BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF047C07

Length=472
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010553233.1|  PREDICTED: 40S ribosomal protein S4-3 isofor...    269   1e-87   Tarenaya hassleriana [spider flower]
ref|XP_010529053.1|  PREDICTED: 40S ribosomal protein S4-3-like         268   3e-87   Tarenaya hassleriana [spider flower]
ref|XP_007211867.1|  hypothetical protein PRUPE_ppa010094mg             268   3e-87   Prunus persica
ref|XP_007156130.1|  hypothetical protein PHAVU_003G261200g             268   3e-87   Phaseolus vulgaris [French bean]
ref|XP_008383247.1|  PREDICTED: 40S ribosomal protein S4                268   3e-87   Malus domestica [apple tree]
ref|XP_011084586.1|  PREDICTED: 40S ribosomal protein S4                268   3e-87   Sesamum indicum [beniseed]
ref|NP_001189539.1|  40S ribosomal protein S4-1                         265   3e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009368564.1|  PREDICTED: 40S ribosomal protein S4-3-like         268   3e-87   Pyrus x bretschneideri [bai li]
gb|EYU41945.1|  hypothetical protein MIMGU_mgv1a012043mg                268   3e-87   Erythranthe guttata [common monkey flower]
ref|XP_008233807.1|  PREDICTED: 40S ribosomal protein S4-1              268   3e-87   Prunus mume [ume]
ref|NP_200650.1|  40S ribosomal protein S4-3                            268   4e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011097305.1|  PREDICTED: 40S ribosomal protein S4-like           268   4e-87   Sesamum indicum [beniseed]
ref|NP_568179.1|  40S ribosomal protein S4-2                            267   4e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006851828.1|  hypothetical protein AMTR_s00041p00058440          268   4e-87   
ref|XP_006288484.1|  hypothetical protein CARUB_v10001743mg             267   4e-87   Capsella rubella
ref|XP_010243078.1|  PREDICTED: 40S ribosomal protein S4-3-like         267   5e-87   Nelumbo nucifera [Indian lotus]
ref|XP_010491309.1|  PREDICTED: 40S ribosomal protein S4-3-like         267   5e-87   Camelina sativa [gold-of-pleasure]
ref|XP_006280972.1|  hypothetical protein CARUB_v10026972mg             267   5e-87   Capsella rubella
ref|XP_002884052.1|  40S ribosomal protein S4                           267   5e-87   Arabidopsis lyrata subsp. lyrata
ref|NP_565414.1|  40S ribosomal protein S4-1                            267   5e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515129.1|  PREDICTED: 40S ribosomal protein S4-1              267   5e-87   Camelina sativa [gold-of-pleasure]
ref|XP_006409322.1|  hypothetical protein EUTSA_v10022813mg             267   5e-87   Eutrema salsugineum [saltwater cress]
ref|XP_006298349.1|  hypothetical protein CARUB_v10014418mg             267   6e-87   Capsella rubella
ref|XP_002275063.1|  PREDICTED: 40S ribosomal protein S4                267   6e-87   Vitis vinifera
gb|KCW60004.1|  hypothetical protein EUGRSUZ_H02737                     265   6e-87   Eucalyptus grandis [rose gum]
ref|XP_010529903.1|  PREDICTED: 40S ribosomal protein S4-3-like         267   6e-87   Tarenaya hassleriana [spider flower]
ref|XP_010453688.1|  PREDICTED: 40S ribosomal protein S4-3-like         267   6e-87   Camelina sativa [gold-of-pleasure]
ref|NP_001235428.1|  uncharacterized protein LOC100500000               265   6e-87   
ref|XP_010423256.1|  PREDICTED: 40S ribosomal protein S4-3-like         266   7e-87   Camelina sativa [gold-of-pleasure]
gb|AGZ15374.1|  40S ribosomal S4 protein                                266   9e-87   Phaseolus vulgaris [French bean]
gb|KDP30648.1|  hypothetical protein JCGZ_16213                         266   9e-87   Jatropha curcas
gb|KDP45131.1|  hypothetical protein JCGZ_17463                         266   9e-87   Jatropha curcas
ref|XP_010553232.1|  PREDICTED: 40S ribosomal protein S4-3 isofor...    266   9e-87   Tarenaya hassleriana [spider flower]
gb|KHN48586.1|  40S ribosomal protein S4-2                              266   1e-86   Glycine soja [wild soybean]
ref|XP_002871248.1|  40S ribosomal protein S4                           266   1e-86   Arabidopsis lyrata subsp. lyrata
ref|XP_010934423.1|  PREDICTED: 40S ribosomal protein S4-3-like         266   1e-86   Elaeis guineensis
ref|XP_003544057.1|  PREDICTED: 40S ribosomal protein S4-1              266   1e-86   Glycine max [soybeans]
ref|XP_006488578.1|  PREDICTED: 40S ribosomal protein S4-like           266   1e-86   Citrus sinensis [apfelsine]
gb|AAL49933.1|  AT5g58420/mqj2_10                                       266   1e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003604568.1|  40S ribosomal protein S4                           266   1e-86   Medicago truncatula
ref|XP_004294780.1|  PREDICTED: 40S ribosomal protein S4-3              266   1e-86   Fragaria vesca subsp. vesca
dbj|BAE20168.1|  ribosomal protein S4                                   266   1e-86   Panax ginseng [Asiatic ginseng]
ref|XP_010243101.1|  PREDICTED: 40S ribosomal protein S4-3-like         266   1e-86   Nelumbo nucifera [Indian lotus]
ref|XP_010276734.1|  PREDICTED: 40S ribosomal protein S4-3              266   1e-86   Nelumbo nucifera [Indian lotus]
ref|XP_002864574.1|  40S ribosomal protein S4                           266   1e-86   Arabidopsis lyrata subsp. lyrata
ref|XP_006399188.1|  hypothetical protein EUTSA_v10014417mg             266   1e-86   Eutrema salsugineum [saltwater cress]
ref|XP_009369212.1|  PREDICTED: 40S ribosomal protein S4-3              266   1e-86   Pyrus x bretschneideri [bai li]
ref|XP_007218753.1|  hypothetical protein PRUPE_ppa009337mg             267   1e-86   
ref|XP_006576176.1|  PREDICTED: uncharacterized protein LOC100500...    266   1e-86   
ref|XP_003516980.1|  PREDICTED: 40S ribosomal protein S4                266   2e-86   Glycine max [soybeans]
ref|NP_001235826.1|  40S ribosomal S4 protein                           266   2e-86   Glycine max [soybeans]
ref|XP_003547932.1|  PREDICTED: 40S ribosomal protein S4-1              266   2e-86   Glycine max [soybeans]
gb|EYU19705.1|  hypothetical protein MIMGU_mgv1a012053mg                266   2e-86   Erythranthe guttata [common monkey flower]
ref|XP_010907826.1|  PREDICTED: 40S ribosomal protein S4-3-like         265   2e-86   Elaeis guineensis
dbj|BAB11167.1|  40S ribosomal protein S4                               265   3e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006429477.1|  hypothetical protein CICLE_v10012499mg             265   3e-86   Citrus clementina [clementine]
gb|KGN44410.1|  hypothetical protein Csa_7G281390                       265   4e-86   Cucumis sativus [cucumbers]
ref|XP_008234249.1|  PREDICTED: 40S ribosomal protein S4                265   4e-86   Prunus mume [ume]
ref|XP_010443578.1|  PREDICTED: 40S ribosomal protein S4-3-like i...    265   4e-86   
ref|XP_004150395.1|  PREDICTED: 40S ribosomal protein S4-like           265   5e-86   
ref|XP_009369565.1|  PREDICTED: 40S ribosomal protein S4-3-like         265   5e-86   Pyrus x bretschneideri [bai li]
ref|XP_010483440.1|  PREDICTED: 40S ribosomal protein S4-3-like         265   5e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010938423.1|  PREDICTED: 40S ribosomal protein S4-3              265   5e-86   Elaeis guineensis
gb|KFK36724.1|  hypothetical protein AALP_AA4G161500                    265   5e-86   Arabis alpina [alpine rockcress]
ref|XP_002512717.1|  40S ribosomal protein S4, putative                 265   5e-86   Ricinus communis
ref|XP_004307685.1|  PREDICTED: 40S ribosomal protein S4-like           265   6e-86   Fragaria vesca subsp. vesca
ref|XP_007205728.1|  hypothetical protein PRUPE_ppa010072mg             265   6e-86   Prunus persica
ref|XP_003623356.1|  40S ribosomal protein S4                           265   6e-86   Medicago truncatula
ref|XP_004293830.1|  PREDICTED: 40S ribosomal protein S4-3              265   6e-86   Fragaria vesca subsp. vesca
emb|CDY60025.1|  BnaAnng16450D                                          265   7e-86   Brassica napus [oilseed rape]
ref|XP_010676809.1|  PREDICTED: 40S ribosomal protein S4-1-like         264   7e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002515668.1|  40S ribosomal protein S4, putative                 264   7e-86   Ricinus communis
ref|XP_010023674.1|  PREDICTED: 40S ribosomal protein S4-3              264   7e-86   Eucalyptus grandis [rose gum]
ref|XP_002276986.1|  PREDICTED: 40S ribosomal protein S4-1              264   7e-86   Vitis vinifera
gb|ACU24295.1|  unknown                                                 264   7e-86   Glycine max [soybeans]
gb|AFK41206.1|  unknown                                                 259   8e-86   Lotus japonicus
ref|XP_009393217.1|  PREDICTED: 40S ribosomal protein S4-1-like         264   8e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002268192.1|  PREDICTED: 40S ribosomal protein S4-3-like         264   9e-86   Vitis vinifera
ref|XP_008454823.1|  PREDICTED: 40S ribosomal protein S4-3              264   9e-86   Cucumis melo [Oriental melon]
ref|XP_004163526.1|  PREDICTED: 40S ribosomal protein S4-like           264   9e-86   
ref|XP_010517120.1|  PREDICTED: 40S ribosomal protein S4-3-like         264   9e-86   Camelina sativa [gold-of-pleasure]
gb|AAS48726.1|  ribosomal protein S4                                    264   1e-85   Zea mays [maize]
ref|XP_009391002.1|  PREDICTED: 40S ribosomal protein S4-3              264   1e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009120350.1|  PREDICTED: 40S ribosomal protein S4-1              264   1e-85   Brassica rapa
ref|XP_009766580.1|  PREDICTED: 40S ribosomal protein S4                264   1e-85   Nicotiana sylvestris
ref|XP_004511996.1|  PREDICTED: 40S ribosomal protein S4-1-like         264   1e-85   Cicer arietinum [garbanzo]
ref|XP_002463552.1|  hypothetical protein SORBIDRAFT_01g001850          264   1e-85   Sorghum bicolor [broomcorn]
ref|NP_001266498.1|  40S ribosomal protein S4                           264   1e-85   Zea mays [maize]
ref|XP_010037684.1|  PREDICTED: 40S ribosomal protein S4-3-like         263   1e-85   Eucalyptus grandis [rose gum]
ref|XP_009354210.1|  PREDICTED: 40S ribosomal protein S4-3-like         264   1e-85   Pyrus x bretschneideri [bai li]
ref|XP_004240421.1|  PREDICTED: 40S ribosomal protein S4                263   1e-85   Solanum lycopersicum
ref|XP_010036744.1|  PREDICTED: 40S ribosomal protein S4-3-like         263   1e-85   Eucalyptus grandis [rose gum]
ref|XP_007141735.1|  hypothetical protein PHAVU_008G221000g             263   2e-85   Phaseolus vulgaris [French bean]
emb|CDY32986.1|  BnaA10g11920D                                          264   2e-85   Brassica napus [oilseed rape]
ref|XP_009385022.1|  PREDICTED: 40S ribosomal protein S4-1-like         263   2e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009132054.1|  PREDICTED: 40S ribosomal protein S4-2-like         263   2e-85   Brassica rapa
ref|NP_001275093.1|  40S ribosomal protein S4-like                      263   2e-85   Solanum tuberosum [potatoes]
ref|XP_006344073.1|  PREDICTED: 40S ribosomal protein S4-like           263   2e-85   
ref|XP_003611879.1|  40S ribosomal protein S4                           263   2e-85   Medicago truncatula
ref|XP_008461463.1|  PREDICTED: 40S ribosomal protein S4-3-like         263   2e-85   Cucumis melo [Oriental melon]
emb|CDY57385.1|  BnaCnng31910D                                          264   3e-85   Brassica napus [oilseed rape]
ref|NP_001275148.1|  40S ribosomal protein S4                           263   3e-85   Solanum tuberosum [potatoes]
ref|XP_008461503.1|  PREDICTED: 40S ribosomal protein S4-3-like         263   3e-85   Cucumis melo [Oriental melon]
ref|XP_004150397.1|  PREDICTED: 40S ribosomal protein S4-like           263   3e-85   Cucumis sativus [cucumbers]
ref|XP_004492491.1|  PREDICTED: 40S ribosomal protein S4-2-like         263   3e-85   Cicer arietinum [garbanzo]
emb|CDY14056.1|  BnaC02g01730D                                          263   4e-85   Brassica napus [oilseed rape]
ref|XP_004491013.1|  PREDICTED: 40S ribosomal protein S4-2-like         263   4e-85   Cicer arietinum [garbanzo]
emb|CDY05015.1|  BnaAnng01970D                                          264   4e-85   
ref|NP_001242281.1|  uncharacterized protein LOC100812132               262   4e-85   Glycine max [soybeans]
gb|KHN38535.1|  40S ribosomal protein S4-1                              262   4e-85   Glycine soja [wild soybean]
ref|XP_010666843.1|  PREDICTED: 40S ribosomal protein S4-1              262   4e-85   
