYGQQLRVVGNAPGLGGWDTARGLHLKWSEGHVWSGEVELDAGSHVEFKLVCVGKDSD  73

Query  493  LLWETGDNRVLK-LPAGGSFKMVCQWNVTDK  582
              WE G+NR +K L AG S  + C+W  T +
Sbjct  74   -AWEDGNNRGIKVLGAGYSQDVHCEWGRTKE  103



>ref|XP_009778046.1| PREDICTED: uncharacterized protein LOC104227496 [Nicotiana sylvestris]
Length=440

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 71/129 (55%), Gaps = 13/129 (10%)
 Frame = +1

Query  181  IMNRPTRGLSSRTI----CA---VSSVETR---EVEKKGKEKRSAHENLKLKIWLDHQVE  330
            I+N  +  +  +T+    CA    SS +T+   + E+      +  E +++K  L+ +  
Sbjct  49   IVNVSSLSIQRKTVQPIFCAPALQSSTDTQTHTQSEESETTDTNQSEPVRVKFQLNKECT  108

Query  331  YGEHIAIMGSTKELGSWKKN--VMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLW  501
            +G+H  I+G    LGSW  +  V +DW+E   W  E+++  G+P+ +KF++ G  + +LW
Sbjct  109  FGQHFHIVGDDPVLGSWNPSNAVPLDWSEGHAWTVELDIPSGKPISYKFILKGDAETILW  168

Query  502  ETGDNRVLK  528
            + G +R+L+
Sbjct  169  QQGPDRILQ  177



>ref|XP_005849428.1| hypothetical protein CHLNCDRAFT_21770 [Chlorella variabilis]
 gb|EFN57326.1| hypothetical protein CHLNCDRAFT_21770 [Chlorella variabilis]
Length=1182

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 45/133 (34%), Positives = 71/133 (53%), Gaps = 24/133 (18%)
 Frame = +1

Query  190  RPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKE  369
            RP RGL++  +CA                +   +++ ++  +  +V++GE + ++GS   
Sbjct  14   RPARGLAA-PVCA----------------QGGGDDVLVRFSVQREVKFGEAVRLVGSHPS  56

Query  370  LGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIV-GKDK-NLLWETGDNRVLKLP  534
            LG+WK  K   M W E   WV+E+ L  G  +EFK V V G+D  +  WE GDNR L +P
Sbjct  57   LGNWKVRKAPSMGWREGHIWVAEVALPPGTALEFKCVRVKGEDGGDGRWEDGDNRSLVVP  116

Query  535  AGG--SFKMVCQW  567
            AGG  S  ++ +W
Sbjct  117  AGGASSLSVLLEW  129



>ref|WP_033217558.1| cyclomaltodextrin glucanotransferase, partial [Kitasatospora 
phosalacinea]
Length=98

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 46/85 (54%), Gaps = 7/85 (8%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWK--KNVMMDWTEKG----WVSEMELKGGEPVEFKFVIVGKDKN  492
            YG+ + + G+  ELG W   K V +  T+ G    W ++++L    PVE+K++I   D  
Sbjct  14   YGQGLYLAGNLAELGGWDPAKAVPLT-TDSGSYPAWTADLQLPSDTPVEYKYLIKDPDGT  72

Query  493  LLWETGDNRVLKLPAGGSFKMVCQW  567
            ++WE GDNR    PA G+F     W
Sbjct  73   VVWEDGDNRTALTPATGTFTADDTW  97



>gb|KIY94688.1| hypothetical protein MNEG_13275 [Monoraphidium neglectum]
Length=234

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 50/91 (55%), Gaps = 5/91 (5%)
 Frame = +1

Query  274  KRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKG  444
            KRS    + ++ WL  +VEYG+ + + G +K LG+W   K   M W+E   W   ++L  
Sbjct  95   KRSDSGRVNVRFWLKFRVEYGQSLRVTGGSKVLGAWDLAKAPRMVWSEGDLWNVTLDLDA  154

Query  445  GEPVEFKFVIVGKDKN--LLWETGDNRVLKL  531
            G   E+K+V+VG D      W+TG N V+ L
Sbjct  155  GMVYEYKYVVVGWDGQTAAAWQTGGNGVIAL  185



>ref|XP_005849860.1| hypothetical protein CHLNCDRAFT_57278 [Chlorella variabilis]
 gb|EFN57758.1| hypothetical protein CHLNCDRAFT_57278 [Chlorella variabilis]
Length=967

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/125 (30%), Positives = 62/125 (50%), Gaps = 11/125 (9%)
 Frame = +1

Query  250  EVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE-KGW  420
            E E+    +   H ++  +      V +G+ + ++G   +LG W   K   M+W+E   W
Sbjct  61   EEEQAASARSQGHASVTFRAC--RHVGFGQVLKVVGGPDQLGGWDADKAPAMEWSEGDQW  118

Query  421  VSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLP-----AGGSFKMVCQWNVTDKP  585
            +  +EL  G   EFK V+    ++  WE G NR L++P     + G+F +VC+W  T   
Sbjct  119  LLTLELPEGRH-EFKMVVAQGGRSAQWEGGANRTLQVPGPQAASRGAFTVVCEWGNTAAS  177

Query  586  LELLP  600
            LE +P
Sbjct  178  LETVP  182



>ref|XP_002956065.1| hypothetical protein VOLCADRAFT_97031 [Volvox carteri f. nagariensis]
 gb|EFJ42805.1| hypothetical protein VOLCADRAFT_97031 [Volvox carteri f. nagariensis]
Length=385

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 50/84 (60%), Gaps = 5/84 (6%)
 Frame = +1

Query  295  LKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEFK  465
            +++K  L ++  YG+ + I+GS  +LGSW   K + +DWT+   W++ +EL  G   E+K
Sbjct  28   VQVKFCLKYRTSYGQSVKIIGSHPKLGSWDINKALNLDWTDGDRWIAAVELPAGAVYEYK  87

Query  466  FVIVGKDK--NLLWETGDNRVLKL  531
            +V+V  D    L W+ G N VL L
Sbjct  88   YVLVDHDSRATLAWQGGGNSVLAL  111



>ref|XP_009587696.1| PREDICTED: uncharacterized protein LOC104085387 [Nicotiana tomentosiformis]
Length=440

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = +1

Query  289  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTE-KGWVSEMELKGGEPVE  459
            E +++K  L+ +  +G+H  I+G    LGSW  +  V +DW+E   W  E+++  G+ + 
Sbjct  95   EPVRVKFQLNKECTFGQHFHIVGDDPVLGSWNPSNAVPLDWSEGHAWTVELDIPSGKTIS  154

Query  460  FKFVIVGKDKNLLWETGDNRVLK  528
            +KF++ G  + +LW+ G +R+L+
Sbjct  155  YKFILKGDAETILWQQGPDRILQ  177



>gb|KIZ07546.1| hypothetical protein MNEG_0408 [Monoraphidium neglectum]
Length=538

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 7/109 (6%)
 Frame = +1

Query  292  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM--MDWTEKG-WVSEMELKGG-EPVE  459
            N+ ++  +  ++ +GE +A++G   ELG+W       + W+E   W  E+E+    + +E
Sbjct  176  NVDVRFSVTAELRFGEQVAVVGDAPELGAWSPEAARRLTWSEGHVWTGEVEVAAARKSLE  235

Query  460  FKFVIVGKDKNL-LWETGDNRVLKLPAGGSFKMV--CQWNVTDKPLELL  597
            FKF+++G+      WE G NR   LPA G    V    W  +   LELL
Sbjct  236  FKFIVLGESGAAERWEPGQNRAAPLPAAGHRLAVTAAAWGDSACTLELL  284



>ref|XP_001696825.1| hypothetical protein CHLREDRAFT_150073 [Chlamydomonas reinhardtii]
 gb|EDP00933.1| predicted protein [Chlamydomonas reinhardtii]
Length=323

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = +1

Query  292  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEF  462
            N++++  L ++  YG+ + I+GS  +LG+W  N  +++ WT+   WV+ +EL  G   E+
Sbjct  23   NVQVRFCLKYRTSYGQSVKIIGSHAKLGNWDINKALVLSWTDGDRWVATIELPAGSVYEY  82

Query  463  KFVIVGKD--KNLLWETGDNRVLKL  531
            K+V+V  D    L W+ G N VL +
Sbjct  83   KYVLVDHDGRSALAWQGGSNSVLAI  107



>ref|XP_001697099.1| phosphoglucan water dikinase [Chlamydomonas reinhardtii]
 gb|EDP00354.1| phosphoglucan water dikinase [Chlamydomonas reinhardtii]
Length=978

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 3/71 (4%)
 Frame = +1

Query  322  QVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKN  492
            QV++GE + ++G+   LGSW  KK V + WTE   W +E  +  G  VEFK V +  D  
Sbjct  37   QVDFGESVRLVGNQPFLGSWQPKKAVELRWTEGNIWKTEARVPVGTEVEFKVVKMKPDGE  96

Query  493  LLWETGDNRVL  525
            ++WE GDNR  
Sbjct  97   VIWEDGDNRTF  107



>ref|XP_005642714.1| starch-binding domain-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18170.1| starch-binding domain-like protein [Coccomyxa subellipsoidea 
C-169]
Length=260

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 54/85 (64%), Gaps = 5/85 (6%)
 Frame = +1

Query  295  LKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEME--LKGGEPVE  459
            ++LK+ + +   +G+H+ I+GST+ LG W   + V M+W++   W ++ +  L+ G  +E
Sbjct  55   IRLKLAIPYHCNFGQHLCIVGSTESLGGWNIDQGVPMEWSDGDLWSADFDLPLQLGTELE  114

Query  460  FKFVIVGKDKNLLWETGDNRVLKLP  534
            +K+V+  +D ++ W+ G N  +++P
Sbjct  115  YKYVVRSEDGSVYWKPGCNLCIRIP  139



>ref|WP_030916433.1| hypothetical protein [Streptomyces sp. NRRL S-384]
Length=240

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 42/84 (50%), Gaps = 5/84 (6%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDKNL  495
            YG+++ + G+  ELG W     +  T  G     W + ++L    P+ +K++I   D  +
Sbjct  156  YGQNLYLAGNLSELGGWDPAKAVPLTTDGTSYPVWSAGLQLPPNTPIAYKYLIKNPDGTV  215

Query  496  LWETGDNRVLKLPAGGSFKMVCQW  567
            +WE GDNR    PA G+F     W
Sbjct  216  VWEGGDNRTATTPATGTFTADDTW  239



>ref|XP_004302646.1| PREDICTED: uncharacterized protein LOC101312742 [Fragaria vesca 
subsp. vesca]
Length=500

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 60/110 (55%), Gaps = 5/110 (5%)
 Frame = +1

Query  214  RTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSW--  381
            + +  +SS    E+E    + + ++  + + +K  L  +  +G+   I+G    LGSW  
Sbjct  59   KPLVCLSSKTQAELETPDAQIQDSYPIKTMHVKFQLQKECSFGQQFLIVGDDPILGSWDP  118

Query  382  KKNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
            ++ + MDW++   W  E+++  G+ ++FKF++ G   N LW+ G +R+ +
Sbjct  119  ERAIPMDWSDGNVWSVELDIPVGKSIQFKFILTGDAGNFLWQPGPDRIFQ  168



>gb|ABK25218.1| unknown [Picea sitchensis]
Length=307

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +1

Query  295  LKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEFK  465
            + +K  L+ + ++G+   ++G   + GSW  K  V ++W+E   W  E+++  G+ +E+K
Sbjct  110  VTVKFVLEKKCKFGQQFHVVGDAPQFGSWNPKAAVPLEWSEGDMWTKEVDVPVGKQIEYK  169

Query  466  FVIVGKDKNLLWETGDNRVLK  528
            F+++GK   LLW+ G NR  +
Sbjct  170  FILIGKRGELLWQPGPNRAFE  190



>ref|WP_033216324.1| hypothetical protein [Kitasatospora phosalacinea]
Length=239

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (49%), Gaps = 5/86 (6%)
 Frame = +1

Query  325  VEYGEHIAIMGSTKELGSWKKNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDK  489
              YG+++ + G+  ELG W     +  +  G     W + ++L    P+E+K++I   D 
Sbjct  153  TAYGQNLYLAGNLAELGGWDPAKAVPLSTDGAHYPLWTAGLQLPPNTPIEYKYLIKNPDG  212

Query  490  NLLWETGDNRVLKLPAGGSFKMVCQW  567
             ++WE G NR    PA G+F     W
Sbjct  213  TVVWENGGNRTAVTPATGTFTTNDTW  238



>emb|CBI30404.3| unnamed protein product [Vitis vinifera]
Length=382

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/150 (25%), Positives = 77/150 (51%), Gaps = 13/150 (9%)
 Frame = +1

Query  178  SIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMG  357
            S+ ++P   +SS +    + +ET E +    +K+S    + +++ L  +  YGE   I+G
Sbjct  47   SVQHKPIHPISSSSPEPQAELETAETKI---QKKSRSNTVHVRLQLQKRCSYGEQFLIVG  103

Query  358  STKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
                 G W  +  V + W++   W +E+++  G+ ++FKF++ G    +LW+ G +R+L+
Sbjct  104  DDPMFGLWDPSSAVPLCWSDGHVWTAELDIPIGKLIQFKFILKGITGTILWQPGPDRILR  163

Query  529  LPAG-GSFKMVCQWN------VTDKPLELL  597
              A   +  +V  W       +T+ P+ +L
Sbjct  164  TWATENTITVVEDWEDAELQKITEGPVSIL  193



>ref|WP_030918859.1| cyclomaltodextrin glucanotransferase, partial [Streptomyces sp. 
NRRL S-384]
Length=98

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 5/68 (7%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDKNL  495
            YG+++ + G   ELG W     +  T  G     W + ++L  G P+ +K++I   D  +
Sbjct  14   YGQNLYLSGDIAELGGWDPAKAVPLTTDGTSYPVWTANLQLPAGTPIAYKYLIKNPDGTV  73

Query  496  LWETGDNR  519
            +WE+GDNR
Sbjct  74   IWESGDNR  81



>ref|XP_002974170.1| hypothetical protein SELMODRAFT_414445 [Selaginella moellendorffii]
 gb|EFJ25125.1| hypothetical protein SELMODRAFT_414445 [Selaginella moellendorffii]
Length=371

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 50/93 (54%), Gaps = 4/93 (4%)
 Frame = +1

Query  313  LDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGK  483
            L  + +YGE  A++G++  LG+W     V MDW+E   W  +++L  GE  E+KFV+  K
Sbjct  91   LQKKCDYGERFAVVGASPLLGAWDPAAGVSMDWSEDHVWKCQIDLPVGEQYEYKFVLTSK  150