ref|XP_009597091.1|  PREDICTED: 40S ribosomal protein S4-like           262   5e-85   Nicotiana tomentosiformis
ref|XP_008789926.1|  PREDICTED: 40S ribosomal protein S4-1 isofor...    262   5e-85   
gb|ACU24626.1|  unknown                                                 262   6e-85   Glycine max [soybeans]
ref|XP_002455614.1|  hypothetical protein SORBIDRAFT_03g014380          262   6e-85   Sorghum bicolor [broomcorn]
gb|KFK27370.1|  hypothetical protein AALP_AA8G374100                    262   6e-85   Arabis alpina [alpine rockcress]
ref|XP_002308235.1|  hypothetical protein POPTR_0006s10460g             262   6e-85   Populus trichocarpa [western balsam poplar]
ref|XP_009381027.1|  PREDICTED: 40S ribosomal protein S4-like           262   7e-85   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN00473.1|  40S ribosomal protein S4-1                              263   7e-85   Glycine soja [wild soybean]
ref|XP_006646768.1|  PREDICTED: 40S ribosomal protein S4-like           262   7e-85   Oryza brachyantha
ref|XP_010685909.1|  PREDICTED: 40S ribosomal protein S4-1              261   7e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009784493.1|  PREDICTED: 40S ribosomal protein S4-like           262   7e-85   Nicotiana sylvestris
ref|XP_008356229.1|  PREDICTED: 40S ribosomal protein S4-3-like         262   7e-85   
ref|XP_009125675.1|  PREDICTED: 40S ribosomal protein S4-1              261   8e-85   Brassica rapa
ref|XP_006645886.1|  PREDICTED: 40S ribosomal protein S4-like           262   8e-85   
ref|XP_011046821.1|  PREDICTED: 40S ribosomal protein S4-3              261   8e-85   Populus euphratica
ref|XP_011035547.1|  PREDICTED: 40S ribosomal protein S4-1              261   8e-85   Populus euphratica
gb|KFK25102.1|  hypothetical protein AALP_AA8G066400                    261   8e-85   Arabis alpina [alpine rockcress]
ref|XP_006374217.1|  40S ribosomal protein S4                           261   9e-85   Populus trichocarpa [western balsam poplar]
ref|XP_009794044.1|  PREDICTED: 40S ribosomal protein S4-like           261   9e-85   Nicotiana sylvestris
ref|XP_009402521.1|  PREDICTED: 40S ribosomal protein S4-3-like         261   1e-84   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAX19871.1|  putative ribosomal protein S4                           256   1e-84   Doryanthes excelsa
ref|XP_006352980.1|  PREDICTED: 40S ribosomal protein S4-like           261   1e-84   Solanum tuberosum [potatoes]
ref|XP_004233134.1|  PREDICTED: 40S ribosomal protein S4-like           261   1e-84   Solanum lycopersicum
ref|XP_004233133.1|  PREDICTED: 40S ribosomal protein S4-like           261   1e-84   Solanum lycopersicum
gb|ABK92450.1|  unknown                                                 261   1e-84   Populus trichocarpa [western balsam poplar]
ref|XP_006411034.1|  hypothetical protein EUTSA_v10017036mg             262   1e-84   
ref|XP_006401084.1|  hypothetical protein EUTSA_v10014163mg             263   1e-84   
ref|XP_002323021.2|  hypothetical protein POPTR_0016s13210g             261   1e-84   Populus trichocarpa [western balsam poplar]
ref|XP_009600336.1|  PREDICTED: 40S ribosomal protein S4                261   1e-84   Nicotiana tomentosiformis
emb|CAA75242.1|  ribosomal protein S4                                   261   1e-84   Oryza sativa Japonica Group [Japonica rice]
emb|CDY69841.1|  BnaAnng31720D                                          263   1e-84   Brassica napus [oilseed rape]
ref|NP_001043015.1|  Os01g0358400                                       261   2e-84   
ref|NP_001045624.1|  Os02g0105900                                       261   2e-84   
gb|ACV70143.1|  putative 40S ribosomal protein S4                       261   2e-84   Jatropha curcas
gb|EPS63485.1|  hypothetical protein M569_11297                         261   2e-84   Genlisea aurea
ref|XP_010316939.1|  PREDICTED: 40S ribosomal protein S4-like           261   2e-84   Solanum lycopersicum
ref|XP_009595443.1|  PREDICTED: 40S ribosomal protein S4-like           260   2e-84   Nicotiana tomentosiformis
ref|XP_008789925.1|  PREDICTED: 40S ribosomal protein S4-1 isofor...    262   3e-84   Phoenix dactylifera
ref|XP_009609731.1|  PREDICTED: 40S ribosomal protein S4-like           260   4e-84   Nicotiana tomentosiformis
ref|XP_006644163.1|  PREDICTED: 40S ribosomal protein S4-like           259   5e-84   Oryza brachyantha
ref|XP_004962295.1|  PREDICTED: 40S ribosomal protein S4-like           259   5e-84   Setaria italica
ref|XP_009122377.1|  PREDICTED: 40S ribosomal protein S4-1              259   5e-84   Brassica rapa
ref|NP_001055342.1|  Os05g0368300                                       259   6e-84   
ref|XP_006352979.1|  PREDICTED: 40S ribosomal protein S4-like           259   6e-84   Solanum tuberosum [potatoes]
emb|CDX99006.1|  BnaC09g48290D                                          260   6e-84   
gb|EPS70681.1|  hypothetical protein M569_04077                         259   6e-84   Genlisea aurea
gb|KDO67004.1|  hypothetical protein CISIN_1g024108mg                   259   7e-84   Citrus sinensis [apfelsine]
ref|XP_004960263.1|  PREDICTED: 40S ribosomal protein S4-like           259   8e-84   Setaria italica
ref|XP_007050962.1|  Ribosomal protein S4 (RPS4A) family protein        259   1e-83   Theobroma cacao [chocolate]
ref|XP_002322175.1|  hypothetical protein POPTR_0015s09110g             259   1e-83   Populus trichocarpa [western balsam poplar]
ref|XP_007026596.1|  Ribosomal protein S4 (RPS4A) family protein        258   1e-83   
gb|KHG30713.1|  40S ribosomal S4                                        258   1e-83   Gossypium arboreum [tree cotton]
ref|XP_011019071.1|  PREDICTED: 40S ribosomal protein S4-3-like         258   1e-83   Populus euphratica
ref|XP_011046165.1|  PREDICTED: 40S ribosomal protein S4-2-like         258   2e-83   Populus euphratica
gb|KJB37999.1|  hypothetical protein B456_006G231800                    258   2e-83   Gossypium raimondii
ref|NP_001288485.1|  40S ribosomal protein S4-like                      258   2e-83   Zea mays [maize]
gb|KHG02041.1|  40S ribosomal S4                                        258   3e-83   Gossypium arboreum [tree cotton]
ref|XP_002318967.2|  hypothetical protein POPTR_0013s01230g             258   3e-83   Populus trichocarpa [western balsam poplar]
gb|KHG26321.1|  40S ribosomal S4                                        257   3e-83   Gossypium arboreum [tree cotton]
gb|KJB71672.1|  hypothetical protein B456_011G136800                    257   3e-83   Gossypium raimondii
gb|KHG02126.1|  40S ribosomal S4                                        257   4e-83   Gossypium arboreum [tree cotton]
ref|XP_002439678.1|  hypothetical protein SORBIDRAFT_09g018320          257   4e-83   Sorghum bicolor [broomcorn]
emb|CDX70008.1|  BnaA10g23570D                                          257   7e-83   
ref|XP_009130977.1|  PREDICTED: 40S ribosomal protein S4-1-like         256   8e-83   
gb|EAY97774.1|  hypothetical protein OsI_19685                          257   1e-82   Oryza sativa Indica Group [Indian rice]
emb|CDX81032.1|  BnaC03g02860D                                          256   1e-82   
ref|XP_011023749.1|  PREDICTED: 40S ribosomal protein S4-2-like         256   1e-82   Populus euphratica
emb|CDY58877.1|  BnaA03g55550D                                          256   2e-82   Brassica napus [oilseed rape]
dbj|BAJ94984.1|  predicted protein                                      255   4e-82   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY02821.1|  BnaC02g10680D                                          255   5e-82   
dbj|BAD22763.1|  ribosomal protein                                      254   8e-82   Bromus inermis [awnless brome grass]
sp|P46299.1|RS4_GOSHI  RecName: Full=40S ribosomal protein S4           254   8e-82   Gossypium hirsutum [American cotton]
ref|XP_010087529.1|  40S ribosomal protein S4                           255   1e-81   
gb|EEE63465.1|  hypothetical protein OsJ_18278                          257   3e-81   Oryza sativa Japonica Group [Japonica rice]
gb|KHG30303.1|  40S ribosomal S4                                        252   3e-81   Gossypium arboreum [tree cotton]
ref|XP_003568916.1|  PREDICTED: 40S ribosomal protein S4                252   4e-81   Brachypodium distachyon [annual false brome]
gb|EMT14698.1|  40S ribosomal protein S4                                252   4e-81   
emb|CDY32700.1|  BnaA02g07620D                                          253   8e-81   Brassica napus [oilseed rape]
gb|KJB29915.1|  hypothetical protein B456_005G123400                    250   2e-80   Gossypium raimondii
ref|XP_009126753.1|  PREDICTED: 40S ribosomal protein S4-1-like i...    251   5e-80   
ref|XP_009781828.1|  PREDICTED: 40S ribosomal protein S4-like           246   1e-78   Nicotiana sylvestris
gb|ABK22322.1|  unknown                                                 244   6e-78   Picea sitchensis
gb|ABK21170.1|  unknown                                                 244   6e-78   Picea sitchensis
ref|XP_008810991.1|  PREDICTED: 40S ribosomal protein S4-1-like i...    239   1e-77   
ref|XP_001759591.1|  predicted protein                                  235   1e-74   
ref|XP_001759850.1|  predicted protein                                  235   1e-74   
ref|XP_001780588.1|  predicted protein                                  235   1e-74   
ref|XP_001751877.1|  predicted protein                                  235   1e-74   
ref|XP_001785339.1|  predicted protein                                  234   5e-74   
sp|O81363.1|RS4_PRUAR  RecName: Full=40S ribosomal protein S4           233   7e-74   Prunus armeniaca
ref|XP_001766039.1|  predicted protein                                  235   7e-74   
ref|XP_009126752.1|  PREDICTED: 40S ribosomal protein S4-1-like i...    235   2e-73   
emb|CDP06439.1|  unnamed protein product                                230   1e-72   Coffea canephora [robusta coffee]
dbj|BAB10257.1|  ribosomal protein S4                                   229   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031846.1|  40S ribosomal protein S4-2                         229   2e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CBI15899.3|  unnamed protein product                                229   2e-72   Vitis vinifera
gb|KDO67006.1|  hypothetical protein CISIN_1g024108mg                   228   4e-72   Citrus sinensis [apfelsine]
ref|XP_008778562.1|  PREDICTED: 40S ribosomal protein S4-3-like         228   5e-72   Phoenix dactylifera
gb|KHN03095.1|  40S ribosomal protein S4                                228   5e-72   Glycine soja [wild soybean]
gb|KDO63242.1|  hypothetical protein CISIN_1g023289mg                   228   1e-71   Citrus sinensis [apfelsine]
emb|CBI18118.3|  unnamed protein product                                226   1e-71   Vitis vinifera
ref|XP_010509192.1|  PREDICTED: 40S ribosomal protein S4-3-like         227   1e-71   Camelina sativa [gold-of-pleasure]
emb|CBI25428.3|  unnamed protein product                                226   2e-71   Vitis vinifera
gb|KFK40122.1|  hypothetical protein AALP_AA3G333200                    224   1e-70   Arabis alpina [alpine rockcress]
gb|AAT38019.1|  putative 40S ribosomal protein S4                       223   4e-70   Oryza sativa Japonica Group [Japonica rice]
gb|KHG11751.1|  40S ribosomal S4                                        222   1e-69   Gossypium arboreum [tree cotton]
gb|KJB38000.1|  hypothetical protein B456_006G231800                    222   2e-69   Gossypium raimondii
gb|KJB77064.1|  hypothetical protein B456_012G118500                    221   3e-69   Gossypium raimondii
gb|AGT17062.1|  ribosomal protein S4                                    217   5e-69   Saccharum hybrid cultivar R570
gb|KDD75424.1|  hypothetical protein H632_c691p0                        220   1e-68   Helicosporidium sp. ATCC 50920
ref|XP_002984314.1|  hypothetical protein SELMODRAFT_271698             220   1e-68   Selaginella moellendorffii
ref|XP_002972484.1|  hypothetical protein SELMODRAFT_148442             219   2e-68   Selaginella moellendorffii
ref|XP_005850141.1|  hypothetical protein CHLNCDRAFT_59606              216   3e-67   Chlorella variabilis
gb|KJB29916.1|  hypothetical protein B456_005G123400                    216   4e-67   Gossypium raimondii
ref|XP_011402198.1|  40S ribosomal protein S4-3                         214   3e-66   Auxenochlorella protothecoides
dbj|GAN07411.1|  40S ribosomal protein S4                               214   3e-66   Mucor ambiguus
gb|EIE83303.1|  40S ribosomal protein S4                                213   9e-66   Rhizopus delemar RA 99-880
emb|CEG70586.1|  Putative 40S ribosomal protein S4-A                    212   2e-65   Rhizopus microsporus
gb|KGG52703.1|  hypothetical protein DI09_141p50                        212   2e-65   Mitosporidium daphniae
ref|XP_006576177.1|  PREDICTED: uncharacterized protein LOC100500...    211   3e-65   Glycine max [soybeans]
gb|EIE90129.1|  40S ribosomal protein S4-A                              211   4e-65   Rhizopus delemar RA 99-880
gb|EIE79548.1|  40S ribosomal protein S4-A                              211   4e-65   Rhizopus delemar RA 99-880
emb|CEP14949.1|  hypothetical protein                                   211   5e-65   Parasitella parasitica
gb|KFH71854.1|  40S ribosomal protein S4                                211   5e-65   Mortierella verticillata NRRL 6337
ref|XP_002502247.1|  predicted protein                                  211   7e-65   Micromonas commoda
ref|XP_001421876.1|  Ribosomal protein S4, component of cytosolic...    210   7e-65   Ostreococcus lucimarinus CCE9901
gb|ABZ04256.1|  ribosomal protein rps4                                  207   9e-65   Lineus viridis
ref|XP_006679983.1|  hypothetical protein BATDEDRAFT_35382              211   1e-64   Batrachochytrium dendrobatidis JAM81
ref|XP_002954897.1|  component of cytosolic 80S ribosome and 40S ...    210   1e-64   Volvox carteri f. nagariensis
emb|CEI87363.1|  Putative 40S ribosomal protein S4-A                    210   1e-64   Rhizopus microsporus
gb|KDO63240.1|  hypothetical protein CISIN_1g023289mg                   210   1e-64   Citrus sinensis [apfelsine]
emb|CEG72922.1|  Putative 40S ribosomal protein S4-A                    209   2e-64   Rhizopus microsporus
ref|XP_009022208.1|  hypothetical protein HELRODRAFT_185809             207   2e-64   Helobdella robusta
ref|XP_001691218.1|  ribosomal protein S4, component of cytosolic...    209   2e-64   Chlamydomonas reinhardtii
gb|KDO63241.1|  hypothetical protein CISIN_1g023289mg                   209   3e-64   Citrus sinensis [apfelsine]
gb|EQL02576.1|  Ribosomal protein S4e                                   209   3e-64   Ophiocordyceps sinensis CO18
emb|CEG00570.1|  Ribosomal protein S4e                                  208   4e-64   Ostreococcus tauri
ref|XP_007872809.1|  hypothetical protein PNEG_00898                    208   5e-64   Pneumocystis murina B123
emb|CDH52779.1|  40s ribosomal protein s4                               208   6e-64   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS09843.1|  Putative 40S ribosomal protein S4-A                    208   7e-64   Lichtheimia ramosa
emb|CCE33652.1|  probable ribosomal protein S4.e, cytosolic             207   1e-63   Claviceps purpurea 20.1
ref|XP_004990087.1|  ribosomal protein s4 X isoform                     207   1e-63   Salpingoeca rosetta
ref|XP_008600052.1|  ribosomal family S4e                               206   3e-63   Beauveria bassiana ARSEF 2860
gb|KID72648.1|  Ribosomal protein S4e                                   206   3e-63   Metarhizium brunneum ARSEF 3297
ref|XP_006668474.1|  ribosomal protein S4                               206   4e-63   Cordyceps militaris CM01
ref|XP_003064004.1|  predicted protein                                  206   4e-63   Micromonas pusilla CCMP1545
ref|XP_006691808.1|  40S ribosomal protein S4-like protein              206   7e-63   Chaetomium thermophilum var. thermophilum DSM 1495
gb|ELU11454.1|  hypothetical protein CAPTEDRAFT_152725                  205   7e-63   Capitella teleta
dbj|BAM17680.1|  ribosomal protein S4                                   205   8e-63   Papilio xuthus [Chinese swallowtail]
ref|XP_007823560.1|  hypothetical protein MAA_07371                     205   8e-63   Metarhizium robertsii ARSEF 23
ref|XP_007807221.1|  ribosomal protein S4                               205   9e-63   Metarhizium acridum CQMa 102
ref|XP_003052651.1|  40S ribosomal protein S4                           205   1e-62   [Nectria] haematococca mpVI 77-13-4
ref|XP_009259092.1|  hypothetical protein FPSE_07699                    205   1e-62   Fusarium pseudograminearum CS3096
gb|KIE00269.1|  Ribosomal protein S4e                                   205   1e-62   Metarhizium majus ARSEF 297
gb|KID89485.1|  Ribosomal protein S4e                                   205   1e-62   Metarhizium guizhouense ARSEF 977
ref|XP_004679117.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    205   1e-62   
gb|EXX69253.1|  ribosomal 40S subunit protein S4A                       204   1e-62   Rhizophagus irregularis DAOM 197198w
gb|KIL89636.1|  hypothetical protein FAVG1_07216                        204   2e-62   Fusarium avenaceum
gb|KJB77063.1|  hypothetical protein B456_012G118500                    204   2e-62   Gossypium raimondii
gb|ADT80676.1|  ribosomal protein S4                                    204   3e-62   Euphydryas aurinia [marsh fritillary]
emb|CCE33007.1|  probable ribosomal protein S4.e, cytosolic             204   3e-62   Claviceps purpurea 20.1
gb|EGU80487.1|  hypothetical protein FOXB_08947                         204   3e-62   Fusarium oxysporum Fo5176
ref|XP_005650091.1|  ribosomal protein S4 component of cytosolic ...    204   3e-62   Coccomyxa subellipsoidea C-169
ref|XP_005536157.1|  40S ribosomal protein S4                           203   4e-62   Cyanidioschyzon merolae strain 10D
gb|KJB36905.1|  hypothetical protein B456_006G184600                    202   4e-62   Gossypium raimondii
gb|EPZ32691.1|  40S ribosomal protein S4                                203   5e-62   Rozella allomycis CSF55
ref|XP_004484345.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    201   5e-62   
gb|AFM89946.1|  40S ribosomal protein S4                                203   5e-62   Callorhinchus milii [Australian ghost shark]
ref|XP_964251.2|  40S ribosomal protein S4                              203   5e-62   
ref|NP_001037257.1|  40S ribosomal protein S4                           203   5e-62   
sp|Q95V34.1|RS4_SPOFR  RecName: Full=40S ribosomal protein S4           203   5e-62   
gb|AFM90857.1|  40S ribosomal protein S4                                203   5e-62   
ref|XP_002599076.1|  hypothetical protein BRAFLDRAFT_81739              203   5e-62   
ref|XP_010758820.1|  40S ribosomal protein S4                           203   5e-62   
ref|XP_002794223.1|  40S ribosomal protein S4                           203   5e-62   
ref|XP_003651472.1|  40S ribosomal protein S4                           203   6e-62   
gb|ACY95325.1|  ribosomal protein S4                                    203   6e-62   
gb|AEL28856.1|  ribosomal protein S4                                    203   6e-62   
ref|XP_010989591.1|  PREDICTED: 40S ribosomal protein S4, X isoform     204   6e-62   
dbj|BAB29207.1|  unnamed protein product                                203   8e-62   
ref|XP_005706608.1|  40S ribosomal protein S4e                          203   8e-62   
emb|CDO92178.1|  unnamed protein product                                202   8e-62   
ref|XP_011380547.1|  PREDICTED: 40S ribosomal protein S4-like           202   9e-62   
ref|XP_004887478.1|  PREDICTED: 40S ribosomal protein S4-like iso...    203   9e-62   
gb|AFM89445.1|  40S ribosomal protein S4                                202   9e-62   
gb|ACD65137.1|  putative 40S ribosomal protein RPS4                     201   9e-62   
ref|XP_010383061.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    201   9e-62   
ref|XP_001222557.1|  40S ribosomal protein S4                           202   9e-62   
gb|AFM87151.1|  40S ribosomal protein S4                                202   9e-62   
gb|AFM86794.1|  40S ribosomal protein S4                                202   9e-62   
gb|AFM90836.1|  40S ribosomal protein S4                                202   1e-61   
gb|AFM90738.1|  40S ribosomal protein S4                                202   1e-61   
gb|AFM86034.1|  40S ribosomal protein S4                                202   1e-61   
gb|AFM90173.1|  40S ribosomal protein S4                                202   1e-61   
ref|XP_007889271.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    202   1e-61   
gb|ABF18051.1|  40S ribosomal protein S4                                202   1e-61   
gb|EAW71816.1|  ribosomal protein S4, X-linked, isoform CRA_b           201   1e-61   
gb|ABK30794.1|  ribosomal protein S4                                    202   1e-61   
gb|AFM90740.1|  40S ribosomal protein S4                                202   1e-61   
gb|AFM86071.1|  40S ribosomal protein S4                                202   1e-61   
gb|AFM88094.1|  40S ribosomal protein S4                                202   1e-61   
ref|XP_006923115.1|  PREDICTED: 40S ribosomal protein S4-like iso...    202   1e-61   
gb|KFA60798.1|  hypothetical protein S40285_07752                       202   1e-61   
ref|NP_001279537.1|  ribosomal protein S4, X-linked                     202   1e-61   
ref|NP_001233602.1|  40S ribosomal protein S4                           202   1e-61   
ref|XP_004887477.1|  PREDICTED: 40S ribosomal protein S4-like iso...    202   1e-61   
ref|XP_005701142.1|  PREDICTED: 40S ribosomal protein S4-like           202   1e-61   
gb|KEY68677.1|  hypothetical protein S7711_00551                        202   2e-61   
dbj|BAE22507.1|  unnamed protein product                                202   2e-61   
emb|CEJ90606.1|  Putative 40S ribosomal protein S4                      202   2e-61   
ref|XP_006908610.1|  PREDICTED: 40S ribosomal protein S4-like           202   2e-61   
ref|XP_009204777.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    202   2e-61   
ref|XP_004327034.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    202   2e-61   
ref|NP_001187069.1|  40S ribosomal protein S4                           202   2e-61   
ref|XP_010606265.1|  PREDICTED: 40S ribosomal protein S4, X isoform     202   2e-61   
ref|XP_010358394.1|  PREDICTED: 40S ribosomal protein S4-like           201   2e-61   
ref|XP_004015500.1|  PREDICTED: 40S ribosomal protein S4-like           201   2e-61   
gb|EHK42992.1|  hypothetical protein TRIATDRAFT_300975                  201   2e-61   
ref|XP_006910196.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    201   2e-61   
ref|XP_002112468.1|  conserved hypothetical protein                     201   2e-61   
ref|XP_004484344.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    201   3e-61   
ref|XP_007169373.1|  PREDICTED: 40S ribosomal protein S4-like           201   3e-61   
ref|XP_005885533.1|  PREDICTED: 40S ribosomal protein S4, X isoform     201   3e-61   
gb|AFM85695.1|  40S ribosomal protein S4                                201   3e-61   
ref|NP_000998.1|  40S ribosomal protein S4, X isoform X isoform         201   3e-61   
ref|XP_006926381.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    201   3e-61   
ref|XP_008954190.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    201   3e-61   
ref|XP_008069053.1|  PREDICTED: 40S ribosomal protein S4, X isoform     201   3e-61   
gb|AAV69397.1|  40S ribosomal protein S4                                201   3e-61   
ref|XP_006082927.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    201   3e-61   
ref|XP_003785255.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    201   3e-61   
ref|XP_008157005.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    201   3e-61   
gb|KDN64809.1|  putative ribosomal family S4e                           201   3e-61   
prf||1617101C  ribosomal protein S4                                     201   3e-61
ref|XP_006199437.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    201   3e-61   
ref|XP_003471039.1|  PREDICTED: 40S ribosomal protein S4, X isoform     201   3e-61   
gb|ELR52713.1|  40S ribosomal protein S4                                201   3e-61   
ref|XP_001907457.1|  hypothetical protein                               201   3e-61   
ref|XP_003660094.1|  hypothetical protein MYCTH_2297948                 201   3e-61   
ref|XP_005700707.1|  PREDICTED: 40S ribosomal protein S4-like           201   3e-61   
ref|NP_001005589.1|  40S ribosomal protein S4, X isoform                201   3e-61   
gb|AFM88708.1|  40S ribosomal protein S4                                201   3e-61   
ref|XP_003803397.1|  PREDICTED: 40S ribosomal protein S4, X isoform     201   4e-61   
ref|XP_003956128.1|  hypothetical protein KAFR_0B06960                  201   4e-61   
gb|ABQ18253.1|  ribosomal protein S4e                                   201   4e-61   