Query  484  DKNLLWETGDNRVLKLPAGGSFKMVCQ-WNVTD  579
                 W+ G NR+ K     S  +V + W  T+
Sbjct  151  KAVPEWQPGPNRIFKTDDAESPLIVSESWESTE  183



>ref|XP_010654173.1| PREDICTED: uncharacterized protein LOC104880162 [Vitis vinifera]
Length=455

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/150 (25%), Positives = 77/150 (51%), Gaps = 13/150 (9%)
 Frame = +1

Query  178  SIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMG  357
            S+ ++P   +SS +    + +ET E +    +K+S    + +++ L  +  YGE   I+G
Sbjct  48   SVQHKPIHPISSSSPEPQAELETAETKI---QKKSRSNTVHVRLQLQKRCSYGEQFLIVG  104

Query  358  STKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
                 G W  +  V + W++   W +E+++  G+ ++FKF++ G    +LW+ G +R+L+
Sbjct  105  DDPMFGLWDPSSAVPLCWSDGHVWTAELDIPIGKLIQFKFILKGITGTILWQPGPDRILR  164

Query  529  LPAG-GSFKMVCQWN------VTDKPLELL  597
              A   +  +V  W       +T+ P+ +L
Sbjct  165  TWATENTITVVEDWEDAELQKITEGPVSIL  194



>ref|XP_001258586.1| starch binding domain protein [Neosartorya fischeri NRRL 181]
 gb|EAW16689.1| starch binding domain protein [Neosartorya fischeri NRRL 181]
Length=497

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 7/79 (9%)
 Frame = +1

Query  325  VEYGEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGK  483
              YGE+I I GS  +LG+W  +  +  +  G       W  +++L  G   ++KF+  G+
Sbjct  406  TSYGENIFISGSIDQLGNWDTSRAVALSASGYTSSNPVWSVKLDLYAGTYFQYKFIRKGQ  465

Query  484  DKNLLWETGDNRVLKLPAG  540
            D +++WE+G NR   LP+G
Sbjct  466  DGSVIWESGPNRSYTLPSG  484



>ref|XP_005844815.1| hypothetical protein CHLNCDRAFT_54374 [Chlorella variabilis]
 gb|EFN52713.1| hypothetical protein CHLNCDRAFT_54374 [Chlorella variabilis]
Length=687

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 43/73 (59%), Gaps = 4/73 (5%)
 Frame = +1

Query  316  DHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKD  486
            D  +++GEH+ ++GS  E+G W  K    +DW E   WV+E+ L  GE + FK VI+  D
Sbjct  86   DCPLQFGEHLRLVGSCAEMGGWDAKSAPSLDWQEGNNWVAELALPPGEHL-FKLVIMRSD  144

Query  487  KNLLWETGDNRVL  525
                WE G+NR L
Sbjct  145  GEQQWEDGNNREL  157



>gb|KIZ03831.1| hypothetical protein MNEG_4121, partial [Monoraphidium neglectum]
Length=325

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 57/137 (42%), Gaps = 9/137 (7%)
 Frame = +1

Query  160  PQGIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGE  339
            P   P     R  R  S+R+  AV    T   +  G+    A    + +I     V +GE
Sbjct  23   PAAAPVCAAGRAPR--STRSGLAVVRFATDSAD--GEVDVDAAATARFRI--TTPVRFGE  76

Query  340  HIAIMGSTKELGSWKKNVMM--DWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETG  510
            H+ ++G    LGSW  +  +   W+E   W    +L  G+ +EFKF+I        WE G
Sbjct  77   HVRVVGGAPSLGSWSPDAALKLTWSEGDKWEGAAQLPAGQDIEFKFLICPAAGAPAWEPG  136

Query  511  DNRVLKLPAGGSFKMVC  561
             N    LP G    +V 
Sbjct  137  ANHKAALPEGAEAVIVA  153



>ref|XP_004506775.1| PREDICTED: protein ycf2-like isoform X1 [Cicer arietinum]
Length=472

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/113 (25%), Positives = 62/113 (55%), Gaps = 3/113 (3%)
 Frame = +1

Query  235  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  408
             +ET E   +  E+ +    ++++  L    ++GE   I+G    LGSW   + + M W+
Sbjct  74   DLETVEPRVQQSEQTNESNFVRVEFQLQKDCDFGEQFLIVGDDPMLGSWNPLEALPMTWS  133

Query  409  EKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  564
            +   W  E+++  G+PV++KF++ G + +++W+ G +R++      +  +VC+
Sbjct  134  DGHLWTLELDIPAGKPVQYKFILKGIEGDIIWQPGLDRIIHTWETMNRIIVCE  186



>ref|XP_002968806.1| hypothetical protein SELMODRAFT_440606 [Selaginella moellendorffii]
 gb|EFJ29922.1| hypothetical protein SELMODRAFT_440606 [Selaginella moellendorffii]
Length=392

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +1

Query  313  LDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGK  483
            L  + +YGE  A++G++  LG+W     V MDW+E   W  +++L  GE  E+KFV+  K
Sbjct  91   LQKKCDYGERFAVVGASPLLGAWDPAAGVSMDWSEDHVWKCQIDLPVGEQYEYKFVLTSK  150

Query  484  DKNLLWETGDNRVLK  528
                 W+ G NR+ K
Sbjct  151  KAVPEWQPGPNRIFK  165



>emb|CAN60108.1| hypothetical protein VITISV_044328 [Vitis vinifera]
Length=430

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 76/150 (51%), Gaps = 13/150 (9%)
 Frame = +1

Query  178  SIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMG  357
            S+ ++P   +SS +    + +ET E + +   K+S    + +++ L  +  YGE   I+G
Sbjct  23   SVQHKPIHPISSSSPEPQAELETAETKIQ---KKSRSNTVHVRLQLQKRCSYGEQFLIVG  79

Query  358  STKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
                 G W  +  V + W++   W +E+++  G+ ++FKF++ G    +LW+ G +R+L+
Sbjct  80   DDPMFGLWDPSSAVPLCWSDGHVWTAELDIPIGKLIQFKFILKGJTGTILWQPGPDRILR  139

Query  529  L-PAGGSFKMVCQWN------VTDKPLELL  597
                  +  +V  W       +T+ P+ +L
Sbjct  140  TWATENTITVVEDWEDAELQKITEGPVSIL  169



>gb|KJB46631.1| hypothetical protein B456_007G379100 [Gossypium raimondii]
Length=305

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 9/100 (9%)
 Frame = +1

Query  238  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTE  411
            +ET E + K       H   ++K  L  +  +GEH  I+G    LGSW     + + W+E
Sbjct  75   LETAETQPK------EHNTTRVKFQLKKECSFGEHFFIVGDHPMLGSWDPESCIPLTWSE  128

Query  412  -KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
               W  E+++  G  V+FKF++     ++LW+ G +R+ K
Sbjct  129  GHVWAVELDIPVGISVQFKFILKTTTGDILWQPGPDRIFK  168



>ref|XP_005844056.1| hypothetical protein CHLNCDRAFT_139625 [Chlorella variabilis]
 gb|EFN51954.1| hypothetical protein CHLNCDRAFT_139625 [Chlorella variabilis]
Length=246

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = +1

Query  292  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEK-GWVSEMELKGGEPVEF  462
            ++ +   L  +  YG+ + ++GS++ELG+WK    + + W+E+  W + + L  G  VE+
Sbjct  16   SVAVSFILKKETYYGQRVLLVGSSQELGAWKLDAGLPLRWSEEHKWSTTVALPAGAAVEY  75

Query  463  KFVIVGKDKNLLWETGDNRVLKL  531
            KFVI   ++  LWE+  NR L +
Sbjct  76   KFVITDPEQPPLWESCLNRSLAV  98



>ref|XP_001702927.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO96780.1| predicted protein [Chlamydomonas reinhardtii]
Length=141

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 61/127 (48%), Gaps = 13/127 (10%)
 Frame = +1

Query  199  RGLSSRT----ICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTK  366
            R  SSR     +CA + V T  V  +   +   HE   +K  L  +V  GE   I+G   
Sbjct  11   RAASSRRSTVRVCAQAQVAT--VTARPAVRSVEHE---VKFTLKQKVGLGECWKIVGMCP  65

Query  367  ELGSWKKNVM--MDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPA  537
            ELG  K  V   M WT    W  E +++ G   EFK V+   D + LWE G +RVL++P 
Sbjct  66   ELGRMKPEVAPYMQWTNGDVWTLEAKMRPGT-YEFKAVLRKPDGSYLWEDGKDRVLEVPF  124

Query  538  GGSFKMV  558
            G S K V
Sbjct  125  GASGKNV  131



>gb|KJB46630.1| hypothetical protein B456_007G379100 [Gossypium raimondii]
Length=335

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 9/100 (9%)
 Frame = +1

Query  238  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTE  411
            +ET E + K       H   ++K  L  +  +GEH  I+G    LGSW     + + W+E
Sbjct  75   LETAETQPK------EHNTTRVKFQLKKECSFGEHFFIVGDHPMLGSWDPESCIPLTWSE  128

Query  412  -KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
               W  E+++  G  V+FKF++     ++LW+ G +R+ K
Sbjct  129  GHVWAVELDIPVGISVQFKFILKTTTGDILWQPGPDRIFK  168



>ref|XP_002963384.1| hypothetical protein SELMODRAFT_438530 [Selaginella moellendorffii]
 gb|EFJ35255.1| hypothetical protein SELMODRAFT_438530 [Selaginella moellendorffii]
Length=516

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 53/102 (52%), Gaps = 4/102 (4%)
 Frame = +1

Query  298  KLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKF  468
            ++K  L  Q  +GEH  ++G    LG W  +  + ++W++   W +E+++  G   E+KF
Sbjct  192  RVKFVLQRQCMFGEHFKVIGGHPALGEWDPRAAIPLEWSDGHNWTTELDVPQGSVFEYKF  251

Query  469  VIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ-WNVTDKPLE  591
            V+  ++  + W+ G NRV   P      +V Q W+   K +E
Sbjct  252  VLQCQNGWIHWQPGPNRVFSTPEKKPSLVVSQTWDFDAKGME  293



>ref|WP_030499128.1| alpha-amylase [Micromonospora purpureochromogenes]
Length=738

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 3/82 (4%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLW  501
            YG+++ ++G+T  LGSW     +  +      W + ++L     +E+K+V    D  + W
Sbjct  656  YGQNVFVVGNTPALGSWNPAAAVALSSAAYPVWRATVDLPANTAIEYKYVKKNPDGTVTW  715

Query  502  ETGDNRVLKLPAGGSFKMVCQW  567
            E+G NR L  PAGG+  +   W
Sbjct  716  ESGANRTLTTPAGGTRAVTDTW  737



>ref|XP_005847512.1| hypothetical protein CHLNCDRAFT_52636 [Chlorella variabilis]
 gb|EFN55410.1| hypothetical protein CHLNCDRAFT_52636 [Chlorella variabilis]
Length=541

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 4/75 (5%)
 Frame = +1

Query  322  QVEYGEHIAIMGSTKELGSWKKNV--MMDWTEKG-WVSEMELKGGEPVEFKFVIV-GKDK  489
             +++GEH+ ++G+  ELG W       + W E   W  E+ L  G  V FK VIV G   
Sbjct  135  HLQFGEHLRVVGNCPELGEWDAQAAPALIWHEDDVWKGELTLPSGRHVAFKLVIVRGDGV  194

Query  490  NLLWETGDNRVLKLP  534
             L WE G +R L++P
Sbjct  195  TLYWEPGADRRLRVP  209



>ref|XP_002974668.1| hypothetical protein SELMODRAFT_415024 [Selaginella moellendorffii]
 gb|EFJ24188.1| hypothetical protein SELMODRAFT_415024 [Selaginella moellendorffii]
Length=407

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 53/102 (52%), Gaps = 4/102 (4%)
 Frame = +1

Query  298  KLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKF  468
            ++K  L  Q  +GEH  ++G    LG W  +  + ++W++   W +E+++  G   E+KF
Sbjct  135  RVKFVLQRQCMFGEHFKVIGGHPALGEWDPRAAIPLEWSDGHNWTTELDVPQGSVFEYKF  194

Query  469  VIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ-WNVTDKPLE  591
            V+  ++  + W+ G NRV   P      +V Q W+   K +E
Sbjct  195  VLQCQNGWIHWQPGPNRVFSTPEKKPSLVVSQTWDFDAKGME  236



>gb|KHN47425.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=225

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = +1

Query  235  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  408
             +ET E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W+
Sbjct  61   DLETVEPQAQQSEQTNESKFVRVSFQLEKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  120

Query  409  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  121  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  160



>gb|KIY98013.1| hypothetical protein MNEG_9950 [Monoraphidium neglectum]
Length=254

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 6/96 (6%)
 Frame = +1

Query  298  KLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFKF  468
            K+   L   VE+G  +A++GS+  LG W     V ++WTE   W +E E+  G  VE+K+
Sbjct  35   KVSFTLPLHVEFGTEVALVGSSPVLGEWDATSAVPLNWTEGDVWTAEAEVPVGSSVEYKY  94

Query  469  VI-VGKDKNLL-WE-TGDNRVLKLPAGGSFKMVCQW  567
            +I V +D  +L W+ T  N VL +P  G   +   W
Sbjct  95   IIRVPEDGKVLEWQPTPANLVLSIPEAGPVAVTDDW  130



>ref|XP_005644670.1| hypothetical protein COCSUDRAFT_67495 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20126.1| hypothetical protein COCSUDRAFT_67495 [Coccomyxa subellipsoidea 
C-169]
Length=470

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 51/91 (56%), Gaps = 6/91 (7%)
 Frame = +1

Query  313  LDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKFVIVG-  480
            L +   YG+ I ++GS + LGSW  ++   + WTE   W + +EL GG   E+K+V++  
Sbjct  201  LQYHTSYGQQIRLVGSHENLGSWQLREGPDLRWTEGDNWRATVELPGGTVYEYKYVLLDS  260

Query  481  -KDKNLLWETGDNRVLKLPAG-GSFKMVCQW  567
                 L W+ G+N VL + AG  S +++  W
Sbjct  261  YSGHALSWQRGNNSVLAIKAGEESVEVIDNW  291



>ref|XP_006398635.1| hypothetical protein EUTSA_v10013736mg [Eutrema salsugineum]
 gb|ESQ40088.1| hypothetical protein EUTSA_v10013736mg [Eutrema salsugineum]
Length=318

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (52%), Gaps = 5/122 (4%)
 Frame = +1

Query  178  SIMNRPTRGLSSRTICAVSSVETREV-EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIM  354
            S+ +R  + +  R+     S E RE  E +  EK SA + +++   L  +  +GEH  I+
Sbjct  50   SVQSRILKPILLRSSLIKVSQENREAAEIEAVEKSSATKTVRVSFQLRRECVFGEHFFIL  109