ref|XP_003347065.1|  40S ribosomal protein S4                           201   4e-61   
ref|XP_003957732.1|  hypothetical protein KAFR_0E04470                  201   4e-61   
ref|XP_005880123.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    202   4e-61   
emb|CAJ17168.1|  ribosomal protein S4e                                  201   4e-61   
ref|XP_004893287.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    201   4e-61   
gb|ACY71283.1|  ribosomal protein S4                                    201   4e-61   
ref|XP_969262.1|  PREDICTED: 40S ribosomal protein S4                   201   4e-61   
ref|XP_006685622.1|  ribosomal protein S4e                              201   4e-61   
gb|EPB85233.1|  40S ribosomal protein S4-A                              201   4e-61   
ref|XP_007242077.1|  PREDICTED: 40S ribosomal protein S4-like           201   4e-61   
gb|AFM87833.1|  40S ribosomal protein S4                                201   4e-61   
ref|XP_003721009.1|  40S ribosomal protein S4-A                         201   4e-61   
ref|XP_011300956.1|  PREDICTED: 40S ribosomal protein S4                201   4e-61   
emb|CEG70587.1|  Putative 40S ribosomal protein S4-A                    201   5e-61   
gb|EGE82775.1|  40S ribosomal protein S4                                202   5e-61   
ref|XP_009495182.1|  40S ribosomal protein S4                           201   5e-61   
ref|XP_007528658.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    201   5e-61   
gb|AFM90735.1|  40S ribosomal protein S4                                201   5e-61   
ref|XP_011122246.1|  hypothetical protein AOL_s00079g69                 201   5e-61   
gb|AFM89018.1|  40S ribosomal protein S4                                201   6e-61   
ref|XP_451697.1|  40S ribosomal protein S4                              201   6e-61   
gb|AJR59975.1|  Rps4ap                                                  200   6e-61   
ref|XP_003898985.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    200   7e-61   
gb|AFM87393.1|  40S ribosomal protein S4                                200   7e-61   
gb|AAP06482.1|  SJCHGC06323 protein                                     200   7e-61   
gb|AGH70188.1|  40S ribosomal protein S4                                200   7e-61   
ref|XP_002752965.2|  PREDICTED: 40S ribosomal protein S4, X isofo...    201   7e-61   
ref|XP_004777312.1|  PREDICTED: 40S ribosomal protein S4-like           200   7e-61   
gb|EAX02770.1|  ribosomal protein S4, Y-linked 1, isoform CRA_a         197   7e-61   
dbj|BAN20754.1|  ribosomal protein S4                                   200   7e-61   
emb|CAX76675.1|  ribosomal protein S4, X-linked                         200   7e-61   
ref|XP_002493655.1|  40S ribosomal protein S4                           201   7e-61   
ref|XP_009002753.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    200   7e-61   
ref|NP_012073.1|  ribosomal 40S subunit protein S4B                     200   7e-61   
ref|XP_003374555.1|  40S ribosomal protein S4                           200   7e-61   
ref|XP_001949785.1|  PREDICTED: 40S ribosomal protein S4                200   7e-61   
emb|CAX76676.1|  ribosomal protein S4, X-linked                         200   7e-61   
ref|XP_004181063.1|  hypothetical protein TBLA_0E04950                  200   7e-61   
ref|XP_007590516.1|  ribosomal family S4e                               200   8e-61   
gb|ELR61790.1|  hypothetical protein M91_18687                          201   8e-61   
emb|CEI97230.1|  Putative 40S ribosomal protein S4-A                    200   8e-61   
ref|XP_007991470.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    198   8e-61   
dbj|BAO40506.1|  40S ribosomal protein S4                               200   8e-61   
ref|XP_006102622.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    201   8e-61   
gb|KJB17112.1|  hypothetical protein B456_002G266000                    199   9e-61   
dbj|BAD96199.1|  ribosomal protein S4, X-linked X isoform variant       200   9e-61   
gb|KGB33723.1|  40S ribosomal protein S4                                200   9e-61   
ref|XP_002498034.1|  40S ribosomal protein S4                           200   9e-61   
gb|EGD95553.1|  40S ribosomal protein S4                                200   9e-61   
ref|XP_004605913.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    200   9e-61   
ref|XP_003237687.1|  40S ribosomal protein S4                           200   9e-61   
emb|CCF38284.1|  40S ribosomal protein S4                               200   9e-61   
gb|EZG03440.1|  40S ribosomal protein S4                                200   9e-61   
emb|CCX29556.1|  Similar to 40S ribosomal protein S4; acc. no. O5...    200   9e-61   
ref|NP_983705.1|  40S ribosomal protein S4                              200   1e-60   
ref|XP_006124705.1|  PREDICTED: 40S ribosomal protein S4-like           200   1e-60   
ref|XP_446360.1|  40S ribosomal protein S4                              200   1e-60   
ref|XP_005189699.1|  PREDICTED: 40S ribosomal protein S4                200   1e-60   
gb|KIN07653.1|  hypothetical protein OIDMADRAFT_16250                   200   1e-60   
ref|XP_002842984.1|  40S ribosomal protein S4                           200   1e-60   
emb|CAJ17169.1|  ribosomal protein S4e                                  200   1e-60   
gb|ABG34271.1|  40S ribosomal protein S4                                200   1e-60   
gb|KFM79678.1|  40S ribosomal protein S4                                199   1e-60   
ref|XP_004887479.1|  PREDICTED: 40S ribosomal protein S4-like iso...    200   1e-60   
ref|XP_007913637.1|  putative 40s ribosomal protein s4 protein          200   1e-60   
ref|XP_001625647.1|  predicted protein                                  200   1e-60   
ref|XP_006154441.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    198   1e-60   
ref|XP_005964326.1|  PREDICTED: 40S ribosomal protein S4-like iso...    199   1e-60   
ref|XP_003172932.1|  40S ribosomal protein S4                           199   1e-60   
ref|XP_004798077.1|  PREDICTED: 40S ribosomal protein S4-like           199   1e-60   
ref|XP_005898249.1|  PREDICTED: 40S ribosomal protein S4-like           199   1e-60   
ref|XP_005900947.1|  PREDICTED: 40S ribosomal protein S4-like           199   1e-60   
ref|XP_001747807.1|  hypothetical protein                               199   1e-60   
ref|XP_005147776.1|  PREDICTED: 40S ribosomal protein S4-like iso...    199   1e-60   
ref|XP_003672432.1|  ribosomal protein S4                               199   2e-60   
ref|XP_005313894.1|  PREDICTED: 40S ribosomal protein S4 isoform X2     199   2e-60   
ref|XP_004758473.1|  PREDICTED: LOW QUALITY PROTEIN: 40S ribosoma...    199   2e-60   
ref|NP_001075891.1|  40S ribosomal protein S4                           199   2e-60   
gb|ENN70158.1|  hypothetical protein YQE_00030                          196   2e-60   
ref|XP_006057394.1|  PREDICTED: 40S ribosomal protein S4-like           198   2e-60   
ref|XP_003669897.1|  ribosomal protein S4                               199   2e-60   
ref|XP_001365342.1|  PREDICTED: 40S ribosomal protein S4-like           199   2e-60   
ref|XP_003766510.1|  PREDICTED: 40S ribosomal protein S4-like iso...    199   2e-60   
ref|XP_001246620.1|  40S ribosomal protein S4                           199   2e-60   
ref|XP_003684132.1|  40S ribosomal protein S4                           199   2e-60   
gb|EHK22484.1|  hypothetical protein TRIVIDRAFT_84016                   199   2e-60   
gb|EXX69254.1|  ribosomal 40S subunit protein S4A                       198   2e-60   
ref|NP_001090472.1|  40S ribosomal protein S4                           199   2e-60   
ref|XP_011275622.1|  40S ribosomal protein                              199   2e-60   
ref|XP_002553456.1|  40S ribosomal protein S4                           199   2e-60   
ref|XP_006160168.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    199   2e-60   
ref|XP_006962266.1|  hypothetical protein TRIREDRAFT_74568              199   2e-60   
ref|XP_003673582.1|  hypothetical protein NCAS_0A06410                  199   2e-60   
gb|EHH30841.1|  Single copy abundant mRNA protein                       199   2e-60   
ref|XP_010565368.1|  PREDICTED: 40S ribosomal protein S4, X isoform     199   2e-60   
gb|EHH60989.1|  Single copy abundant mRNA protein                       199   2e-60   
gb|EPE05262.1|  40s ribosomal protein s4                                199   2e-60   
ref|XP_003678541.1|  hypothetical protein NCAS_0J02250                  199   2e-60   
dbj|GAA33707.2|  small subunit ribosomal protein S4e                    200   2e-60   
gb|AAB01670.1|  ribosomal protein S4                                    199   2e-60   
gb|EFB14527.1|  hypothetical protein PANDA_015068                       199   2e-60   
ref|XP_010356463.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    197   2e-60   
ref|XP_003204899.1|  PREDICTED: 40S ribosomal protein S4-like           199   2e-60   
gb|ACG49261.1|  40S ribosomal protein S4                                197   2e-60   
ref|NP_990439.1|  40S ribosomal protein S4                              199   2e-60   
gb|KHN98797.1|  ribosomal protein S4                                    199   2e-60   
ref|XP_003472052.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    199   2e-60   
ref|XP_007003999.1|  hypothetical protein TREMEDRAFT_43729              199   2e-60   
gb|ERL91296.1|  hypothetical protein D910_08629                         199   2e-60   
ref|XP_003648106.1|  hypothetical protein Ecym_7471                     199   2e-60   
gb|EFQ26693.1|  ribosomal family S4e                                    199   2e-60   
gb|EUB63197.1|  40S ribosomal protein S4                                199   2e-60   
gb|EPY50701.1|  40S ribosomal protein S4                                199   2e-60   
ref|XP_006822958.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    199   2e-60   
emb|CCK72874.1|  hypothetical protein KNAG_0M00210                      199   3e-60   
gb|AEE63224.1|  unknown                                                 199   3e-60   
emb|CAJ17164.1|  ribosomal protein S4e                                  199   3e-60   
sp|P79183.3|RS4Y1_MACFU  RecName: Full=40S ribosomal protein S4, ...    199   3e-60   
gb|EPY52081.1|  40S ribosomal protein S4                                199   3e-60   
gb|ACI69831.1|  40S ribosomal protein S4                                196   3e-60   
ref|XP_009438182.1|  PREDICTED: 40S ribosomal protein S4, Y isofo...    198   3e-60   
ref|XP_003680830.1|  40S ribosomal protein S4                           199   3e-60   
ref|XP_005894604.1|  PREDICTED: 40S ribosomal protein S4-like           199   3e-60   
gb|KFH43552.1|  40S ribosomal protein S4-like protein                   199   3e-60   
ref|XP_005992934.1|  PREDICTED: 40S ribosomal protein S4-like           199   3e-60   
ref|NP_001232240.1|  putative ribosomal protein S4                      199   3e-60   
ref|XP_003228681.1|  PREDICTED: 40S ribosomal protein S4                199   3e-60   
ref|NP_988912.1|  40S ribosomal protein S4                              199   3e-60   
ref|NP_001028160.1|  40S ribosomal protein S4, Y isoform 1              199   3e-60   
ref|XP_004080003.1|  PREDICTED: 40S ribosomal protein S4, X isoform     199   3e-60   
gb|EPY52214.1|  40S ribosomal protein S4                                199   3e-60   
ref|XP_002716797.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    199   3e-60   
ref|XP_005403497.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    199   3e-60   
gb|ETN60427.1|  40S ribosomal protein S4                                199   3e-60   
ref|XP_008433376.1|  PREDICTED: 40S ribosomal protein S4, X isoform     199   3e-60   
ref|NP_001084941.1|  40S ribosomal protein S4                           199   3e-60   
gb|EPS26877.1|  hypothetical protein PDE_01817                          199   3e-60   
ref|XP_004272428.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    199   3e-60   
gb|KDR20779.1|  40S ribosomal protein S4                                199   3e-60   
ref|XP_011153375.1|  PREDICTED: 40S ribosomal protein S4                199   3e-60   
gb|ESZ97229.1|  40S ribosomal protein S4                                199   3e-60   
gb|EPX72118.1|  40S ribosomal protein S4                                199   3e-60   
ref|XP_006888343.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    199   3e-60   
ref|XP_002175438.1|  40S ribosomal protein S4                           199   3e-60   