Query  355  GSTKELG-SWK-KNVM-MDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRV  522
            G     G  W  +N + + W++   W  +++L  G  VEFKF++  K   +LW+ G NR 
Sbjct  110  GDDPVFGVPWDPENALPLSWSDGHVWTVDLDLPVGRLVEFKFILKAKTGEILWQPGPNRA  169

Query  523  LK  528
            L+
Sbjct  170  LQ  171



>ref|XP_007026748.1| Carbohydrate-binding-like fold, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07250.1| Carbohydrate-binding-like fold, putative isoform 1 [Theobroma 
cacao]
Length=449

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 55/101 (54%), Gaps = 9/101 (9%)
 Frame = +1

Query  250  EVEKKGKEKRSAHEN----LKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE  411
            +V+ +  E + A EN    + +K  L  +  +GEH  I+G    LG W  +  + ++W  
Sbjct  72   QVDFETAETQPAEENPSKTVHVKFQLQKECSFGEHFFIVGDHPMLGIWDPESAIPLNWL-  130

Query  412  KG--WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
            KG  W  E+++  G+ ++FKFV+     NLLW+ G +R+ K
Sbjct  131  KGHVWTVELDIPVGKSIQFKFVLKTSTGNLLWQPGPDRIFK  171



>ref|XP_007026749.1| Carbohydrate-binding-like fold, putative isoform 2 [Theobroma 
cacao]
 gb|EOY07251.1| Carbohydrate-binding-like fold, putative isoform 2 [Theobroma 
cacao]
Length=426

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 51/94 (54%), Gaps = 9/94 (10%)
 Frame = +1

Query  271  EKRSAHEN----LKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG--WVS  426
            E + A EN    + +K  L  +  +GEH  I+G    LG W  +  + ++W  KG  W  
Sbjct  45   ETQPAEENPSKTVHVKFQLQKECSFGEHFFIVGDHPMLGIWDPESAIPLNWL-KGHVWTV  103

Query  427  EMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
            E+++  G+ ++FKFV+     NLLW+ G +R+ K
Sbjct  104  ELDIPVGKSIQFKFVLKTSTGNLLWQPGPDRIFK  137



>dbj|GAM27795.1| hypothetical protein SAMD00019534_109710, partial [Acytostelium 
subglobosum LB1]
Length=128

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 50/90 (56%), Gaps = 5/90 (6%)
 Frame = +1

Query  298  KLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKF  468
            K++ WL + V++G+ + + G+ ++LG+W  +K   + +++   W  E+ L     +E+K+
Sbjct  32   KIRFWLKYHVQFGQQVRVTGNCEQLGNWDPQKAFPLKFSQGDTWEGELLLGQAGRIEYKY  91

Query  469  VIVGKDKN--LLWETGDNRVLKLPAGGSFK  552
             I   D    L WETG NRV  +    +++
Sbjct  92   FISYYDTGDLLYWETGSNRVFLVAGSSNYR  121



>gb|KJB46629.1| hypothetical protein B456_007G379100 [Gossypium raimondii]
Length=276

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 52/104 (50%), Gaps = 9/104 (9%)
 Frame = +1

Query  226  AVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMM  399
            A   +ET E + K       H   ++K  L  +  +GEH  I+G    LGSW     + +
Sbjct  12   AYGELETAETQPK------EHNTTRVKFQLKKECSFGEHFFIVGDHPMLGSWDPESCIPL  65

Query  400  DWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
             W+E   W  E+++  G  V+FKF++     ++LW+ G +R+ K
Sbjct  66   TWSEGHVWAVELDIPVGISVQFKFILKTTTGDILWQPGPDRIFK  109



>ref|XP_001701978.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06953.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=106

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 53/92 (58%), Gaps = 7/92 (8%)
 Frame = +1

Query  292  NLKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEP---  453
            +LKL   + ++V +G+ IA++GS   LG+W  K+++ M WT+   W  E+ +  G     
Sbjct  1    SLKLNFKVGYRVNFGQTIAMIGSGDALGNWDPKRSIAMKWTDGDYWTVELNVAPGRSALD  60

Query  454  VEFKFVIVGKDKNL-LWETGDNRVLKLPAGGS  546
            +E+K+V+V  D ++  W+ G N  + LP   S
Sbjct  61   LEYKYVVVNSDGHIGYWKPGSNYKVTLPLNSS  92



>ref|XP_004506776.1| PREDICTED: protein ycf2-like isoform X2 [Cicer arietinum]
Length=468

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 62/112 (55%), Gaps = 5/112 (4%)
 Frame = +1

Query  238  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  411
            V+   VE + ++  S    ++++  L    ++GE   I+G    LGSW   + + M W++
Sbjct  73   VDLETVEPRVQQNESNF--VRVEFQLQKDCDFGEQFLIVGDDPMLGSWNPLEALPMTWSD  130

Query  412  KG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  564
               W  E+++  G+PV++KF++ G + +++W+ G +R++      +  +VC+
Sbjct  131  GHLWTLELDIPAGKPVQYKFILKGIEGDIIWQPGLDRIIHTWETMNRIIVCE  182



>ref|XP_002502726.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
 gb|ACO63984.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
Length=300

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 49/82 (60%), Gaps = 3/82 (4%)
 Frame = +1

Query  298  KLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFKF  468
            +++  + +Q + GE + I+GS K++G W ++  + M W++ G W +++EL  G  V +K+
Sbjct  113  RVQFRIGYQTQVGEDLFIVGSHKKMGEWNQHHALPMQWSDGGNWFTDLELPAGGVVFYKY  172

Query  469  VIVGKDKNLLWETGDNRVLKLP  534
            V+   +    W+ G N +L LP
Sbjct  173  VVKQANGAYRWQEGANNLLVLP  194



>emb|CAB42581.1| putative degreening-enhanced protein [Auxenochlorella protothecoides]
Length=214

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 56/102 (55%), Gaps = 8/102 (8%)
 Frame = +1

Query  280  SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKK--NVMMDWTEKG-WVSEMELKGGE  450
            +A    K++  L  +V +G+ I+I+ S      W+   ++ MDW+E   W    E+  G+
Sbjct  17   AAAGKAKVQFRLPKRVSFGQTISIVTSRS---GWEPIPDLHMDWSEGDEWKVSAEVAPGD  73

Query  451  PVEFKFVIVGKDKNLLWETGDNRVLK--LPAGGSFKMVCQWN  570
             +E+K+V++G    + W+TG NR L   +P G +  +V +W+
Sbjct  74   ELEYKYVVLGPSGIVEWQTGSNRRLAVDVPGGAAVTVVDEWH  115



>ref|WP_034223083.1| glycosidase [Actinotalea ferrariae]
 gb|EYR64530.1| glycosidase [Actinotalea ferrariae CF5-4]
Length=573

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/137 (23%), Positives = 58/137 (42%), Gaps = 3/137 (2%)
 Frame = +1

Query  166  GIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHI  345
            G  G  +     G  + T+ A + +      K G    +      +   ++    YG+++
Sbjct  435  GCSGRSITVNASGQFTATVNANTPLALHVNAKAGASTTTPTTQTTISFGVNATTVYGQNV  494

Query  346  AIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDN  516
             ++G+   LGSW     +  +      W + +    G  VE+K+V V    N++WE+G N
Sbjct  495  RVVGNHPSLGSWNAAAGVPLSSAAYPVWRAGVAFPAGTRVEYKYVKVDGSGNVVWESGVN  554

Query  517  RVLKLPAGGSFKMVCQW  567
            RV   P+ G+  +   W
Sbjct  555  RVATAPSTGTLTLNDAW  571



>ref|XP_006576534.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Glycine max]
 ref|XP_006607034.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Glycine max]
Length=221

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +1

Query  235  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  408
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  409  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>ref|XP_006576539.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X4 [Glycine max]
Length=221

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +1

Query  235  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  408
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  409  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>ref|XP_005846256.1| hypothetical protein CHLNCDRAFT_135558 [Chlorella variabilis]
 gb|EFN54154.1| hypothetical protein CHLNCDRAFT_135558 [Chlorella variabilis]
Length=368

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 62/109 (57%), Gaps = 7/109 (6%)
 Frame = +1

Query  292  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-WVSEMEL--KGGEPV  456
            ++ ++  L +  +YG+ + ++GS   LG+W   + V M+WTE   W  E+++   G   +
Sbjct  45   SVAVRFQLPYHCKYGQRLCLIGSNDNLGAWNVAQAVPMEWTEGDVWTVELQMPADGSVEL  104

Query  457  EFKFVIVG-KDKNLL-WETGDNRVLKLPAGGSFKMVCQWNVTDKPLELL  597
            E+K+V+   +DK  + W+ G N  L++P  G  ++   W+ + + +E+L
Sbjct  105  EYKYVVRHERDKTAVRWKEGGNFYLQVPPKGELRVRDTWDESMREVEVL  153



>ref|WP_013286849.1| MULTISPECIES: alpha-amylase [Micromonospora]
 gb|ADL47225.1| alpha amylase catalytic region [Micromonospora aurantiaca ATCC 
27029]
 gb|ADU10176.1| alpha amylase catalytic region [Micromonospora sp. L5]
Length=734

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 3/82 (4%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLW  501
            YG+++ ++G+   LG W  +  +  +      W + ++L     VE+K+V    D  ++W
Sbjct  652  YGQNVFVVGNVPALGGWNPSAAVALSPAAYPVWRATVDLPANTAVEYKYVKKNPDGTVIW  711

Query  502  ETGDNRVLKLPAGGSFKMVCQW  567
            E+G NR    PAGG+  +   W
Sbjct  712  ESGANRTFTTPAGGTRAVSDTW  733



>gb|ESL03105.1| alpha amylase, catalytic domain protein [Catonella morbi ATCC 
51271]
Length=715

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 45/82 (55%), Gaps = 4/82 (5%)
 Frame = +1

Query  334  GEHIAIMGSTKELGSWKKNVM----MDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLW  501
            GE I I+G+  ELG W  N+     +      W + +++  G+ +E+K V  G + +++W
Sbjct  633  GESIYIVGNVDELGYWNVNMAAGPALCPNYPTWEAHIDVPVGKNIEWKAVKKGSNSSVVW  692

Query  502  ETGDNRVLKLPAGGSFKMVCQW  567
            ++GDN +  +P  G  + +C W
Sbjct  693  QSGDNNIFTVPKNGVGEAICSW  714



>ref|XP_006398636.1| hypothetical protein EUTSA_v10013736mg [Eutrema salsugineum]
 gb|ESQ40089.1| hypothetical protein EUTSA_v10013736mg [Eutrema salsugineum]
Length=397

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (52%), Gaps = 5/122 (4%)
 Frame = +1

Query  178  SIMNRPTRGLSSRTICAVSSVETREV-EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIM  354
            S+ +R  + +  R+     S E RE  E +  EK SA + +++   L  +  +GEH  I+
Sbjct  50   SVQSRILKPILLRSSLIKVSQENREAAEIEAVEKSSATKTVRVSFQLRRECVFGEHFFIL  109

Query  355  GSTKELG-SWK-KNVM-MDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRV  522
            G     G  W  +N + + W++   W  +++L  G  VEFKF++  K   +LW+ G NR 
Sbjct  110  GDDPVFGVPWDPENALPLSWSDGHVWTVDLDLPVGRLVEFKFILKAKTGEILWQPGPNRA  169

Query  523  LK  528
            L+
Sbjct  170  LQ  171



>ref|XP_003520734.1| PREDICTED: uncharacterized protein LOC100778097 [Glycine max]
Length=464

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = +1

Query  235  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  408
             +ET E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLEKTCNFGEQFLIVGGDPVLGSWDPLEALPMTWS  132

Query  409  EKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  172



>ref|WP_030461968.1| hypothetical protein [Kitasatospora sp. NRRL B-11411]
Length=239

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (49%), Gaps = 5/84 (6%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDKNL  495
            YG+++ + G   ELG W     +  T        W + ++L    P+ +K+++   D ++
Sbjct  155  YGQNLYLAGDLAELGGWDPAKAVPLTTGSGSYPVWSAGLQLPPNTPIAYKYLLKNPDGSV  214

Query  496  LWETGDNRVLKLPAGGSFKMVCQW  567
            +WE+GDNR    P  G+F     W
Sbjct  215  VWESGDNRTATTPPTGTFTADDTW  238



>gb|ACU23169.1| unknown [Glycine max]
Length=464

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = +1

Query  235  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  408
             +ET E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLEKTCNFGEQFLIVGGDPVLGSWDPLEALPMTWS  132

Query  409  EKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  172



>ref|XP_005644337.1| hypothetical protein COCSUDRAFT_48869 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19793.1| hypothetical protein COCSUDRAFT_48869 [Coccomyxa subellipsoidea 
C-169]
Length=1081

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 61/121 (50%), Gaps = 5/121 (4%)
 Frame = +1

Query  256  EKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM--MDWTE-KGWVS  426
            +++G  K  A     ++I   H+V +GE +  +G+ ++LG+W       + W E   W  
Sbjct  73   QRRGALKCEAASGSTVRITTQHEVAFGEVVKAVGTQEQLGAWDPAAAPGLTWAEGNKWSV  132

Query  427  EMELKGGEPVEFKFVIVGKDKNLL-WETGDNRVLKLPAGGSFKMVCQWNVTDKPLELLPL  603
            ++ L   +  EFK V+V +D +   WE G NR +K+   G  K+V +   +D    +L +
Sbjct  133  DLALP-PDTYEFKLVVVREDGSAAEWEPGTNREIKVEEAGDEKIVAECAWSDTATTVLSI  191

Query  604  D  606
            D
Sbjct  192  D  192



>gb|KHG02392.1| Phosphoglucan, water dikinase, chloroplastic -like protein [Gossypium 
arboreum]
Length=451

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 58/116 (50%), Gaps = 6/116 (5%)
 Frame = +1

Query  232  SSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDW  405
            S VE   VE +  EK    + + ++  L+ +  +GEH  I+G    LG W  +  V + W
Sbjct  69   SQVELETVETQ-PEKEIPSKTVNVRFQLEKECSFGEHFFIVGDHPMLGLWDPDNAVPLTW  127

Query  406  TE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL--KLPAGGSFKMVCQ  564
            +E   W  E+++  G  ++FKF++     NLLW+   +R+   +     S  +VC+
Sbjct  128  SEGHVWTVELDVPVGVSIQFKFILKTSTGNLLWQPDPDRIFESRETETNSTTVVCE  183



>ref|XP_006576535.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X3 [Glycine max]
 ref|XP_006607035.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Glycine max]
Length=217

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +1

Query  235  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  408
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  409  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>ref|WP_029664274.1| glycosidase [Cellulomonas sp. KRMCY2]
Length=571

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (48%), Gaps = 3/88 (3%)
 Frame = +1