>ref|XP_010553233.1| PREDICTED: 40S ribosomal protein S4-3 isoform X2 [Tarenaya hassleriana]
Length=262

 Score =   269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/132 (96%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010529053.1| PREDICTED: 40S ribosomal protein S4-3-like [Tarenaya hassleriana]
Length=262

 Score =   268 bits (685),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLC+VRSVQFG
Sbjct  121  FKLCRVRSVQFG  132



>ref|XP_007211867.1| hypothetical protein PRUPE_ppa010094mg [Prunus persica]
 ref|XP_008225941.1| PREDICTED: 40S ribosomal protein S4-like [Prunus mume]
 gb|EMJ13066.1| hypothetical protein PRUPE_ppa010094mg [Prunus persica]
Length=264

 Score =   268 bits (685),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_007156130.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
 gb|ESW28124.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
Length=264

 Score =   268 bits (685),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_008383247.1| PREDICTED: 40S ribosomal protein S4 [Malus domestica]
 ref|XP_008364235.1| PREDICTED: 40S ribosomal protein S4 [Malus domestica]
 ref|XP_009363280.1| PREDICTED: 40S ribosomal protein S4 [Pyrus x bretschneideri]
Length=264

 Score =   268 bits (684),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_011084586.1| PREDICTED: 40S ribosomal protein S4 [Sesamum indicum]
 ref|XP_011095064.1| PREDICTED: 40S ribosomal protein S4 [Sesamum indicum]
Length=263

 Score =   268 bits (684),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|NP_001189539.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
 gb|AEC06617.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
Length=184

 Score =   265 bits (677),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_009368564.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=264

 Score =   268 bits (684),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|EYU41945.1| hypothetical protein MIMGU_mgv1a012043mg [Erythranthe guttata]
Length=263

 Score =   268 bits (684),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRH+LVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHILVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_008233807.1| PREDICTED: 40S ribosomal protein S4-1 [Prunus mume]
Length=264

 Score =   268 bits (684),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|NP_200650.1| 40S ribosomal protein S4-3 [Arabidopsis thaliana]
 sp|Q8VYK6.2|RS43_ARATH RecName: Full=40S ribosomal protein S4-3 [Arabidopsis thaliana]
 gb|AAL16117.1|AF428285_1 AT5g58420/mqj2_10 [Arabidopsis thaliana]
 gb|AAM64284.1| ribosomal protein S4-like [Arabidopsis thaliana]
 gb|AED97051.1| 40S ribosomal protein S4-3 [Arabidopsis thaliana]
Length=262

 Score =   268 bits (684),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_011097305.1| PREDICTED: 40S ribosomal protein S4-like [Sesamum indicum]
Length=263

 Score =   268 bits (684),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLMYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|NP_568179.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
 sp|P49204.4|RS42_ARATH RecName: Full=40S ribosomal protein S4-2 [Arabidopsis thaliana]
 emb|CAB87265.1| ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAK93610.1| putative 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL50106.1| AT5g07090/T28J14_30 [Arabidopsis thaliana]
 gb|AAL85148.1| putative 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAM10339.1| AT5g07090/T28J14_30 [Arabidopsis thaliana]
 gb|AAM61755.1| 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AED91107.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
Length=262

 Score =   267 bits (683),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_006851828.1| hypothetical protein AMTR_s00041p00058440 [Amborella trichopoda]
 gb|ERN13295.1| hypothetical protein AMTR_s00041p00058440 [Amborella trichopoda]
Length=268

 Score =   268 bits (684),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +1

Query  64   LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYAL  243
            ++ T ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RN+LKYAL
Sbjct  1    MAKTWARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNKLKYAL  60

Query  244  TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXD  423
            TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D
Sbjct  61   TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVKD  120

Query  424  EEAKFKLCKVRSVQFG  471
            EEAKFKLCKVRSVQFG
Sbjct  121  EEAKFKLCKVRSVQFG  136



>ref|XP_006288484.1| hypothetical protein CARUB_v10001743mg [Capsella rubella]
 ref|XP_010452659.1| PREDICTED: 40S ribosomal protein S4-3 [Camelina sativa]
 gb|EOA21382.1| hypothetical protein CARUB_v10001743mg [Capsella rubella]
Length=262

 Score =   267 bits (683),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_010243078.1| PREDICTED: 40S ribosomal protein S4-3-like [Nelumbo nucifera]
Length=265

 Score =   267 bits (683),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010491309.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   267 bits (683),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_006280972.1| hypothetical protein CARUB_v10026972mg [Capsella rubella]
 gb|EOA13870.1| hypothetical protein CARUB_v10026972mg [Capsella rubella]
Length=262

 Score =   267 bits (683),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_002884052.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60311.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=261

 Score =   267 bits (683),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|NP_565414.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
 sp|Q93VH9.1|RS41_ARATH RecName: Full=40S ribosomal protein S4-1 [Arabidopsis thaliana]
 gb|AAK43846.1|AF370469_1 Unknown protein [Arabidopsis thaliana]
 gb|AAK59636.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL34157.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL47338.1| unknown protein [Arabidopsis thaliana]
 gb|AAM60830.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AEC06616.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
Length=261

 Score =   267 bits (683),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_010515129.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
 ref|XP_010467507.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
 ref|XP_010489362.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
Length=262

 Score =   267 bits (682),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_006409322.1| hypothetical protein EUTSA_v10022813mg [Eutrema salsugineum]
 ref|XP_006411040.1| hypothetical protein EUTSA_v10017108mg [Eutrema salsugineum]
 gb|ESQ50775.1| hypothetical protein EUTSA_v10022813mg [Eutrema salsugineum]
 gb|ESQ52493.1| hypothetical protein EUTSA_v10017108mg [Eutrema salsugineum]
Length=262

 Score =   267 bits (682),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_006298349.1| hypothetical protein CARUB_v10014418mg [Capsella rubella]
 gb|EOA31247.1| hypothetical protein CARUB_v10014418mg [Capsella rubella]
Length=262

 Score =   267 bits (682),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_002275063.1| PREDICTED: 40S ribosomal protein S4 [Vitis vinifera]
Length=264

 Score =   267 bits (682),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|KCW60004.1| hypothetical protein EUGRSUZ_H02737 [Eucalyptus grandis]
Length=215

 Score =   265 bits (678),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010529903.1| PREDICTED: 40S ribosomal protein S4-3-like [Tarenaya hassleriana]
Length=262

 Score =   267 bits (682),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
             KLCKVRSVQFG
Sbjct  121  LKLCKVRSVQFG  132



>ref|XP_010453688.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   267 bits (682),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|NP_001235428.1| uncharacterized protein LOC100500000 [Glycine max]
 gb|ACU14556.1| unknown [Glycine max]
Length=205

 Score =   265 bits (677),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010423256.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=258

 Score =   266 bits (681),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>gb|AGZ15374.1| 40S ribosomal S4 protein [Phaseolus vulgaris]
Length=264

 Score =   266 bits (681),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|KDP30648.1| hypothetical protein JCGZ_16213 [Jatropha curcas]
Length=263

 Score =   266 bits (681),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|KDP45131.1| hypothetical protein JCGZ_17463 [Jatropha curcas]
Length=264

 Score =   266 bits (681),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010553232.1| PREDICTED: 40S ribosomal protein S4-3 isoform X1 [Tarenaya hassleriana]
Length=263

 Score =   266 bits (681),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 126/131 (96%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  79   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  258
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYREV
Sbjct  3    ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYREV  62

Query  259  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKF  438
            I+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAKF
Sbjct  63   IAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKF  122

Query  439  KLCKVRSVQFG  471
            KLCKVRSVQFG
Sbjct  123  KLCKVRSVQFG  133



>gb|KHN48586.1| 40S ribosomal protein S4-2 [Glycine soja]
Length=264

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_002871248.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47507.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KR+NAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRINAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_010934423.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=265

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_003544057.1| PREDICTED: 40S ribosomal protein S4-1 [Glycine max]
Length=264

 Score =   266 bits (681),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_006488578.1| PREDICTED: 40S ribosomal protein S4-like [Citrus sinensis]
 gb|KDO67005.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=265

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|AAL49933.1| AT5g58420/mqj2_10 [Arabidopsis thaliana]
 gb|AAN28773.1| At5g58420/mqj2_10 [Arabidopsis thaliana]
Length=262

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRL+YALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLEYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_003604568.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|AES86765.1| 40S ribosomal S4-like protein [Medicago truncatula]
Length=264

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_004294780.1| PREDICTED: 40S ribosomal protein S4-3 [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>dbj|BAE20168.1| ribosomal protein S4 [Panax ginseng]
Length=264

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VQSILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010243101.1| PREDICTED: 40S ribosomal protein S4-3-like [Nelumbo nucifera]
Length=264

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010276734.1| PREDICTED: 40S ribosomal protein S4-3 [Nelumbo nucifera]
Length=267

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_002864574.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40833.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEA+
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAQ  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_006399188.1| hypothetical protein EUTSA_v10014417mg [Eutrema salsugineum]
 gb|ESQ40641.1| hypothetical protein EUTSA_v10014417mg [Eutrema salsugineum]
Length=262

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVR++QFG
Sbjct  121  FKLCKVRTIQFG  132



>ref|XP_009369212.1| PREDICTED: 40S ribosomal protein S4-3 [Pyrus x bretschneideri]
Length=264

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_007218753.1| hypothetical protein PRUPE_ppa009337mg [Prunus persica]
 gb|EMJ19952.1| hypothetical protein PRUPE_ppa009337mg [Prunus persica]
Length=296

 Score =   267 bits (683),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  33   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  92

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  93   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEEAK  152

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  153  FKLCKVRSVQFG  164



>ref|XP_006576176.1| PREDICTED: uncharacterized protein LOC100500000 isoform X1 [Glycine 
max]
Length=264

 Score =   266 bits (680),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_003516980.1| PREDICTED: 40S ribosomal protein S4 [Glycine max]
Length=264

 Score =   266 bits (680),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|NP_001235826.1| 40S ribosomal S4 protein [Glycine max]
 gb|AAM93434.1| 40S ribosomal S4 protein [Glycine max]
 gb|ACU21252.1| unknown [Glycine max]
Length=264

 Score =   266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_003547932.1| PREDICTED: 40S ribosomal protein S4-1 [Glycine max]
 gb|KHN01598.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=264

 Score =   266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|EYU19705.1| hypothetical protein MIMGU_mgv1a012053mg [Erythranthe guttata]
Length=263

 Score =   266 bits (679),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_010907826.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=265

 Score =   265 bits (678),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>dbj|BAB11167.1| 40S ribosomal protein S4 [Arabidopsis thaliana]
Length=263

 Score =   265 bits (677),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  79   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  258
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV
Sbjct  3    ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  62

Query  259  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKF  438
            ISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAKF
Sbjct  63   ISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKF  122

Query  439  KLCKVRSVQFG  471
            KLCKVRS+QFG
Sbjct  123  KLCKVRSIQFG  133



>ref|XP_006429477.1| hypothetical protein CICLE_v10012499mg [Citrus clementina]
 ref|XP_006481102.1| PREDICTED: 40S ribosomal protein S4-2-like [Citrus sinensis]
 gb|ESR42717.1| hypothetical protein CICLE_v10012499mg [Citrus clementina]
 gb|KDO63239.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=262

 Score =   265 bits (677),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+L++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|KGN44410.1| hypothetical protein Csa_7G281390 [Cucumis sativus]
Length=264

 Score =   265 bits (677),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRSVQFG
Sbjct  121  YKLCKVRSVQFG  132



>ref|XP_008234249.1| PREDICTED: 40S ribosomal protein S4 [Prunus mume]
Length=265

 Score =   265 bits (677),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEE+K
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010443578.1| PREDICTED: 40S ribosomal protein S4-3-like isoform X1 [Camelina 
sativa]
 ref|XP_010443579.1| PREDICTED: 40S ribosomal protein S4-3-like isoform X2 [Camelina 
sativa]
Length=262

 Score =   265 bits (677),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_004150395.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 ref|XP_004160252.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
Length=264

 Score =   265 bits (676),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRSVQFG
Sbjct  121  YKLCKVRSVQFG  132



>ref|XP_009369565.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=264

 Score =   265 bits (676),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL +DTKGRFRLHSI DEEAK
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLFDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010483440.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   265 bits (676),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
             KLCKVRS+QFG
Sbjct  121  LKLCKVRSIQFG  132



>ref|XP_010938423.1| PREDICTED: 40S ribosomal protein S4-3 [Elaeis guineensis]
Length=265

 Score =   265 bits (676),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|KFK36724.1| hypothetical protein AALP_AA4G161500 [Arabis alpina]
Length=262

 Score =   265 bits (676),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/132 (95%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYGE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSISDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_002512717.1| 40S ribosomal protein S4, putative [Ricinus communis]
 gb|EEF50169.1| 40S ribosomal protein S4, putative [Ricinus communis]
Length=263

 Score =   265 bits (676),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D+EAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_004307685.1| PREDICTED: 40S ribosomal protein S4-like [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   265 bits (676),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSI DEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_007205728.1| hypothetical protein PRUPE_ppa010072mg [Prunus persica]
 gb|EMJ06927.1| hypothetical protein PRUPE_ppa010072mg [Prunus persica]
Length=265

 Score =   265 bits (676),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEE+K
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_003623356.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|AES79574.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AFK36229.1| unknown [Medicago truncatula]
Length=265

 Score =   265 bits (676),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_004293830.1| PREDICTED: 40S ribosomal protein S4-3 [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   265 bits (676),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>emb|CDY60025.1| BnaAnng16450D [Brassica napus]
Length=285

 Score =   265 bits (677),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = +1

Query  67   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  246
            +T MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT
Sbjct  21   ATHMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  80

Query  247  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDE  426
            YREVISILMQRH+ VDGKVRTDKTYPAGFMDV+SIPKTNENFRL YDTKGRFRLHSI DE
Sbjct  81   YREVISILMQRHIQVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDE  140

Query  427  EAKFKLCKVRSVQFG  471
            EAKFKLCKVR++Q G
Sbjct  141  EAKFKLCKVRTIQVG  155



>ref|XP_010676809.1| PREDICTED: 40S ribosomal protein S4-1-like [Beta vulgaris subsp. 
vulgaris]
Length=263

 Score =   264 bits (675),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRH+LVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHILVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRS+QFG
Sbjct  121  YKLCKVRSIQFG  132



>ref|XP_002515668.1| 40S ribosomal protein S4, putative [Ricinus communis]
 gb|EEF46720.1| 40S ribosomal protein S4, putative [Ricinus communis]
Length=263

 Score =   264 bits (675),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D+EAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010023674.1| PREDICTED: 40S ribosomal protein S4-3 [Eucalyptus grandis]
 gb|KCW60003.1| hypothetical protein EUGRSUZ_H02737 [Eucalyptus grandis]
Length=264

 Score =   264 bits (675),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_002276986.1| PREDICTED: 40S ribosomal protein S4-1 [Vitis vinifera]
Length=264

 Score =   264 bits (675),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRH+ VDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHIFVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|ACU24295.1| unknown [Glycine max]
Length=264

 Score =   264 bits (675),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKK++KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKYLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|AFK41206.1| unknown [Lotus japonicus]
Length=141

 Score =   259 bits (663),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YD KGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDIKGRFRLHSVRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_009393217.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   264 bits (675),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_002268192.1| PREDICTED: 40S ribosomal protein S4-3-like [Vitis vinifera]
Length=264

 Score =   264 bits (675),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKV+ VQFG
Sbjct  121  FKLCKVKGVQFG  132



>ref|XP_008454823.1| PREDICTED: 40S ribosomal protein S4-3 [Cucumis melo]
 ref|XP_008454824.1| PREDICTED: 40S ribosomal protein S4-3 [Cucumis melo]
Length=264

 Score =   264 bits (675),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKT+ENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_004163526.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 gb|KGN50688.1| hypothetical protein Csa_5G212590 [Cucumis sativus]
 gb|KGN50692.1| hypothetical protein Csa_5G215120 [Cucumis sativus]
Length=264

 Score =   264 bits (675),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKT+ENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010517120.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   264 bits (674),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>gb|AAS48726.1| ribosomal protein S4 [Zea mays]
Length=265

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH I DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_009391002.1| PREDICTED: 40S ribosomal protein S4-3 [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_009120350.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVR++Q G
Sbjct  121  FKLCKVRTIQVG  132



>ref|XP_009766580.1| PREDICTED: 40S ribosomal protein S4 [Nicotiana sylvestris]
Length=264

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_004511996.1| PREDICTED: 40S ribosomal protein S4-1-like [Cicer arietinum]
Length=264

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_002463552.1| hypothetical protein SORBIDRAFT_01g001850 [Sorghum bicolor]
 gb|EER90550.1| hypothetical protein SORBIDRAFT_01g001850 [Sorghum bicolor]
Length=264

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH I DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|NP_001266498.1| 40S ribosomal protein S4 [Zea mays]
 sp|O22424.1|RS4_MAIZE RecName: Full=40S ribosomal protein S4 [Zea mays]
 gb|AAB66899.1| ribosomal protein S4 type I [Zea mays]
 gb|ACF83328.1| unknown [Zea mays]
 gb|ACG30922.1| 40S ribosomal protein S4 [Zea mays]
 gb|ACG34655.1| 40S ribosomal protein S4 [Zea mays]
 gb|AFW67028.1| putative ribosomal protein S4 (RPS4A) family protein [Zea mays]
Length=265

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH I DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010037684.1| PREDICTED: 40S ribosomal protein S4-3-like [Eucalyptus grandis]
 gb|KCW49427.1| hypothetical protein EUGRSUZ_K02962 [Eucalyptus grandis]
Length=264

 Score =   263 bits (673),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_009354210.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=265

 Score =   264 bits (674),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPLVLI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLVLILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL +DTKGRFRLHSI DEEAK
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLFDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_004240421.1| PREDICTED: 40S ribosomal protein S4 [Solanum lycopersicum]
Length=264

 Score =   263 bits (673),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010036744.1| PREDICTED: 40S ribosomal protein S4-3-like [Eucalyptus grandis]
 gb|KCW88215.1| hypothetical protein EUGRSUZ_A00608 [Eucalyptus grandis]
Length=264