Query  313  LDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGK  483
            +D    +G+ + ++GS   LGSW     +  +  G   W   + L  G  V +K+V V  
Sbjct  482  VDAGTTWGQSVRVVGSVAALGSWSPAAGVPLSAAGYPVWRGSVNLPAGSTVAYKYVKVDA  541

Query  484  DKNLLWETGDNRVLKLPAGGSFKMVCQW  567
              N++WE+G +R + +P  G   +   W
Sbjct  542  AGNVVWESGSDRTVTVPVSGVLTLDDTW  569



>gb|KHN46339.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=451

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +1

Query  238  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  411
            +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGDPVLGSWDPLEALPMTWSE  133

Query  412  -KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  172



>gb|KHN36405.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=210

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +1

Query  235  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  408
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  409  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>ref|WP_026447047.1| hypothetical protein [Acidobacteriaceae bacterium URHE0068]
Length=708

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 25/84 (30%), Positives = 41/84 (49%), Gaps = 6/84 (7%)
 Frame = +1

Query  334  GEHIAIMGSTKELGSWKKNV------MMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  495
            G++I + GST ELG+W          M+      W   + L  G+ V+FKF+ +  + N+
Sbjct  623  GDYIFVTGSTVELGNWATTFQTAVGPMLAPDYPNWFLNVALPAGQAVQFKFIDIQSNGNV  682

Query  496  LWETGDNRVLKLPAGGSFKMVCQW  567
            +WE G N    +P  G+  +   W
Sbjct  683  VWENGPNHSYIVPTSGTGSVNVNW  706



>gb|KHN48367.1| Alpha-amylase [Glycine soja]
Length=392

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +1

Query  238  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  411
            ++T E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W E
Sbjct  74   LDTAEPQAQQSEQTNESKFVRVSFQLEKNCNFGEQFLIVGDDPVLGSWDPLEALPMTWFE  133

Query  412  -KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
               W  E+++  G+  +FKF++ GK  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGKSFQFKFILKGKGGDIIWQPGLDRMI  172



>ref|XP_006576537.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X2 [Glycine max]
Length=291

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +1

Query  235  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  408
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  409  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>gb|KHN45754.1| Phosphoglucan, water dikinase, chloroplastic [Glycine soja]
Length=523

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = +1

Query  238  VETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE  411
            +ET E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W+E
Sbjct  74   LETVEPQAQQSEQTNESKFVRVSFQLEKSCNFGEQFLIVGGDPVLGSWDPLEALPMTWSE  133

Query  412  -KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
               W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  134  GHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGSDRLI  172



>gb|EHK25059.1| glycoside hydrolase family 15 protein [Trichoderma virens Gv29-8]
Length=631

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/77 (30%), Positives = 40/77 (52%), Gaps = 7/77 (9%)
 Frame = +1

Query  328  EYGEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGKD  486
            ++G+ I ++GS  ELG+W  N  +             W+  + L  GE V++K++ VG D
Sbjct  540  QFGQTIKVVGSVPELGNWSTNAAVALNAVNYASNHPLWLGSINLAAGEVVQYKYINVGSD  599

Query  487  KNLLWETGDNRVLKLPA  537
             ++ WE+  N    +PA
Sbjct  600  GSVTWESDPNHTYTVPA  616



>ref|XP_004183886.1| hypothetical protein EIN_170650 [Entamoeba invadens IP1]
 gb|ELP84540.1| hypothetical protein EIN_170650 [Entamoeba invadens IP1]
Length=131

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = +1

Query  298  KLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTE-KGWVSEMELKGGEPVEFKFVI  474
            K +  ++++   G  +A++GS KELG W+  ++M WT    W  E+E+    P E+K+ I
Sbjct  3    KFQFNINYKTTLGCKVAVVGSCKELGEWQHGILMTWTSGNNWRCEVEIT-NVPFEYKYQI  61

Query  475  VGKDKNL-LWETGDNRVLK  528
              +  N+ +WE   NR+++
Sbjct  62   TDERGNVFVWEATQNRLVQ  80



>ref|WP_007544893.1| cyclomaltodextrin glucanotransferase [Haloferax larsenii]
 gb|ELZ74804.1| cyclomaltodextrin glucanotransferase [Haloferax larsenii JCM 
13917]
Length=713

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/93 (27%), Positives = 44/93 (47%), Gaps = 11/93 (12%)
 Frame = +1

Query  316  DHQVEYGEHIAIMGSTKELGSWKKN---------VMMDWTEKGWVSEMELKGGEPVEFKF  468
            D   + GE++ ++G+  ELG+W  +         V+ ++    W  ++ L  G  +EFKF
Sbjct  622  DATTDMGENVYVVGNVHELGNWDTDRAVGPFFNQVVHEYPN--WYYDVNLPAGTDIEFKF  679

Query  469  VIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  567
            V +  D  + WE+G NR    P   + +    W
Sbjct  680  VKIADDGTVTWESGSNRTYTTPTDSTGEYTGTW  712



>ref|XP_004538448.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Maylandia 
zebra]
 ref|XP_004538449.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Maylandia 
zebra]
Length=835

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 54/99 (55%), Gaps = 7/99 (7%)
 Frame = +1

Query  280  SAHENLKLKIWLDHQVEYGEH--IAIMGSTKELGSWKKNVMMDWTEKG-WVSEMELKGGE  450
            S + N+  +I   H + +  H  +AI GS +ELG+WKK ++++  E G W + + L    
Sbjct  737  SQNVNVTFRI---HYLTHSPHQKVAITGSQQELGNWKKFILLERAEDGNWATVVSLPAES  793

Query  451  PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  567
             VE+KFV++ K +   WE   NR+L    G    +V +W
Sbjct  794  IVEWKFVVMDKGEVCRWEECGNRLLDTGYGDDL-LVHKW  831



>gb|EQB53702.1| glycosyl hydrolase family 15 [Colletotrichum gloeosporioides 
Cg-14]
Length=437

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/78 (26%), Positives = 41/78 (53%), Gaps = 7/78 (9%)
 Frame = +1

Query  325  VEYGEHIAIMGSTKELGSWKKNVMMDWTEKGWVSE-------MELKGGEPVEFKFVIVGK  483
             ++G+ I I+G+T +LG+W     +  +  G+ S        +EL+ G+ +++K++ V  
Sbjct  348  TQFGQTIKIVGNTAQLGNWSPGSAISLSASGYTSANPVWSVTIELQAGQAIQYKYINVAS  407

Query  484  DKNLLWETGDNRVLKLPA  537
            D  + WE   N    +P+
Sbjct  408  DGTVTWEADPNHTYTVPS  425



>ref|WP_022874232.1| glycosidase [Arthrobacter sp. PAO19]
Length=572

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 47/96 (49%), Gaps = 3/96 (3%)
 Frame = +1

Query  289  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSW---KKNVMMDWTEKGWVSEMELKGGEPVE  459
            +   +++ +  Q   G++I I+G+  ELGSW   K   +   +   W   ++L  G   E
Sbjct  475  DTADVRVAVTAQTVMGQNIRIVGNQPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFE  534

Query  460  FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  567
            +K+V   +  N  WE+G NR+  + A GS  +   W
Sbjct  535  YKYVKYDQSGNATWESGANRIATVNADGSLNLNDSW  570



>ref|XP_004246332.1| PREDICTED: uncharacterized protein LOC101251213 [Solanum lycopersicum]
Length=423

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/105 (24%), Positives = 58/105 (55%), Gaps = 3/105 (3%)
 Frame = +1

Query  223  CAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VM  396
            CA  +    + E+      + ++ +++K  L+ +  +G+H  ++G    LG W  +  V 
Sbjct  60   CASDTQIHNQSEETETTDTNQYKPVRVKFQLNKECSFGQHFYLVGDDPMLGLWDPSNAVP  119

Query  397  MDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
            ++W+E   W  E+++  G+ + +KF++   D+ +LW+ G +R+L+
Sbjct  120  LEWSEGHVWNVELDIPSGKTISYKFIMTVDDETILWQQGPDRILQ  164



>ref|WP_034837471.1| alpha-amylase [[Clostridium] cellulosi]
Length=704

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 44/89 (49%), Gaps = 9/89 (10%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWK---------KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGK  483
            YG ++ ++GS +ELG+W           N     T   W  ++ +  G  +E+KF+    
Sbjct  615  YGTNVYLVGSVEELGNWNTDKAIGPMFNNTSTIGTYPTWFYDVNVPAGTTIEYKFIKKDS  674

Query  484  DKNLLWETGDNRVLKLPAGGSFKMVCQWN  570
              N++WE+G+N  +  P+ G+  +   W+
Sbjct  675  SGNVVWESGNNHKVVTPSSGTATVTVDWS  703



>emb|CDZ24376.1| Cyclomaltodextrin glucanotransferase [ [[Clostridium] cellulosi]
Length=733

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 44/89 (49%), Gaps = 9/89 (10%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWK---------KNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGK  483
            YG ++ ++GS +ELG+W           N     T   W  ++ +  G  +E+KF+    
Sbjct  644  YGTNVYLVGSAEELGNWNTDKAIGPMFNNTSTIGTYPTWFYDVNVPAGTTIEYKFIKKDS  703

Query  484  DKNLLWETGDNRVLKLPAGGSFKMVCQWN  570
              N++WE+G+N  +  P+ G+  +   W+
Sbjct  704  SGNVVWESGNNHKVVTPSSGTATVTVDWS  732



>ref|XP_010543884.1| PREDICTED: uncharacterized protein LOC104816652 [Tarenaya hassleriana]
Length=401

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 47/87 (54%), Gaps = 4/87 (5%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLW  501
            +GEH  I+G     G W  +  + ++W++   W  +++L  G+ +EFKF++ GK   +LW
Sbjct  83   FGEHFFILGDDPVFGLWDPENAIPLNWSDGHVWTVDLDLPVGKSIEFKFILKGKTGIILW  142

Query  502  ETGDNRVLKLPAGGSFKMVCQ-WNVTD  579
            + G NRV +     +   +C+ W   D
Sbjct  143  QPGQNRVFETLETSNTITICEDWENAD  169



>ref|XP_007205350.1| hypothetical protein PRUPE_ppa007150mg [Prunus persica]
 gb|EMJ06549.1| hypothetical protein PRUPE_ppa007150mg [Prunus persica]
Length=380

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 6/120 (5%)
 Frame = +1

Query  220  ICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN-  390
            IC  S  +T E+E    + +  H  + + +K  L  +  +G+   I+G     G W  + 
Sbjct  63   ICLSSKTQT-ELEVTDDQIQETHHTKTIHVKFQLQKECSFGQQFLIVGDDPMFGLWDPSS  121

Query  391  -VMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  564
             + M+W++   W  E+++  G+ V+FKF++     N+LW+ G +R+ +     +   VC+
Sbjct  122  AIPMNWSDGNVWTVELDIPVGKSVQFKFILKEITGNILWQPGPDRIFQTWETKNTITVCE  181



>gb|EMD46465.1| starch binding domain containing protein [Entamoeba histolytica 
KU27]
 gb|EMH75373.1| starch binding domain containing protein [Entamoeba histolytica 
HM-1:IMSS-B]
 gb|EMS17073.1| starch binding domain containing protein [Entamoeba histolytica 
HM-3:IMSS]
 gb|ENY62571.1| starch binding domain containing protein [Entamoeba histolytica 
HM-1:IMSS-A]
Length=112

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 3/73 (4%)
 Frame = +1

Query  313  LDHQVEYGEHIAIMGSTKELGSWKKNVMMDWT-EKGWVSEMELKGGEPVEFKFVIVGKD-  486
            ++++   G  +A++GS KELG W+    MDWT    W  E+++K   P E+K+ I+    
Sbjct  8    INYKTTPGNSVAVVGSCKELGEWEHGAKMDWTVSNNWKIELDIK-NMPFEYKYQIIDSTG  66

Query  487  KNLLWETGDNRVL  525
            + L+WE   NR+ 
Sbjct  67   RVLIWEATQNRMF  79



>ref|WP_008323077.1| cyclomaltodextrin glucanotransferase [Haloferax elongans]
 gb|ELZ87682.1| cyclomaltodextrin glucanotransferase [Haloferax elongans ATCC 
BAA-1513]
Length=713

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/93 (27%), Positives = 44/93 (47%), Gaps = 11/93 (12%)
 Frame = +1

Query  316  DHQVEYGEHIAIMGSTKELGSWKKN---------VMMDWTEKGWVSEMELKGGEPVEFKF  468
            D   + GE++ ++G+  ELG+W  +         V+ ++    W  ++ L  G  +EFKF
Sbjct  622  DATTDMGENVYVVGNVHELGNWDPDRAVGPFFNQVVHEYPN--WYYDVNLPAGADIEFKF  679

Query  469  VIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  567
            V +  D  + WE+G NR    P   + +    W
Sbjct  680  VKIADDGTVTWESGSNRTYTTPTDSTGEYTGTW  712



>ref|XP_652601.2| hypothetical protein [Entamoeba histolytica HM-1:IMSS]
 gb|EAL47215.2| hypothetical protein EHI_132040 [Entamoeba histolytica HM-1:IMSS]
Length=108

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 3/73 (4%)
 Frame = +1

Query  313  LDHQVEYGEHIAIMGSTKELGSWKKNVMMDWT-EKGWVSEMELKGGEPVEFKFVIVGKD-  486
            ++++   G  +A++GS KELG W+    MDWT    W  E+++K   P E+K+ I+    
Sbjct  4    INYKTTPGNSVAVVGSCKELGEWEHGAKMDWTVSNNWKIELDIK-NMPFEYKYQIIDSTG  62

Query  487  KNLLWETGDNRVL  525
            + L+WE   NR+ 
Sbjct  63   RVLIWEATQNRMF  75



>ref|XP_003516949.1| PREDICTED: ribonuclease E/G-like protein, chloroplastic-like 
[Glycine max]
Length=462

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +1

Query  235  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  408
             ++T E + +  E+ +  + +++   L+    +GE   I+G    LGSW   + + M W 
Sbjct  73   DLDTAEPQAQQSEQTNESKFVRVSFQLEKNCNFGEQFLIVGDDPVLGSWDPLEALPMTWF  132

Query  409  EKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
            E   W  E+++  G+  +FKF++ GK  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGKSFQFKFILKGKGGDIIWQPGLDRMI  172



>ref|XP_006576533.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X1 [Glycine max]
Length=275

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +1

Query  235  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  408
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  409  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPGLDRLI  172



>ref|XP_001768545.1| predicted protein [Physcomitrella patens]
 gb|EDQ66696.1| predicted protein [Physcomitrella patens]
Length=447

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = +1

Query  292  NLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEF  462
             +K+K  L  +  +G+   ++GS  + G+W  +  V ++W+E   W +++++  G+ +E+
Sbjct  102  TVKVKFELQRECHFGQQFKVVGSDPQFGNWDPSAAVPLNWSEGHLWTADLDVPEGKKIEY  161