 Score =   263 bits (673),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_007141735.1| hypothetical protein PHAVU_008G221000g [Phaseolus vulgaris]
 ref|XP_007141738.1| hypothetical protein PHAVU_008G221300g [Phaseolus vulgaris]
 gb|ESW13729.1| hypothetical protein PHAVU_008G221000g [Phaseolus vulgaris]
 gb|ESW13732.1| hypothetical protein PHAVU_008G221300g [Phaseolus vulgaris]
Length=264

 Score =   263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKV+SVQFG
Sbjct  121  FKLCKVKSVQFG  132



>emb|CDY32986.1| BnaA10g11920D [Brassica napus]
Length=288

 Score =   264 bits (675),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  27   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  86

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  87   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  146

Query  436  FKLCKVRSVQFG  471
            FKLCKVR++Q G
Sbjct  147  FKLCKVRTIQVG  158



>ref|XP_009385022.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   263 bits (673),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_009132054.1| PREDICTED: 40S ribosomal protein S4-2-like [Brassica rapa]
Length=262

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVR++Q G
Sbjct  121  FKLCKVRTIQVG  132



>ref|NP_001275093.1| 40S ribosomal protein S4-like [Solanum tuberosum]
 gb|ABB72798.1| 40S ribosomal protein S4-like protein [Solanum tuberosum]
Length=264

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_006344073.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_003611879.1| 40S ribosomal protein S4 [Medicago truncatula]
 ref|XP_003628299.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|ACJ85463.1| unknown [Medicago truncatula]
 gb|AES94837.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AET02775.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AFK34966.1| unknown [Medicago truncatula]
 gb|AFK42812.1| unknown [Medicago truncatula]
 gb|KEH27546.1| 40S ribosomal S4-like protein [Medicago truncatula]
Length=265

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSVRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_008461463.1| PREDICTED: 40S ribosomal protein S4-3-like [Cucumis melo]
Length=264

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKT+ENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRSVQFG
Sbjct  121  YKLCKVRSVQFG  132



>emb|CDY57385.1| BnaCnng31910D [Brassica napus]
Length=298

 Score =   264 bits (675),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  37   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  96

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  97   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  156

Query  436  FKLCKVRSVQFG  471
            FKLCKVR++Q G
Sbjct  157  FKLCKVRTIQVG  168



>ref|NP_001275148.1| 40S ribosomal protein S4 [Solanum tuberosum]
 sp|P46300.1|RS4_SOLTU RecName: Full=40S ribosomal protein S4 [Solanum tuberosum]
 emb|CAA54095.1| ribosomal protein S4 [Solanum tuberosum]
Length=264

 Score =   263 bits (671),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_008461503.1| PREDICTED: 40S ribosomal protein S4-3-like [Cucumis melo]
Length=264

 Score =   263 bits (671),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKT+PAGFMD++SIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDILSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRSVQFG
Sbjct  121  YKLCKVRSVQFG  132



>ref|XP_004150397.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 ref|XP_004160251.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 gb|KGN44413.1| hypothetical protein Csa_7G282410 [Cucumis sativus]
Length=264

 Score =   263 bits (671),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKT+ENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRSVQFG
Sbjct  121  YKLCKVRSVQFG  132



>ref|XP_004492491.1| PREDICTED: 40S ribosomal protein S4-2-like [Cicer arietinum]
Length=264

 Score =   263 bits (671),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNKLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>emb|CDY14056.1| BnaC02g01730D [Brassica napus]
Length=291

 Score =   263 bits (673),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +1

Query  58   TQLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY  237
            ++ +  MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY
Sbjct  24   SETTANMARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKY  83

Query  238  ALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSI  417
            ALTYREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+
Sbjct  84   ALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSL  143

Query  418  XDEEAKFKLCKVRSVQFG  471
             DEEAKFKLCKVR++QFG
Sbjct  144  RDEEAKFKLCKVRTIQFG  161



>ref|XP_004491013.1| PREDICTED: 40S ribosomal protein S4-2-like [Cicer arietinum]
Length=265

 Score =   263 bits (671),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>emb|CDY05015.1| BnaAnng01970D [Brassica napus]
Length=305

 Score =   264 bits (674),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = +1

Query  58   TQLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY  237
            ++ +  MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY
Sbjct  38   SETTANMARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKY  97

Query  238  ALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSI  417
            ALTYREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI
Sbjct  98   ALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSI  157

Query  418  XDEEAKFKLCKVRSVQFG  471
             DEEAKFKLCKVR++QFG
Sbjct  158  RDEEAKFKLCKVRTIQFG  175



>ref|NP_001242281.1| uncharacterized protein LOC100812132 [Glycine max]
 gb|ACU23059.1| unknown [Glycine max]
Length=264

 Score =   262 bits (670),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLK ALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKCALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVIDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|KHN38535.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=264

 Score =   262 bits (670),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNA KHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNARKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010666843.1| PREDICTED: 40S ribosomal protein S4-1 [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   262 bits (670),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYAL YRE
Sbjct  1    MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALVYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNENFRL YD KGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDAKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVR+VQFG
Sbjct  121  FKLCKVRNVQFG  132



>ref|XP_009597091.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
Length=264

 Score =   262 bits (670),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VISILMQRQVMVDSKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_008789926.1| PREDICTED: 40S ribosomal protein S4-1 isoform X2 [Phoenix dactylifera]
Length=263

 Score =   262 bits (669),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKV+TD+TYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHVMVDGKVKTDRTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|ACU24626.1| unknown [Glycine max]
Length=264

 Score =   262 bits (669),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMD VSIPKTNENF L YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDAVSIPKTNENFHLLYDTKGRFRLHSVRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_002455614.1| hypothetical protein SORBIDRAFT_03g014380 [Sorghum bicolor]
 gb|EES00734.1| hypothetical protein SORBIDRAFT_03g014380 [Sorghum bicolor]
Length=265

 Score =   262 bits (669),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKT EN+RL YDTKGRFRLHS+ DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTGENYRLLYDTKGRFRLHSVRDEDAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|KFK27370.1| hypothetical protein AALP_AA8G374100 [Arabis alpina]
Length=262

 Score =   262 bits (669),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYGE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D EAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSISDVEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_002308235.1| hypothetical protein POPTR_0006s10460g [Populus trichocarpa]
 gb|EEE91758.1| hypothetical protein POPTR_0006s10460g [Populus trichocarpa]
Length=263

 Score =   262 bits (669),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_009381027.1| PREDICTED: 40S ribosomal protein S4-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   262 bits (669),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEE+K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|KHN00473.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=296

 Score =   263 bits (672),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  79   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  258
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREV
Sbjct  34   ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  93

Query  259  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKF  438
            I+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAKF
Sbjct  94   IAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVIDDEAKF  153

Query  439  KLCKVRSVQFG  471
            KLCKVRSVQFG
Sbjct  154  KLCKVRSVQFG  164



>ref|XP_006646768.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=265

 Score =   262 bits (669),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL SI DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSIKDEDAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010685909.1| PREDICTED: 40S ribosomal protein S4-1 [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   261 bits (668),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYAL YRE
Sbjct  1    MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALVYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNENFRL YD KGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDAKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVR+VQFG
Sbjct  121  FKLCKVRNVQFG  132



>ref|XP_009784493.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   262 bits (669),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VISILMQRQVMVDSKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_008356229.1| PREDICTED: 40S ribosomal protein S4-3-like [Malus domestica]
Length=269

 Score =   262 bits (669),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +1

Query  64   LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYAL  243
            ++  +ARGLKKH+KRLNAPKHWMLDKLGG FAPKPSSGPHK+RECLPLVLI+RNRLKYAL
Sbjct  1    MTEDLARGLKKHLKRLNAPKHWMLDKLGGXFAPKPSSGPHKARECLPLVLILRNRLKYAL  60

Query  244  TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXD  423
            TYREV+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL +DTKGRFRLHSI D
Sbjct  61   TYREVVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLFDTKGRFRLHSIRD  120

Query  424  EEAKFKLCKVRSVQFG  471
            EEAKFKLCKVRSVQFG
Sbjct  121  EEAKFKLCKVRSVQFG  136



>ref|XP_009125675.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   261 bits (668),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVR++QFG
Sbjct  121  FKLCKVRTIQFG  132



>ref|XP_006645886.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=285

 Score =   262 bits (670),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = +1

Query  64   LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYAL  243
            L T  ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYAL
Sbjct  17   LGTDAARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYAL  76

Query  244  TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXD  423
            TYREVISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S+ D
Sbjct  77   TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKD  136

Query  424  EEAKFKLCKVRSVQFG  471
            E+AKFKLCKVRSVQFG
Sbjct  137  EDAKFKLCKVRSVQFG  152



>ref|XP_011046821.1| PREDICTED: 40S ribosomal protein S4-3 [Populus euphratica]
Length=263

 Score =   261 bits (668),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_011035547.1| PREDICTED: 40S ribosomal protein S4-1 [Populus euphratica]
Length=263

 Score =   261 bits (668),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>gb|KFK25102.1| hypothetical protein AALP_AA8G066400 [Arabis alpina]
Length=262

 Score =   261 bits (668),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 124/132 (94%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYGE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D EAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSISDVEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_006374217.1| 40S ribosomal protein S4 [Populus trichocarpa]
 gb|ERP52014.1| 40S ribosomal protein S4 [Populus trichocarpa]
Length=263

 Score =   261 bits (668),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_009794044.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   261 bits (668),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRQVMVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_009402521.1| PREDICTED: 40S ribosomal protein S4-3-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   261 bits (668),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSV+FG
Sbjct  121  FKLCKVRSVRFG  132



>gb|AAX19871.1| putative ribosomal protein S4, partial [Doryanthes excelsa]
Length=131

 Score =   256 bits (655),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWML+KLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLNKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVMVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQF  468
            FKLCKVR+VQF
Sbjct  121  FKLCKVRNVQF  131



>ref|XP_006352980.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   261 bits (668),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_004233134.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
 ref|XP_004233136.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
 ref|XP_004233137.1| PREDICTED: 40S ribosomal protein S4 [Solanum lycopersicum]
Length=264

 Score =   261 bits (667),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_004233133.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
Length=264

 Score =   261 bits (667),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|ABK92450.1| unknown [Populus trichocarpa]
Length=263

 Score =   261 bits (667),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+ ++EAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_006411034.1| hypothetical protein EUTSA_v10017036mg [Eutrema salsugineum]
 gb|ESQ52487.1| hypothetical protein EUTSA_v10017036mg [Eutrema salsugineum]
Length=288

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/134 (93%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +1

Query  70   TTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTY  249
              MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECL LVLIIRN LKYALTY
Sbjct  25   ANMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLTLVLIIRNSLKYALTY  84

Query  250  REVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEE  429
            REVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEE
Sbjct  85   REVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEE  144

Query  430  AKFKLCKVRSVQFG  471
            AKFKLCKVRS+QFG
Sbjct  145  AKFKLCKVRSIQFG  158



>ref|XP_006401084.1| hypothetical protein EUTSA_v10014163mg [Eutrema salsugineum]
 gb|ESQ42537.1| hypothetical protein EUTSA_v10014163mg [Eutrema salsugineum]
Length=312

 Score =   263 bits (671),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 3/143 (2%)
 Frame = +1

Query  52   PNTQL---STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIR  222
            P ++L   +  MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIR
Sbjct  40   PGSELRLQTPNMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIR  99

Query  223  NRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRF  402
            NRLKYAL YREV+SILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRF
Sbjct  100  NRLKYALNYREVVSILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRF  159