Query  463  KFVIVG-KDKNLLWETGDNRVLKLPAGG  543
            K+++V  +++ + W+ G N VL+  AG 
Sbjct  162  KYILVSDQEETVEWQPGSNGVLETVAGA  189



>ref|XP_002477993.1| alpha-amylase, putative [Talaromyces stipitatus ATCC 10500]
 gb|EED21030.1| alpha-amylase, putative [Talaromyces stipitatus ATCC 10500]
Length=610

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 7/77 (9%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKN--VMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDK  489
            YG+ + + GS  +LGSW  +  V+M  ++       W   ++L  GE  ++KF+I   D 
Sbjct  520  YGQEVYLSGSISQLGSWSTSSAVLMSASQYTSSNPLWTVTVDLPAGESFQYKFIIKNTDG  579

Query  490  NLLWETGDNRVLKLPAG  540
            ++ WE+  NR   +P G
Sbjct  580  SITWESDPNRSYTVPTG  596



>ref|XP_003051549.1| hypothetical protein NECHADRAFT_92513 [Nectria haematococca mpVI 
77-13-4]
 gb|EEU45836.1| hypothetical protein NECHADRAFT_92513 [Nectria haematococca mpVI 
77-13-4]
Length=582

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 42/78 (54%), Gaps = 7/78 (9%)
 Frame = +1

Query  322  QVEYGEHIAIMGSTKELGSWK--KNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVG  480
            + EYG+ I I+GS   LGSW   K + +  +E       W + + L  G+  E+K++ V 
Sbjct  490  KTEYGDTIKIVGSIAALGSWDTTKAISLSASEYTASNPLWKTTISLTAGQAFEYKYINVK  549

Query  481  KDKNLLWETGDNRVLKLP  534
            KD +L+WE   NR   +P
Sbjct  550  KDGSLVWERDPNRSYTVP  567



>ref|XP_001270539.1| glucan 1,4-alpha-glucosidase, putative [Aspergillus clavatus 
NRRL 1]
 gb|EAW09113.1| glucan 1,4-alpha-glucosidase, putative [Aspergillus clavatus 
NRRL 1]
Length=617

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 8/92 (9%)
 Frame = +1

Query  289  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK-------KNVMMDWTEKGWVSEME-LKG  444
            + + +  WL     +G+++ + G+T  LG+W         + +     + WV+ +E LK 
Sbjct  515  KRVPVTFWLTASTYWGQNVFMTGNTTALGNWNTTAGYALSSALYTEANQLWVASVEELKP  574

Query  445  GEPVEFKFVIVGKDKNLLWETGDNRVLKLPAG  540
            GE +E++F  V  D+++ WE+   RV  +P G
Sbjct  575  GETIEYRFYKVEPDRSITWESTKKRVYTVPTG  606



>ref|XP_003060950.1| carbohydrate-binding module family 20 protein [Micromonas pusilla 
CCMP1545]
 gb|EEH54600.1| carbohydrate-binding module family 20 protein [Micromonas pusilla 
CCMP1545]
Length=451

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 23/102 (23%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWK---------KNVMMDWTEK--GWVSEMELKGGEPVEFKFVIV  477
            +GE + + GS +ELG W          K  + D TE    W   ++++ G   +FKFV+V
Sbjct  329  FGESVRVCGSLRELGEWNAYEAPDMVYKKTVGDPTEGVGTWDVTLQIQQGSEFKFKFVVV  388

Query  478  G----------KDKNLLWETGDNRVLKLPAGGSFKM--VCQW  567
            G          +  N+ W+ GD+R+++LP    F +  V  W
Sbjct  389  GGLDEEERSRGQQPNMYWQEGDDRMVRLPKDNVFSLDIVVDW  430



>ref|WP_038992291.1| glycosidase [Arthrobacter sp. W1]
Length=572

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 47/96 (49%), Gaps = 3/96 (3%)
 Frame = +1

Query  289  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSW---KKNVMMDWTEKGWVSEMELKGGEPVE  459
            +   + + +  Q  +G++I I+G+  ELGSW   K   +   +   W   ++L  G   E
Sbjct  475  DTADVSVEVTAQTVWGQNIRIVGNRPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFE  534

Query  460  FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  567
            +K+V   +  N  WE+G NR+  + A GS  +   W
Sbjct  535  YKYVKYDQSGNATWESGANRIATVNADGSLNLNDSW  570



>ref|XP_006576541.1| PREDICTED: ribonuclease E/G-like protein, chloroplastic-like 
[Glycine max]
Length=527

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 55/100 (55%), Gaps = 3/100 (3%)
 Frame = +1

Query  235  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  408
             +ET E + +  E+ +  + + +   L+    +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVHVSFQLEKSCNFGEQFLIVGGDPVLGSWDPLEALPMTWS  132

Query  409  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
            E   W  E+++  G+  ++KF++ G+  +++W+ G +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILEGEGGDIIWQPGSDRLI  172



>ref|XP_006366357.1| PREDICTED: uncharacterized protein LOC102586811 [Solanum tuberosum]
Length=422

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 57/105 (54%), Gaps = 3/105 (3%)
 Frame = +1

Query  223  CAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VM  396
            CA  S    + E+      +  E +++K  L+ +  +G+H  ++G    LG W  +  V 
Sbjct  60   CASDSQIHTQSEETETTDTNQSEPVRVKFQLNKECSFGQHFYLVGDDPILGLWDPSNAVP  119

Query  397  MDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
            ++W+E   W  E+++  G+ + +KF++   D+ +LW+ G +R+++
Sbjct  120  LEWSEGHLWNVELDIPSGKTISYKFIMTVDDETILWQQGPDRIIQ  164



>ref|XP_008243940.1| PREDICTED: uncharacterized protein LOC103342132 [Prunus mume]
Length=511

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 6/120 (5%)
 Frame = +1

Query  220  ICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN-  390
            IC  S  +T E+E    + +  H  + + +K  L  +  +G+   I+G     G W  + 
Sbjct  60   ICLSSKTQT-ELEVTDDQIQETHHTKTIHVKFQLQKECSFGQQFLIVGDDPMFGLWDPSS  118

Query  391  -VMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ  564
             + M+W++   W  E+++  G+ V+FKF++     N+LW+ G +R+ +     +   VC+
Sbjct  119  AIPMNWSDGNVWTVELDIPVGKSVQFKFILKEITGNILWQPGPDRIFQTWETKNTITVCE  178



>ref|WP_035419445.1| alpha-amylase [Bacillus sp. JCM 19045]
 dbj|GAF13125.1| cyclomaltodextrin glucanotransferase [Bacillus sp. JCM 19045]
 dbj|GAF16307.1| LOW QUALITY PROTEIN: cyclomaltodextrin glucanotransferase [Bacillus 
sp. JCM 19046]
Length=703

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 47/87 (54%), Gaps = 11/87 (13%)
 Frame = +1

Query  334  GEHIAIMGSTKELGSWKKN---------VMMDWTEKGWVSEMELKGGEPVEFKFVIVGKD  486
            G ++ I+G+  ELG+W  N         VM  +    W  ++ +  G+ +E+K++   ++
Sbjct  619  GTNVYIVGNVSELGNWDPNKAIGPMFNQVMYKYPT--WYYDISVPAGKNLEYKYIKKDQN  676

Query  487  KNLLWETGDNRVLKLPAGGSFKMVCQW  567
             N++W++G+NR    PA G+  ++  W
Sbjct  677  GNVIWQSGNNRTYTSPATGTDTVITNW  703



>ref|XP_002502832.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
 gb|ACO64090.1| carbohydrate-binding module family 20 protein [Micromonas sp. 
RCC299]
Length=410

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/109 (26%), Positives = 54/109 (50%), Gaps = 17/109 (16%)
 Frame = +1

Query  295  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKNVM--MDWTEKG--WVSEMELKGGEPVEF  462
            + ++  ++ +  +GE + + G   ELG+W  N    M++ +K   W + + +  G   +F
Sbjct  281  VPVRFGINVKTAFGEGVVVCGDIPELGAWDANAAPKMEYQKKDATWSTTVHIPQGSVFKF  340

Query  463  KFVI----------VGKDKNLLWETGDNRVLKLPAGG---SFKMVCQWN  570
            KFV+           GK +   W+ G++R ++LP  G   S  +VC W+
Sbjct  341  KFVVEGGLSEKEKEQGKQRAHHWQEGNDRKIQLPIEGDALSLDVVCDWD  389



>gb|EAY76546.1| hypothetical protein OsI_04489 [Oryza sativa Indica Group]
Length=387

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 60/134 (45%), Gaps = 18/134 (13%)
 Frame = +1

Query  223  CAVSSVETREVEKKGKEKR-----SAHE---------NLKLKIWLDHQVEYGEHIAIMGS  360
            C   SV+    E+ G  K       AH+          + +K  L  +  +G+   ++G 
Sbjct  92   CVDHSVQVDADEETGSTKTLPPPDDAHDIFYPPVPTKTVHVKFVLQKRCAFGQRFLVVGD  151

Query  361  TKELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKL  531
               LG W   K   +DW+E   W  + EL     +EFKF++  +  ++ W+ G NR+L +
Sbjct  152  VAALGLWNPAKAAALDWSEDHVWTVKKELPAERSIEFKFLLQDRSGHVEWQHGRNRILHV  211

Query  532  PAGGSFKMVCQ-WN  570
                +  +VC+ W+
Sbjct  212  ADTSNTLIVCEDWD  225



>ref|XP_004156602.1| PREDICTED: uncharacterized LOC101213899 [Cucumis sativus]
Length=446

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/114 (22%), Positives = 58/114 (51%), Gaps = 5/114 (4%)
 Frame = +1

Query  202  GLSSRTICAVSSVETREVEKKGKEKRSAHEN--LKLKIWLDHQVEYGEHIAIMGSTKELG  375
            G+   + C  S  +   ++    E +   ++  +++K  L  +  +GEH  ++G     G
Sbjct  62   GIDFISSCFASYQQADTIQNDAVENQETDQSKTVRVKFQLLKECTFGEHFYVVGDDPIFG  121

Query  376  SWK--KNVMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
            SW     + ++W +   W +E+++  G+ ++FKF++ G   N++W+ G +R  +
Sbjct  122  SWDVTSAIPLNWADGHQWAAEVDIPVGKIIQFKFILQGITGNVVWQPGPDRTFQ  175



>gb|EAZ14199.1| hypothetical protein OsJ_04123 [Oryza sativa Japonica Group]
Length=387

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 60/134 (45%), Gaps = 18/134 (13%)
 Frame = +1

Query  223  CAVSSVETREVEKKGKEKR-----SAHE---------NLKLKIWLDHQVEYGEHIAIMGS  360
            C   SV+    E+ G  K       AH+          + +K  L  +  +G+   ++G 
Sbjct  92   CVDHSVQVDADEETGSTKTLPPPDDAHDIFYPPVPTKTVHVKFVLQKRCAFGQRFLVVGD  151

Query  361  TKELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKL  531
               LG W   K   +DW+E   W  + EL     +EFKF++  +  ++ W+ G NR+L +
Sbjct  152  VAALGLWNPAKAAALDWSEDHVWTVKKELPAERSIEFKFLLQDRSGHVEWQHGRNRILHV  211

Query  532  PAGGSFKMVCQ-WN  570
                +  +VC+ W+
Sbjct  212  ADTSNTLIVCEDWD  225



>ref|XP_004137725.1| PREDICTED: uncharacterized protein LOC101213899 [Cucumis sativus]
 gb|KGN58768.1| hypothetical protein Csa_3G731790 [Cucumis sativus]
Length=446

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/114 (22%), Positives = 58/114 (51%), Gaps = 5/114 (4%)
 Frame = +1

Query  202  GLSSRTICAVSSVETREVEKKGKEKRSAHEN--LKLKIWLDHQVEYGEHIAIMGSTKELG  375
            G+   + C  S  +   ++    E +   ++  +++K  L  +  +GEH  ++G     G
Sbjct  62   GIDFISSCFASYQQADTIQNDAVENQETDQSKTVRVKFQLLKECTFGEHFYVVGDDPIFG  121

Query  376  SWK--KNVMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
            SW     + ++W +   W +E+++  G+ ++FKF++ G   N++W+ G +R  +
Sbjct  122  SWDVTSAIPLNWADGHQWAAEVDIPVGKIIQFKFILQGITGNVVWQPGPDRTFQ  175



>ref|WP_030158763.1| hypothetical protein [Glycomyces sp. NRRL B-16210]
Length=610

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/73 (36%), Positives = 35/73 (48%), Gaps = 3/73 (4%)
 Frame = +1

Query  334  GEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLWE  504
            G+ + ++GS  ELGSW        +      W   +EL  G   E+K+V V  D  L WE
Sbjct  525  GQEVHLIGSIGELGSWNAANAPKLSADDYPVWRGTVELPAGTAFEYKYVKVAPDGALEWE  584

Query  505  TGDNRVLKLPAGG  543
            +G NR    PA G
Sbjct  585  SGGNRTFTAPASG  597



>ref|WP_041648945.1| glycosidase [Arthrobacter arilaitensis]
Length=572

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 46/96 (48%), Gaps = 3/96 (3%)
 Frame = +1

Query  289  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSW---KKNVMMDWTEKGWVSEMELKGGEPVE  459
            +   + + +  Q   G++I I+G+  ELGSW   K   +   +   W   ++L  G   E
Sbjct  475  DTADVSVAVTAQTVMGQNIRIVGNQPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFE  534

Query  460  FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  567
            +K+V   +  N  WE+G NR+  + A GS  +   W
Sbjct  535  YKYVKYDQSGNATWESGANRIATVNADGSLNLNDSW  570



>ref|WP_028596875.1| alpha-amylase [Paenibacillus pasadenensis]
Length=760

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 37/79 (47%), Gaps = 4/79 (5%)
 Frame = +1

Query  334  GEHIAIMGSTKELGSW----KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLW  501
            G++I ++GS  ELGSW        MM+     W   + +  G   +FKFV      N++W
Sbjct  677  GQNIHLVGSIAELGSWDAAKSTEAMMNPNYPVWFLPVSVPKGATFQFKFVKKDASGNVVW  736

Query  502  ETGDNRVLKLPAGGSFKMV  558
            E G NR    P  GS   V
Sbjct  737  EGGSNRTFTAPTSGSADTV  755



>gb|EWM63158.1| alpha-amylase [Micromonospora sp. M42]
Length=722

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 3/82 (4%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLW  501
            YG+++ ++G+   LG W     +  +      W + ++L     VE+K+V    D  + W
Sbjct  640  YGQNVFVVGNIPALGGWNPAAAVALSSAAYPVWRATVDLPANTAVEYKYVKKNPDGTVTW  699

Query  502  ETGDNRVLKLPAGGSFKMVCQW  567
            E+G NR L  PAGG+  +   W
Sbjct  700  ESGANRTLTTPAGGTRAVTDTW  721



>ref|WP_043323282.1| alpha-amylase [Micromonospora sp. M42]
Length=736

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 3/82 (4%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLW  501
            YG+++ ++G+   LG W     +  +      W + ++L     VE+K+V    D  + W
Sbjct  654  YGQNVFVVGNIPALGGWNPAAAVALSSAAYPVWRATVDLPANTAVEYKYVKKNPDGTVTW  713

Query  502  ETGDNRVLKLPAGGSFKMVCQW  567
            E+G NR L  PAGG+  +   W
Sbjct  714  ESGANRTLTTPAGGTRAVTDTW  735



>ref|WP_022110961.1| 4-alpha-glucanotransferase [Prevotella sp. CAG:604]
 emb|CDA54651.1| 4-alpha-glucanotransferase [Prevotella sp. CAG:604]
Length=890

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (58%), Gaps = 5/76 (7%)
 Frame = +1

Query  322  QVEYGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELK--GGEPVEFKFVIVGKD  486
            Q+  GE +A++GS   LG+W KN  +   ++    W  ++ ++      +EFKFV + + 
Sbjct  136  QLREGERLAVVGSDPALGAWDKNHALPMVQQAYNEWTVDINVETLAVNYLEFKFVALNEK  195

Query  487  KNLLWETGDNRVLKLP  534
            K  LWETG NR +++P
Sbjct  196  KECLWETGYNRSIEIP  211



>ref|WP_015794440.1| alpha-amylase [Catenulispora acidiphila]
 gb|ACU74711.1| alpha amylase catalytic region [Catenulispora acidiphila DSM 
44928]
Length=742

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/84 (30%), Positives = 38/84 (45%), Gaps = 6/84 (7%)
 Frame = +1

Query  334  GEHIAIMGSTKELGSWKKNV------MMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  495
            G+ I + G+  ELG+W  +       ++D     W S   +  G  V+FKF I   D  +
Sbjct  659  GDEIYLSGNDDELGNWSTDTATAIGPLLDPNYPTWFSLASVPAGATVQFKFFIKHTDGTV  718

Query  496  LWETGDNRVLKLPAGGSFKMVCQW  567
             WE G N    +PA G+  +   W
Sbjct  719  TWEGGSNHTYTVPASGTGTVTVAW  742



>gb|KGO46641.1| Glycoside hydrolase, family 13 [Penicillium expansum]
 gb|KGO53522.1| Glycoside hydrolase, family 13 [Penicillium expansum]
 gb|KGO70887.1| Glycoside hydrolase, family 13 [Penicillium expansum]
Length=392

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 39/81 (48%), Gaps = 7/81 (9%)
 Frame = +1

Query  325  VEYGEHIAIMGSTKELGSWKKNVMM-----DWTEKG--WVSEMELKGGEPVEFKFVIVGK  483
              YG++I + GS  +LGSW  +  +      +T     W + + L  G   E+KF   G 
Sbjct  301  TSYGQNIFVTGSISQLGSWSTSSAIALSAGSYTSSNPLWTASISLPAGTTFEYKFFKKGS  360

Query  484  DKNLLWETGDNRVLKLPAGGS  546
            D ++ WE+  NR   +P G S
Sbjct  361  DGSITWESDPNRSYTVPTGCS  381



>emb|CBT76664.1| glycosyl hydrolase, family 13 [Arthrobacter arilaitensis Re117]
Length=569

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 46/96 (48%), Gaps = 3/96 (3%)
 Frame = +1

Query  289  ENLKLKIWLDHQVEYGEHIAIMGSTKELGSW---KKNVMMDWTEKGWVSEMELKGGEPVE  459
            +   + + +  Q   G++I I+G+  ELGSW   K   +   +   W   ++L  G   E
Sbjct  472  DTADVSVAVTAQTVMGQNIRIVGNQPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFE  531

Query  460  FKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  567
            +K+V   +  N  WE+G NR+  + A GS  +   W
Sbjct  532  YKYVKYDQSGNATWESGANRIATVNADGSLNLNDSW  567



>ref|WP_035849789.1| glycosidase [Kitasatospora azatica]
Length=570

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/88 (24%), Positives = 43/88 (49%), Gaps = 3/88 (3%)
 Frame = +1

Query  313  LDHQVEYGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGK  483
            ++    YG+++ ++G    LG W     +  +  G   W  ++ L  G   ++K+V+   
Sbjct  481  VNATTSYGQNVYLVGDNPALGGWDTGKALPLSSAGYPVWSLDLALPAGTAFQYKYVLKDG  540

Query  484  DKNLLWETGDNRVLKLPAGGSFKMVCQW  567
            +  + WE+G NR   +P+GG  ++   W
Sbjct  541  NGAVTWESGANRTATVPSGGEVQLNDTW  568



>ref|XP_002951018.1| hypothetical protein VOLCADRAFT_91596 [Volvox carteri f. nagariensis]
 gb|EFJ47912.1| hypothetical protein VOLCADRAFT_91596 [Volvox carteri f. nagariensis]
Length=561

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 47/87 (54%), Gaps = 5/87 (6%)
 Frame = +1

Query  268  KEKRSAHEN-LKLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTEKG-WVSEME  435
            K KR AH + + + +       +GE  A++GS  ELGSW   + V M WT    WV+ ++
Sbjct  114  KFKRGAHRSQVPVILKYGKHCNFGEAYAVVGSVSELGSWDPARAVKMRWTPGDVWVAHVQ  173

Query  436  LKGGEPVEFKFVIVGKDKNLL-WETGD  513
            L     V++K+V + KD  L+ WE  D
Sbjct  174  LPVDTEVQYKYVRINKDGALVAWEGAD  200



>ref|XP_002954891.1| hypothetical protein VOLCADRAFT_118865 [Volvox carteri f. nagariensis]
 gb|EFJ44090.1| hypothetical protein VOLCADRAFT_118865 [Volvox carteri f. nagariensis]
Length=1457

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/92 (32%), Positives = 43/92 (47%), Gaps = 9/92 (10%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKFVIVGKDKNLLW  501
            +G+ + ++G  + LG+W  KK V   W E     +E+EL     +  K V+VG     LW
Sbjct  906  HGQQLVLVGGCEALGNWDVKKGVEFSWCEGHSHTAEVELPIHSHIPCKLVVVGHGNQALW  965

Query  502  ETGDNRVLKLPA------GGSFKMVCQWNVTD  579
            E GDNR L L           + ++C W   D
Sbjct  966  EPGDNRELLLAPSSLASRAAGYTVLCHWGYPD  997



>ref|WP_030583847.1| hypothetical protein [Streptomyces sclerotialus]
Length=141

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/77 (26%), Positives = 40/77 (52%), Gaps = 3/77 (4%)
 Frame = +1

Query  328  EYGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLL  498
            ++G+ + + G+  ELGSW  +  +  +      W + + L     VE+K+++   +  ++
Sbjct  57   QWGQQVYVTGNRPELGSWNPDKAVPLSSASYPTWSATVVLPANTGVEYKYIVKAANTPVV  116

Query  499  WETGDNRVLKLPAGGSF  549
            WETG NR    P  G++
Sbjct  117  WETGPNRTTITPPTGTY  133



>ref|XP_002947049.1| hypothetical protein VOLCADRAFT_103274 [Volvox carteri f. nagariensis]
 gb|EFJ51639.1| hypothetical protein VOLCADRAFT_103274 [Volvox carteri f. nagariensis]
Length=774

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 38/143 (27%), Positives = 66/143 (46%), Gaps = 9/143 (6%)
 Frame = +1

Query  166  GIPGSIMNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHI  345
            G  G  +   +RG S R    +     +   + G  +      + +K+   ++V YGE +
Sbjct  9    GRAGEGVTSLSRGRSHREFFMIYRRGGQGAARSGAPQELTASTVTIKV--PYRVNYGEVL  66

Query  346  AIMGSTKELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLL--WETG  510
             ++GS K LG W   + + + WTE   W  ++ +  G   EFK V+  +    +  WE G
Sbjct  67   RVVGSGKVLGDWSADRGLQLIWTEGDVWTVQVPISAGH-YEFKCVVYNQATKSVARWEDG  125

Query  511  DNRVLKLPAG-GSFKMVCQWNVT  576
             NR+L +    G++ + CQW  T
Sbjct  126  GNRILDITRELGTWDVSCQWGAT  148



>dbj|GAM42477.1| alpha-amylase [Talaromyces cellulolyticus]
Length=609

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 39/77 (51%), Gaps = 7/77 (9%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKN--VMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDK  489
            YG+ + + GS  +LGSW  +  V++   +       W   + L  GE  ++KF+IV  D 
Sbjct  520  YGQEVYLTGSISQLGSWSTSSAVLLSAAQYTSSDPLWTVTVNLPAGESFQYKFIIVNSDG  579

Query  490  NLLWETGDNRVLKLPAG  540
             + WE+  NR   +P G
Sbjct  580  TVEWESDPNRSYTVPTG  596



>ref|WP_012749393.1| alpha-amylase [Geobacillus sp. WCH70]
 gb|ACS23592.1| alpha amylase catalytic region [Geobacillus sp. WCH70]
Length=767

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 38/72 (53%), Gaps = 4/72 (6%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKN----VMMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLL  498
            +GE+I ++G+  ELGSW  N     M++     W   + +  G   EFKF+    + N++
Sbjct  680  WGENIYVVGNIPELGSWDPNQSSEAMLNPNYPEWFLPVSVPKGATFEFKFIKKDNNGNVI  739

Query  499  WETGDNRVLKLP  534
            WE+  NRV   P
Sbjct  740  WESRSNRVFTAP  751



>ref|XP_002145753.1| alpha-amylase, putative [Talaromyces marneffei ATCC 18224]
 gb|EEA25206.1| alpha-amylase, putative [Talaromyces marneffei ATCC 18224]
 gb|KFX41751.1| Acid alpha-amylase [Talaromyces marneffei PM1]
Length=608

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/77 (30%), Positives = 41/77 (53%), Gaps = 7/77 (9%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKN--VMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDK  489
            YG+ + ++GS   LGSW  +  V++  ++       W   + L  GE  ++KF++V  D 
Sbjct  519  YGQKVYLVGSISALGSWSASSAVLLSASQYTASDPVWTGTVNLPAGESFQYKFIVVNTDG  578

Query  490  NLLWETGDNRVLKLPAG  540
            ++ WE+  NR   +P G
Sbjct  579  SVKWESDPNRSYTVPTG  595



>ref|WP_029360941.1| glycosidase [Brachybacterium paraconglomeratum]
Length=586

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/93 (28%), Positives = 46/93 (49%), Gaps = 3/93 (3%)
 Frame = +1

Query  298  KLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWTE-KGWVSEMELKGGEPVEFKF  468
            K+ + +     +G+ + I+GS  ELG W+    V +D +    W   ++L  G   E+K+
Sbjct  493  KVSVSVHASTVWGQEVRIVGSVPELGGWQPASGVALDPSGYPSWTGGVDLPAGTSFEYKY  552

Query  469  VIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  567
            V V     ++WE+G NR   + A G+  +   W
Sbjct  553  VKVDGTGAVVWESGANRTATVGADGTLALTDTW  585



>ref|XP_006848182.1| hypothetical protein AMTR_s00029p00236780 [Amborella trichopoda]
 gb|ERN09763.1| hypothetical protein AMTR_s00029p00236780 [Amborella trichopoda]
Length=386

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/118 (25%), Positives = 61/118 (52%), Gaps = 4/118 (3%)
 Frame = +1

Query  184  MNRPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGST  363
            ++R +  +S + +C+  S  + E E        +   + ++  L  +  +G+   I+G  
Sbjct  44   IHRLSIHVSQKLMCSSVSC-SSEPEVNVDPVAPSQSAVHVRFILQKECMFGQQFFIVGEH  102

Query  364  KELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
              LGSW     ++MDW++   W +++E+  G  + +KF++ GK   + W+ G +RV+K
Sbjct  103  PSLGSWDPTAALLMDWSDGHVWTTDLEVPAGTTLLYKFILKGKLGEIEWQPGPDRVVK  160



>ref|WP_013150819.1| alpha-amylase [Thermoanaerobacter mathranii]
 gb|ADH61639.1| alpha amylase catalytic region [Thermoanaerobacter mathranii 
subsp. mathranii str. A3]
Length=757

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/73 (33%), Positives = 40/73 (55%), Gaps = 4/73 (5%)
 Frame = +1

Query  328  EYGEHIAIMGSTKELGSWKKNV----MMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  495
            E+G++I I+G+  ELG+W   +    MM      W   + +  G   EFKF+    + N+
Sbjct  669  EWGQNIHIVGNLPELGNWDPTLSTEAMMCPNYPEWFLPVSVPMGTTFEFKFIKKDSNGNV  728

Query  496  LWETGDNRVLKLP  534
            +WE+G+NR+   P
Sbjct  729  IWESGENRIFTSP  741



>ref|WP_028991976.1| alpha-amylase [Thermoanaerobacter thermocopriae]
Length=757

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/73 (33%), Positives = 40/73 (55%), Gaps = 4/73 (5%)
 Frame = +1

Query  328  EYGEHIAIMGSTKELGSWKKNV----MMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  495
            E+G++I I+G+  ELG+W   +    MM      W   + +  G   EFKF+    + N+
Sbjct  669  EWGQNIHIVGNLPELGNWDPTLSTEAMMCPNYPEWFLPVSVPMGTTFEFKFIKKDSNGNV  728

Query  496  LWETGDNRVLKLP  534
            +WE+G+NR+   P
Sbjct  729  IWESGENRIFTSP  741



>ref|NP_001044849.1| Os01g0856900 [Oryza sativa Japonica Group]
 dbj|BAB63700.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD82315.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06763.1| Os01g0856900 [Oryza sativa Japonica Group]
 dbj|BAG98094.1| unnamed protein product [Oryza sativa Japonica Group]
Length=379

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 10/126 (8%)
 Frame = +1

Query  223  CAVSSVETREVEKKGKEKR------SAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK  384
            C   SV+    E+ G  K          + + +K  L  +  +G+   ++G    LG W 
Sbjct  92   CVDHSVQVDADEETGSTKTLPPPDDVPTKTVHVKFVLQKRCAFGQRFLVVGDVAALGLWN  151

Query  385  --KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKM  555
              K   +DW+E   W  + EL     +EFKF++  +  ++ W+ G NR+L +    +  +
Sbjct  152  PAKAAALDWSEDHVWTVKKELPAERSIEFKFLLQDRSGHVEWQHGRNRILHVADTSNTLI  211

Query  556  VCQ-WN  570
            VC+ W+
Sbjct  212  VCEDWD  217



>ref|XP_002584589.1| glucoamylase [Uncinocarpus reesii 1704]
 gb|EEP80436.1| glucoamylase [Uncinocarpus reesii 1704]
Length=617

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 7/78 (9%)
 Frame = +1

Query  322  QVEYGEHIAIMGSTKELGSWKKN----VMMDWTEKG---WVSEMELKGGEPVEFKFVIVG  480
            + ++GE+I I+GS  ELGSW       +  D  E     W ++++L  G  VE+K++   
Sbjct  525  ETKWGENIFIVGSVAELGSWNPEAATPLRADKYEDSCHMWYAQVDLPAGARVEYKYIRKS  584

Query  481  KDKNLLWETGDNRVLKLP  534
             D  ++WE+  NR  K+P
Sbjct  585  GDGKVVWESDPNRSYKIP  602



>ref|XP_001273135.1| Glycosyl hydrolase, family 15, putative [Aspergillus clavatus 
NRRL 1]
 gb|EAW11709.1| Glycosyl hydrolase, family 15, putative [Aspergillus clavatus 
NRRL 1]
Length=642

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 28/76 (37%), Positives = 41/76 (54%), Gaps = 7/76 (9%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSW--KKNVMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKDK  489
            YGE I I+GS  ELGSW   K V +  T+       W   ++L  G+  E+K++    + 
Sbjct  553  YGETILIVGSIPELGSWDATKAVALSATKYSASNPLWFVTIDLPAGKSFEYKYIRKQTNG  612

Query  490  NLLWETGDNRVLKLPA  537
            N+ WE+  NR  K+PA
Sbjct  613  NVKWESNPNRSYKVPA  628



>ref|XP_002873018.1| glycoside hydrolase starch-binding domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH49277.1| glycoside hydrolase starch-binding domain-containing protein 
[Arabidopsis lyrata subsp. lyrata]
Length=387

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/121 (24%), Positives = 59/121 (49%), Gaps = 5/121 (4%)
 Frame = +1

Query  232  SSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGS-WKKNVMM--D  402
            SS++  +V  +  +  +  + ++++  L  +  +GEH  I+G     G  W     +  +
Sbjct  68   SSIKDSQVNVEASDIEAHRKTVRVRFQLRKECVFGEHFFILGDDPVFGGLWDPETALPLN  127

Query  403  WTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQ-WNVT  576
            W++   W  +++L  G  VEFKF++  +   +LW+ G NR L+         +C+ W+  
Sbjct  128  WSDGNVWTVDLDLPVGRLVEFKFILKAQTGEILWQPGPNRALETWETNKTIRICEDWDNA  187

Query  577  D  579
            D
Sbjct  188  D  188



>ref|XP_006795663.1| PREDICTED: dentin sialophosphoprotein-like [Neolamprologus brichardi]
Length=839

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 4/86 (5%)
 Frame = +1

Query  319  HQVEYGEH--IAIMGSTKELGSWKKNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDK  489
            H + +  H  +AI GS +ELG+WKK ++++  + G W + + L     VE+KFV++ K +
Sbjct  751  HYLTHSPHQKVAITGSQQELGNWKKFILLERAKDGNWATVVSLPAESIVEWKFVVMDKGE  810

Query  490  NLLWETGDNRVLKLPAGGSFKMVCQW  567
               WE   NR+L    G    +V +W
Sbjct  811  VCRWEECGNRLLDTGYGDDL-LVHKW  835



>ref|XP_001209972.1| hypothetical protein ATEG_07286 [Aspergillus terreus NIH2624]
 gb|EAU32670.1| hypothetical protein ATEG_07286 [Aspergillus terreus NIH2624]
Length=400

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (52%), Gaps = 7/79 (9%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGKDK  489
            +GE++ + GS  +LGSW  +  +  +  G       W + ++L  G   E+KF+    D 
Sbjct  311  WGENVFVTGSISQLGSWSTDKAVALSATGYTASNPLWTTTIDLPAGTTFEYKFIKKETDG  370

Query  490  NLLWETGDNRVLKLPAGGS  546
            +++WE+  NR   +P G S
Sbjct  371  SIIWESDPNRSYTVPTGCS  389



>ref|XP_005729253.1| PREDICTED: uncharacterized protein LOC102200471 [Pundamilia nyererei]
Length=829

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 32/99 (32%), Positives = 54/99 (55%), Gaps = 7/99 (7%)
 Frame = +1

Query  280  SAHENLKLKIWLDHQVEYGEH--IAIMGSTKELGSWKKNVMMDWTEKG-WVSEMELKGGE  450
            S + N+  +I   H + +  H  +AI GS +ELG+WKK ++++  + G W + + L    
Sbjct  731  SQNVNVTFRI---HYLTHSPHQKVAITGSQQELGNWKKFILLERAKDGNWATVVSLPAES  787

Query  451  PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  567
             VE+KFV++ K +   WE   NR+L    G    +V +W
Sbjct  788  IVEWKFVVMDKGEVCRWEECGNRLLDTGYGDDL-LVHKW  825



>ref|XP_005943798.1| PREDICTED: dentin sialophosphoprotein-like [Haplochromis burtoni]
Length=832

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 32/99 (32%), Positives = 54/99 (55%), Gaps = 7/99 (7%)
 Frame = +1

Query  280  SAHENLKLKIWLDHQVEYGEH--IAIMGSTKELGSWKKNVMMDWTEKG-WVSEMELKGGE  450
            S + N+  +I   H + +  H  +AI GS +ELG+WKK ++++  + G W + + L    
Sbjct  734  SQNVNVTFRI---HYLTHSPHQKVAITGSQQELGNWKKFILLERAKDGNWATVVSLPAES  790

Query  451  PVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  567
             VE+KFV++ K +   WE   NR+L    G    +V +W
Sbjct  791  IVEWKFVVMDKGEVCRWEECGNRLLDTGYGDDL-LVHKW  828



>ref|WP_019418183.1| hypothetical protein [Anoxybacillus kamchatkensis]
Length=613

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/84 (29%), Positives = 41/84 (49%), Gaps = 3/84 (4%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLW  501
            YG+++ ++G+  ELG+W     +  T      W + + L  G+ +EFKF+      N++W
Sbjct  529  YGQNVYVVGNIPELGNWNIANAIQMTPSSYPTWKTTVSLPQGKAIEFKFIKKDSAGNVIW  588

Query  502  ETGDNRVLKLPAGGSFKMVCQWNV  573
            E   NR   +P   +      WNV
Sbjct  589  ENIANRTYTVPFSSTGSYTANWNV  612



>ref|XP_011399502.1| Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM26564.1| Phosphoglucan, water dikinase, chloroplastic [Auxenochlorella 
protothecoides]
Length=287

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 48/88 (55%), Gaps = 6/88 (7%)
 Frame = +1

Query  322  QVEYGEHIAIMGSTKELGSWK--KNVMMDWTE-KGWVSEMELKGGEPVEFKFVIV--GKD  486
            + ++G+ + I+GS + LG+W+      M WT    WV+E++L  G   E+KFV+V     
Sbjct  35   RTDWGQRLRIVGSQEGLGNWRLADGHNMKWTTGDNWVAEVDLPTGTVYEYKFVVVDHASG  94

Query  487  KNLLWETGDNRVLKL-PAGGSFKMVCQW  567
              L W++G+N VL L P   S  +   W
Sbjct  95   HALAWQSGNNSVLALRPEDRSVDVFDNW  122



>ref|WP_004057795.1| alpha-amylase [Haloferax mediterranei]
 ref|YP_006348249.1| cyclomaltodextrin glucanotransferase [Haloferax mediterranei 
ATCC 33500]
 gb|AFK18262.1| cyclomaltodextrin glucanotransferase [Haloferax mediterranei 
ATCC 33500]
 gb|EMA02465.1| cyclomaltodextrin glucanotransferase [Haloferax mediterranei 
ATCC 33500]
 gb|AHZ22336.1| alpha-amylase [Haloferax mediterranei ATCC 33500]
Length=713

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/93 (27%), Positives = 43/93 (46%), Gaps = 11/93 (12%)
 Frame = +1

Query  316  DHQVEYGEHIAIMGSTKELGSWKKN---------VMMDWTEKGWVSEMELKGGEPVEFKF  468
            D   + GE++ ++G+  ELG W  +         V+ ++    W  ++ L  G  +EFKF
Sbjct  622  DATTDVGENVYVVGNVHELGDWDTDRAVGPFFNQVVHEYPN--WYYDVNLPAGTDIEFKF  679

Query  469  VIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  567
            V +  D  + WE+G NR    P   + +    W
Sbjct  680  VKIASDGTVTWESGSNRQYTTPTDSTGEYSGTW  712



>emb|CAI46245.1| cyclomaltodextrin glucanotransferase precursor [Haloferax mediterranei]
Length=713

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/93 (27%), Positives = 43/93 (46%), Gaps = 11/93 (12%)
 Frame = +1

Query  316  DHQVEYGEHIAIMGSTKELGSWKKN---------VMMDWTEKGWVSEMELKGGEPVEFKF  468
            D   + GE++ ++G+  ELG W  +         V+ ++    W  ++ L  G  +EFKF
Sbjct  622  DATTDVGENVYVVGNVHELGDWDTDRAVGPFFNQVVHEYPN--WYYDVNLPAGTDIEFKF  679

Query  469  VIVGKDKNLLWETGDNRVLKLPAGGSFKMVCQW  567
            V +  D  + WE+G NR    P   + +    W
Sbjct  680  VKIASDGTVTWESGSNRQYTTPTDSTGEYSGTW  712



>gb|AGT45478.1| CGTase [Bacillus cereus]
Length=694

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 46/87 (53%), Gaps = 11/87 (13%)
 Frame = +1

Query  334  GEHIAIMGSTKELGSWKKN---------VMMDWTEKGWVSEMELKGGEPVEFKFVIVGKD  486
            G ++ I+G+  ELG+W  N         VM  +    W  ++ +  G+ +E+K++   ++
Sbjct  610  GTNVYIVGNVSELGNWDPNKAIGPMFNQVMYKYPT--WYYDISVPAGKNLEYKYIKKDQN  667

Query  487  KNLLWETGDNRVLKLPAGGSFKMVCQW  567
             N+ W++G+NR    PA G+  ++  W
Sbjct  668  GNVTWQSGNNRTYTSPATGTDTVISNW  694



>ref|WP_012269126.1| MULTISPECIES: alpha-amylase [Thermoanaerobacter]
 gb|ABY94335.1| alpha amylase, catalytic region [Thermoanaerobacter pseudethanolicus 
ATCC 33223]
 gb|ADV79284.1| alpha amylase catalytic region [Thermoanaerobacter brockii subsp. 
finnii Ako-1]
Length=757

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/78 (31%), Positives = 40/78 (51%), Gaps = 4/78 (5%)
 Frame = +1

Query  313  LDHQVEYGEHIAIMGSTKELGSW----KKNVMMDWTEKGWVSEMELKGGEPVEFKFVIVG  480
            ++   E+G++I I+G+  ELG W        MM      W   + +  G   EFKF+   
Sbjct  664  VNASTEWGQNIHIVGNLPELGGWDPAMSTEAMMCPNYPEWFLPVSVPMGTTFEFKFIKKD  723

Query  481  KDKNLLWETGDNRVLKLP  534
             + N++WE+G+NR+   P
Sbjct  724  SNGNVIWESGENRIFTSP  741



>sp|P19584.1|AMYB_THETU RecName: Full=Thermophilic beta-amylase; AltName: Full=1,4-alpha-D-glucan 
maltohydrolase; Flags: Precursor [Thermoanaerobacterium 
thermosulfurigenes]
 gb|AAA23204.1| thermophilic beta-amylase (EC 3.2.1.2) [Thermoanaerobacterium 
thermosulfurigenes]
Length=551

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/83 (29%), Positives = 38/83 (46%), Gaps = 4/83 (5%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNVMMDWTE----KGWVSEMELKGGEPVEFKFVIVGKDKNLL  498
            YG+++ I+GST +LG+W                W   + L  GE ++FK V +    N+ 
Sbjct  467  YGQNVYIVGSTSDLGNWNTTYARGPASCPNYPTWTITLNLLPGEQIQFKAVKIDSSGNVT  526

Query  499  WETGDNRVLKLPAGGSFKMVCQW  567
            WE G N    +P  G+  +   W
Sbjct  527  WEGGSNHTYTVPTSGTGSVTITW  549



>ref|XP_004366717.1| kin17-like protein [Dictyostelium fasciculatum]
 gb|EGG19084.1| kin17-like protein [Dictyostelium fasciculatum]
Length=695

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 5/90 (6%)
 Frame = +1

Query  298  KLKIWLDHQVEYGEHIAIMGSTKELGSW--KKNVMMDWTE-KGWVSEMELKGGEPVEFKF  468
            K++ WL H V +G+ I + GS  +LG+W  +K+  + +++   W  E+ L     +E+K+
Sbjct  599  KVRFWLKHHVPFGQQIRVTGSCDQLGNWDPQKSFPLKFSQGDTWEGEIILGQAGRIEYKY  658

Query  469  VIVGKDKNLL--WETGDNRVLKLPAGGSFK  552
             I   D   L  WE G NRV  + +  +++
Sbjct  659  FISYYDTGELVYWEGGPNRVFLVSSNSNYR  688



>gb|KDP24469.1| hypothetical protein JCGZ_25033 [Jatropha curcas]
Length=461

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 60/116 (52%), Gaps = 6/116 (5%)
 Frame = +1

Query  190  RPTRGLSSRTICAVSSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKE  369
            RP    S  T    + +ET E + +  ++      + +K+ L  +  +GE  A++G+   
Sbjct  56   RPIYASSFSTKSQQTDLETVETQNQETDQSKT---VHVKVQLKKECSFGEQFAMVGNDPI  112

Query  370  LGSW--KKNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
             G W  +  + ++W++   W  ++++  G+ +EFKF++      +LW+ G +R+LK
Sbjct  113  FGVWDPENAIPLNWSDGHVWTLDLDIPIGKSIEFKFILKQITGEVLWQPGPDRILK  168



>gb|KIY53725.1| glycoside hydrolase family 13 protein [Fistulina hepatica ATCC 
64428]
Length=558

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (49%), Gaps = 3/82 (4%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNVMMDWTEKG---WVSEMELKGGEPVEFKFVIVGKDKNLLW  501
            +GE I ++GS  ELG+W  +  +  +      W   + ++ G   E+KF+ +  D  + W
Sbjct  476  WGESIYLVGSIPELGNWDTDSAIALSSADYPVWTVAVSIETGVYFEYKFIRIETDDTVEW  535

Query  502  ETGDNRVLKLPAGGSFKMVCQW  567
            E+  NR    P  GS  +V  W
Sbjct  536  ESDPNRAATAPTSGSLTLVTTW  557



>pdb|2VN4|A Chain A, Glycoside Hydrolase Family 15 Glucoamylase From Hypocrea 
Jecorina
 pdb|2VN7|A Chain A, Glycoside Hydrolase Family 15 Glucoamylase From Hypocrea 
Jecorina
Length=599

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (55%), Gaps = 7/77 (9%)
 Frame = +1

Query  328  EYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-----WVSEMELKGGEPVEFKFVIVGKD  486
            ++G+ + + G+   LG+W  +  V +D          W+  + L+ G+ VE+K++ VG+D
Sbjct  508  QFGQTVKVAGNAAALGNWSTSAAVALDAVNYADNHPLWIGTVNLEAGDVVEYKYINVGQD  567

Query  487  KNLLWETGDNRVLKLPA  537
             ++ WE+  N    +PA
Sbjct  568  GSVTWESDPNHTYTVPA  584



>pdb|1CYG|A Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase)
Length=680

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 43/85 (51%), Gaps = 7/85 (8%)
 Frame = +1

Query  334  GEHIAIMGSTKELGSWKKNVMMD-------WTEKGWVSEMELKGGEPVEFKFVIVGKDKN  492
            G++I I+G+  ELG+W  +  +        ++   W  ++ +  G+ +EFKF+      N
Sbjct  594  GQNIYIVGNVYELGNWDTSKAIGPMFNQVVYSYPTWYIDVSVPEGKTIEFKFIKKDSQGN  653

Query  493  LLWETGDNRVLKLPAGGSFKMVCQW  567
            + WE+G N V   P   + K++  W
Sbjct  654  VTWESGSNHVYTTPTNTTGKIIVDW  678



>sp|P31797.1|CDGT_GEOSE RecName: Full=Cyclomaltodextrin glucanotransferase; AltName: 
Full=Cyclodextrin-glycosyltransferase; Short=CGTase; Flags: 
Precursor [Geobacillus stearothermophilus]
 emb|CAA41770.1| cyclomaltodextrin glucanotransferase [Geobacillus stearothermophilus]
 emb|CAA41772.1| cyclomaltodextrin glucanotransferase [Geobacillus stearothermophilus]
 emb|CAA41771.1| cyclomaltodextrin glucanotransferase [Geobacillus stearothermophilus]
Length=711

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 43/85 (51%), Gaps = 7/85 (8%)
 Frame = +1

Query  334  GEHIAIMGSTKELGSWKKNVMMD-------WTEKGWVSEMELKGGEPVEFKFVIVGKDKN  492
            G++I I+G+  ELG+W  +  +        ++   W  ++ +  G+ +EFKF+      N
Sbjct  625  GQNIYIVGNVYELGNWDTSKAIGPMFNQVVYSYPTWYIDVSVPEGKTIEFKFIKKDSQGN  684

Query  493  LLWETGDNRVLKLPAGGSFKMVCQW  567
            + WE+G N V   P   + K++  W
Sbjct  685  VTWESGSNHVYTTPTNTTGKIIVDW  709



>ref|XP_009377794.1| PREDICTED: uncharacterized protein LOC103966354 [Pyrus x bretschneideri]
Length=497

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 63/130 (48%), Gaps = 10/130 (8%)
 Frame = +1

Query  190  RPTRGLSSRTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGST  363
            +P R L    IC  S  +T E+E    + + A+  + + +K  L  +  +G+   I+G  
Sbjct  55   KPIRPL----ICLSSKTQT-ELEVADSQMQEAYHTKTIHVKFQLQKECSFGQEFLIVGDD  109

Query  364  KELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLP  534
               G W     + M+W++   W  EM++  G+ ++FKF++     N+ W+ G +R+ +  
Sbjct  110  PMFGLWDPASAIPMNWSDGNVWTVEMDIPVGKSIQFKFILKESTGNISWQPGPDRIFQTW  169

Query  535  AGGSFKMVCQ  564
               +   VC+
Sbjct  170  ETKNAITVCE  179



>ref|WP_020710051.1| hypothetical protein [Acidobacteriaceae bacterium KBS 83]
Length=712

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 6/84 (7%)
 Frame = +1

Query  334  GEHIAIMGSTKELGSWKKNV------MMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNL  495
            G++I + G+T ELG+W          M+D     W   + +  G+ ++FKF+ +     +
Sbjct  627  GDYIFLTGNTVELGNWGTTFDTAVGPMLDPNYPNWFLNVSVPAGQSIQFKFIKIAASGTI  686

Query  496  LWETGDNRVLKLPAGGSFKMVCQW  567
             WE G N    +P  G+  +   W
Sbjct  687  TWENGANHSYTVPTSGTGSVNVTW  710



>ref|XP_001270422.1| starch binding domain protein [Aspergillus clavatus NRRL 1]
 gb|EAW08996.1| starch binding domain protein [Aspergillus clavatus NRRL 1]
Length=385

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (51%), Gaps = 7/81 (9%)
 Frame = +1

Query  325  VEYGEHIAIMGSTKELGSWKKNVMM-----DWTEKG--WVSEMELKGGEPVEFKFVIVGK  483
              YGE+I ++GS  +LGSW  +  +      +T     W   ++L  G   E+KF+   K
Sbjct  294  TNYGENIFLVGSISQLGSWSTSSAVPLSATQYTSSNPLWTVTVQLPAGATFEYKFIRKQK  353

Query  484  DKNLLWETGDNRVLKLPAGGS  546
            D +++WE+  NR    P G S
Sbjct  354  DGSVIWESNPNRSYTTPNGCS  374



>ref|XP_009344720.1| PREDICTED: uncharacterized protein LOC103936600 isoform X2 [Pyrus 
x bretschneideri]
Length=826

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/119 (24%), Positives = 58/119 (49%), Gaps = 5/119 (4%)
 Frame = +1

Query  187  NRPTRGLSSRTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGS  360
            N P      R I  +SS    E+E    + +  H  + +++K+ L  +  +G+   I+G 
Sbjct  383  NMPESKPVIRPIICLSSKTQTELEIADSQIQETHHTKTIRVKLQLQKECSFGQEFLIVGD  442

Query  361  TKELGSWK--KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
                G W     + M+W++   W  E+++  G+ ++FKF++     N+ W+ G +R+ +
Sbjct  443  DPMFGLWDPASAIPMNWSDGNVWTVELDIPVGKSIQFKFILKEHTGNISWQPGPDRIFQ  501



>ref|NP_568087.1| carbohydrate-binding domain-containing protein [Arabidopsis thaliana]
 gb|AAL15255.1| AT5g01260/F7J8_240 [Arabidopsis thaliana]
 gb|AAN28796.1| At5g01260/F7J8_240 [Arabidopsis thaliana]
 gb|AED90319.1| carbohydrate-binding domain-containing protein [Arabidopsis thaliana]
Length=306

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/133 (25%), Positives = 66/133 (50%), Gaps = 9/133 (7%)
 Frame = +1

Query  208  SSRTICAV----SSVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELG  375
            SSR +  V    SS++  +V  + +E  ++++ ++++  L  +  +GEH  I+G     G
Sbjct  54   SSRILKPVPLRSSSIKDSQVNVEDEEIEASNKTVRVRFQLRKECVFGEHFFIVGDDPVFG  113

Query  376  S-WKKNVMM--DWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGG  543
              W     +  +W++   W  +++L  G  VEFK ++  +   +LW+ G NR L+     
Sbjct  114  GLWDPETALPLNWSDGNVWTVDLDLPVGRLVEFKLLLKAQTGEILWQPGPNRALETWETN  173

Query  544  SFKMVCQ-WNVTD  579
                +C+ W+  D
Sbjct  174  KTIRICEDWDNAD  186



>ref|XP_006576538.1| PREDICTED: phosphoglucan, water dikinase, chloroplastic-like 
isoform X3 [Glycine max]
Length=221

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 54/100 (54%), Gaps = 3/100 (3%)
 Frame = +1

Query  235  SVETREVEKKGKEKRSAHENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK--KNVMMDWT  408
             +ET E + +  E+ +  + +++   L     +GE   I+G    LGSW   + + M W+
Sbjct  73   DLETVEPQAQQSEQTNESKFVRVSFQLQKTCNFGEQFLIVGGGPVLGSWDPLEALPMTWS  132

Query  409  E-KGWVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVL  525
            E   W  E+++  G+  ++KF++ G+  +++W+   +R++
Sbjct  133  EGHVWAVELDMPAGQTFQYKFILKGEGGDIIWQPRLDRLI  172



>gb|KFY83798.1| hypothetical protein V500_09893 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=924

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 37/74 (50%), Gaps = 7/74 (9%)
 Frame = +1

Query  334  GEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGKDKN  492
            G+ I I+GS  +LGSW     +  +  G       W   ++L  G  VE+KF+ V  D  
Sbjct  591  GQTIKIVGSVAKLGSWNPASAVALSASGYTDSNPLWSISVDLPAGTKVEYKFINVASDGT  650

Query  493  LLWETGDNRVLKLP  534
            + WE+G NR   +P
Sbjct  651  VTWESGPNRQYTVP  664



>ref|XP_008370075.1| PREDICTED: uncharacterized protein LOC103433588 [Malus domestica]
Length=497

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/122 (23%), Positives = 59/122 (48%), Gaps = 5/122 (4%)
 Frame = +1

Query  214  RTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK-  384
            R +  +SS    E+E    + + A+  + + +K  L  +  +G+   I+G     G W  
Sbjct  58   RPVICLSSKTQTELEVADSQMQEAYHTKTIHVKFQLQKECSFGQEFLIVGDDPMFGLWDP  117

Query  385  -KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLKLPAGGSFKMV  558
               + M+W++   W  EM++  G+ ++FKF++     N+ W+ G +R+ +     +   V
Sbjct  118  ASAIPMNWSDGNVWTVEMDIPVGKSIQFKFILKESTGNISWQPGPDRIFQTWETKNAITV  177

Query  559  CQ  564
            C+
Sbjct  178  CE  179



>ref|XP_009344719.1| PREDICTED: uncharacterized protein LOC103936600 isoform X1 [Pyrus 
x bretschneideri]
Length=842

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/110 (24%), Positives = 56/110 (51%), Gaps = 5/110 (5%)
 Frame = +1

Query  214  RTICAVSSVETREVEKKGKEKRSAH--ENLKLKIWLDHQVEYGEHIAIMGSTKELGSWK-  384
            R I  +SS    E+E    + +  H  + +++K+ L  +  +G+   I+G     G W  
Sbjct  408  RPIICLSSKTQTELEIADSQIQETHHTKTIRVKLQLQKECSFGQEFLIVGDDPMFGLWDP  467

Query  385  -KNVMMDWTEKG-WVSEMELKGGEPVEFKFVIVGKDKNLLWETGDNRVLK  528
               + M+W++   W  E+++  G+ ++FKF++     N+ W+ G +R+ +
Sbjct  468  ASAIPMNWSDGNVWTVELDIPVGKSIQFKFILKEHTGNISWQPGPDRIFQ  517



>ref|XP_010037714.1| PREDICTED: uncharacterized protein LOC104426382 isoform X2 [Eucalyptus 
grandis]
Length=391

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 47/82 (57%), Gaps = 3/82 (4%)
 Frame = +1

Query  295  LKLKIWLDHQVEYGEHIAIMGSTKELGSWKKN--VMMDWTEKG-WVSEMELKGGEPVEFK  465
            + ++  +  + ++GE   ++G    LGSW  +  V +DW++   W  E+++  G  ++FK
Sbjct  96   VHVRFQVQRECQFGEQFLVIGDDPALGSWDPSSAVPLDWSDGHIWSVELDIPIGRDIQFK  155

Query  466  FVIVGKDKNLLWETGDNRVLKL  531
            F++  +D  + W+   +R+L++
Sbjct  156  FILRQRDGEIQWQPDPDRILQI  177



>ref|XP_008081828.1| Six-hairpin glycosidase [Glarea lozoyensis ATCC 20868]
 gb|EPE30417.1| Six-hairpin glycosidase [Glarea lozoyensis ATCC 20868]
Length=683

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/79 (32%), Positives = 39/79 (49%), Gaps = 7/79 (9%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGKDK  489
            YG+ I ++GS   LG+W     +  +          W   + L  G  VE+K++ V  D 
Sbjct  585  YGQTIKLVGSVAALGNWAPANAITLSAAQYTASNPLWFGTVGLPAGTRVEYKYINVAADG  644

Query  490  NLLWETGDNRVLKLPAGGS  546
            ++ WE G NRV  +PA G+
Sbjct  645  SVTWEGGANRVYTVPASGT  663



>gb|EEH40712.2| glucoamylase [Paracoccidioides sp. 'lutzii' Pb01]
Length=648

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/77 (30%), Positives = 39/77 (51%), Gaps = 7/77 (9%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGKDK  489
            +G+ I ++GS  ELGSW     +  +          W   + L  G+  E+K++    D 
Sbjct  541  FGQMILLVGSIPELGSWAPGSAIALSADQYSDANHLWYKTITLSAGQKFEYKYIRQETDG  600

Query  490  NLLWETGDNRVLKLPAG  540
            N++WE+G NR+  +P G
Sbjct  601  NIVWESGSNRLYTVPRG  617



>ref|WP_030462927.1| alpha-amylase [Kitasatospora sp. NRRL B-11411]
Length=723

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 39/82 (48%), Gaps = 3/82 (4%)
 Frame = +1

Query  331  YGEHIAIMGSTKELGSWKKNV---MMDWTEKGWVSEMELKGGEPVEFKFVIVGKDKNLLW  501
            YG+++ ++GST +LGSW       M   +   W   + L      E+K+++     N+ W
Sbjct  641  YGQNVYLVGSTAQLGSWNPASALPMSSASYPNWTLSLTLPANSAFEYKYIVKDAAGNVTW  700

Query  502  ETGDNRVLKLPAGGSFKMVCQW  567
            E+G NR     A G+  +   W
Sbjct  701  ESGANRSYTTGASGTATLTDSW  722



>ref|XP_007273214.1| glucoamylase [Colletotrichum gloeosporioides Nara gc5]
 gb|ELA37711.1| glucoamylase [Colletotrichum gloeosporioides Nara gc5]
Length=626

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/77 (26%), Positives = 40/77 (52%), Gaps = 7/77 (9%)
 Frame = +1

Query  328  EYGEHIAIMGSTKELGSWKKNVMMDWTEKG-------WVSEMELKGGEPVEFKFVIVGKD  486
            ++G+ I I+G+T +LG+W     +  +  G       W   +EL+ G+ +++K++ V  D
Sbjct  538  QFGQTIKIVGNTAQLGNWSPGSAISLSASGYTSANPVWSVTIELQAGQAIQYKYINVASD  597

Query  487  KNLLWETGDNRVLKLPA  537
              + WE   N    +P+
Sbjct  598  GTVTWEADPNHTYTVPS  614



Lambda      K        H        a         alpha
   0.317    0.134    0.408    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800