Query  403  RLHSIXDEEAKFKLCKVRSVQFG  471
            RLHSI DEEAK+KLCKVR++QFG
Sbjct  160  RLHSIRDEEAKYKLCKVRTIQFG  182



>ref|XP_002323021.2| hypothetical protein POPTR_0016s13210g [Populus trichocarpa]
 gb|EEF04782.2| hypothetical protein POPTR_0016s13210g [Populus trichocarpa]
Length=263

 Score =   261 bits (667),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+ ++EAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_009600336.1| PREDICTED: 40S ribosomal protein S4 [Nicotiana tomentosiformis]
Length=264

 Score =   261 bits (667),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYGE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>emb|CAA75242.1| ribosomal protein S4 [Oryza sativa Japonica Group]
Length=268

 Score =   261 bits (667),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S+ DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>emb|CDY69841.1| BnaAnng31720D [Brassica napus]
Length=311

 Score =   263 bits (671),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = +1

Query  67   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  246
            +  MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT
Sbjct  47   TPNMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  106

Query  247  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDE  426
            YREVISILMQRH+ VDGKVRTDKTYPAGFMDV+SIPKTNENFRL YDTKGRFRLHSI DE
Sbjct  107  YREVISILMQRHIQVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDE  166

Query  427  EAKFKLCKVRSVQFG  471
            EAKFKLCKVR++Q G
Sbjct  167  EAKFKLCKVRTIQVG  181



>ref|NP_001043015.1| Os01g0358400 [Oryza sativa Japonica Group]
 dbj|BAD52963.1| putative 40S ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAF04929.1| Os01g0358400 [Oryza sativa Japonica Group]
 gb|EAY74000.1| hypothetical protein OsI_01884 [Oryza sativa Indica Group]
 gb|EAZ11863.1| hypothetical protein OsJ_01737 [Oryza sativa Japonica Group]
 gb|ABR25672.1| 40S ribosomal protein S4 [Oryza sativa Indica Group]
 dbj|BAG88133.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S+ DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|NP_001045624.1| Os02g0105900 [Oryza sativa Japonica Group]
 sp|P49398.3|RS4_ORYSJ RecName: Full=40S ribosomal protein S4; AltName: Full=SCAR protein 
SS620 [Oryza sativa Japonica Group]
 pdb|3J60|E Chain E, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD28085.1| putative ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAF07538.1| Os02g0105900 [Oryza sativa Japonica Group]
 gb|EAY84111.1| hypothetical protein OsI_05494 [Oryza sativa Indica Group]
 gb|EAZ21423.1| hypothetical protein OsJ_05027 [Oryza sativa Japonica Group]
 gb|ACA50490.1| 40S ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAG96339.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95549.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86872.1| 40S ribosomal protein S4 [Oryza sativa Japonica Group]
Length=265

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S+ DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|ACV70143.1| putative 40S ribosomal protein S4 [Jatropha curcas]
Length=264

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRL YALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLPYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLV GKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHVLVVGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|EPS63485.1| hypothetical protein M569_11297, partial [Genlisea aurea]
Length=262

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  79   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  258
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREV
Sbjct  1    ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  60

Query  259  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKF  438
            ISI+MQR VLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLH+I DEEAKF
Sbjct  61   ISIMMQRLVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHTIRDEEAKF  120

Query  439  KLCKVRSVQFG  471
            KLCKVRSVQFG
Sbjct  121  KLCKVRSVQFG  131



>ref|XP_010316939.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
Length=264

 Score =   261 bits (666),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VDGK+RTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VISILMQRQVMVDGKIRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_009595443.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
Length=264

 Score =   260 bits (665),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLH+I DEEAK
Sbjct  61   VIAILMQRQVMVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHAIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_008789925.1| PREDICTED: 40S ribosomal protein S4-1 isoform X1 [Phoenix dactylifera]
Length=319

 Score =   262 bits (670),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKV+TD+TYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VIAILMQRHVMVDGKVKTDRTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_009609731.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
 ref|XP_009764136.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   260 bits (664),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIIMRNRLKYALTYGE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VISILMQRLVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLMYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_006644163.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=265

 Score =   259 bits (663),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNKLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S+ DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_004962295.1| PREDICTED: 40S ribosomal protein S4-like [Setaria italica]
Length=262

 Score =   259 bits (663),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VDGKVRTDKTYP+GFMDVVSIPKT ENFRL YDTKGRFRLHSI D+EAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPSGFMDVVSIPKTGENFRLLYDTKGRFRLHSIRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_009122377.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   259 bits (663),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVR++Q G
Sbjct  121  FKLCKVRTIQVG  132



>ref|NP_001055342.1| Os05g0368300 [Oryza sativa Japonica Group]
 dbj|BAF17256.1| Os05g0368300 [Oryza sativa Japonica Group]
Length=263

 Score =   259 bits (662),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHV+VDGKVRTDKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI DE+AK
Sbjct  61   VISILMQRHVMVDGKVRTDKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_006352979.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   259 bits (662),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  436  FKLCKVRSVQFG  471
             KLCKVRSVQFG
Sbjct  121  LKLCKVRSVQFG  132



>emb|CDX99006.1| BnaC09g48290D [Brassica napus]
Length=288

 Score =   260 bits (665),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +1

Query  70   TTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTY  249
              MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTY
Sbjct  25   ANMARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTY  84

Query  250  REVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEE  429
            REVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEE
Sbjct  85   REVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEE  144

Query  430  AKFKLCKVRSVQFG  471
            AKFKLCKVR++Q G
Sbjct  145  AKFKLCKVRTIQVG  158



>gb|EPS70681.1| hypothetical protein M569_04077, partial [Genlisea aurea]
Length=256

 Score =   259 bits (662),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +1

Query  79   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  258
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREV
Sbjct  1    ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  60

Query  259  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKF  438
            ISI+MQR VLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLH+I DEE+KF
Sbjct  61   ISIMMQRLVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHTIRDEESKF  120

Query  439  KLCKVRSVQFG  471
            KLCKVRSVQFG
Sbjct  121  KLCKVRSVQFG  131



>gb|KDO67004.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=272

 Score =   259 bits (663),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 125/139 (90%), Positives = 129/139 (93%), Gaps = 7/139 (5%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  436  -------FKLCKVRSVQFG  471
                   FKLCKVRSVQFG
Sbjct  121  ALILLFQFKLCKVRSVQFG  139



>ref|XP_004960263.1| PREDICTED: 40S ribosomal protein S4-like [Setaria italica]
Length=265

 Score =   259 bits (662),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYAL YRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALNYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH I DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  436  FKLCKVRSVQFG  471
             KLCKVRSVQFG
Sbjct  121  TKLCKVRSVQFG  132



>ref|XP_007050962.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
 gb|EOX95119.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
Length=262

 Score =   259 bits (661),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_002322175.1| hypothetical protein POPTR_0015s09110g [Populus trichocarpa]
 gb|EEF06302.1| hypothetical protein POPTR_0015s09110g [Populus trichocarpa]
Length=263

 Score =   259 bits (661),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV VDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+ ++EAK
Sbjct  61   VIAILMQRHVFVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_007026596.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
 gb|EOY07098.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
Length=262

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|KHG30713.1| 40S ribosomal S4 [Gossypium arboreum]
Length=268

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/137 (88%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = +1

Query  61   QLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYA  240
            QL   +ARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYA
Sbjct  2    QLLGFLARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYA  61

Query  241  LTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIX  420
            LTYREVI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I 
Sbjct  62   LTYREVIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAIS  121

Query  421  DEEAKFKLCKVRSVQFG  471
             +E KFKLCKVRSVQFG
Sbjct  122  GDETKFKLCKVRSVQFG  138



>ref|XP_011019071.1| PREDICTED: 40S ribosomal protein S4-3-like [Populus euphratica]
Length=263

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 130/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKK+MKRL+APKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKNMKRLHAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>ref|XP_011046165.1| PREDICTED: 40S ribosomal protein S4-2-like [Populus euphratica]
Length=263

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV VDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+ ++EAK
Sbjct  61   VIAILMQRHVFVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  121  FKLCKVRSIQFG  132



>gb|KJB37999.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=262

 Score =   258 bits (659),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E+K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDESK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|NP_001288485.1| 40S ribosomal protein S4-like [Zea mays]
 gb|AAB67831.1| ribsomal protein S4 [Zea mays]
 gb|ACF87994.1| unknown [Zea mays]
 gb|ACG25377.1| 40S ribosomal protein S4 [Zea mays]
 gb|ACG45984.1| 40S ribosomal protein S4 [Zea mays]
 tpg|DAA52405.1| TPA: ribosomal protein S4 [Zea mays]
Length=265

 Score =   258 bits (659),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/132 (92%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYAL YRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALNYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRLH I DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTMENYRLLYDTKGRFRLHPIRDEDAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|KHG02041.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   258 bits (658),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_002318967.2| hypothetical protein POPTR_0013s01230g [Populus trichocarpa]
 gb|ABK94293.1| unknown [Populus trichocarpa]
 gb|EEE94890.2| hypothetical protein POPTR_0013s01230g [Populus trichocarpa]
Length=263

 Score =   258 bits (658),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALT RE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTGRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V++ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VLAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|KHG26321.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   257 bits (657),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|KJB71672.1| hypothetical protein B456_011G136800 [Gossypium raimondii]
Length=262

 Score =   257 bits (657),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|KHG02126.1| 40S ribosomal S4 [Gossypium arboreum]
 gb|KJB36904.1| hypothetical protein B456_006G184600 [Gossypium raimondii]
 gb|KJB77062.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=262

 Score =   257 bits (657),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_002439678.1| hypothetical protein SORBIDRAFT_09g018320 [Sorghum bicolor]
 gb|EES18108.1| hypothetical protein SORBIDRAFT_09g018320 [Sorghum bicolor]
Length=263

 Score =   257 bits (657),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VDGKVRTDKTYP+GFMDVVSIPKT ENFRL YDTKGRFRLHSI D+EAK
Sbjct  61   VISILMQRLVMVDGKVRTDKTYPSGFMDVVSIPKTGENFRLLYDTKGRFRLHSIRDDEAK  120

Query  436  FKLCKVRSVQFG  471
            FK+CKVRSVQFG
Sbjct  121  FKMCKVRSVQFG  132



>emb|CDX70008.1| BnaA10g23570D [Brassica napus]
Length=269

 Score =   257 bits (656),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +1

Query  58   TQLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY  237
            ++     ARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY
Sbjct  2    SECKILQARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKY  61

Query  238  ALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSI  417
            ALTYREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI
Sbjct  62   ALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSI  121

Query  418  XDEEAKFKLCKVRSVQFG  471
             DEEAKFKLCKVR++Q G
Sbjct  122  RDEEAKFKLCKVRTIQVG  139



>ref|XP_009130977.1| PREDICTED: 40S ribosomal protein S4-1-like [Brassica rapa]
Length=262

 Score =   256 bits (655),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 120/132 (91%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VIS LMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAK
Sbjct  61   VISSLMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVR++Q G
Sbjct  121  FKLCKVRTIQLG  132



>gb|EAY97774.1| hypothetical protein OsI_19685 [Oryza sativa Indica Group]
Length=279

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  79   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  258
            ARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYREV
Sbjct  18   ARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREV  77

Query  259  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKF  438
            ISILMQRHV+VDGKVRTDKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI DE+AKF
Sbjct  78   ISILMQRHVMVDGKVRTDKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAKF  137

Query  439  KLCKVRSVQFG  471
            KLCKVRSVQFG
Sbjct  138  KLCKVRSVQFG  148



>emb|CDX81032.1| BnaC03g02860D [Brassica napus]
Length=279

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  79   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  258
            ARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYREV
Sbjct  19   ARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYREV  78

Query  259  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKF  438
            ISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAKF
Sbjct  79   ISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKF  138

Query  439  KLCKVRSVQFG  471
            KLCKVR++Q G
Sbjct  139  KLCKVRTIQLG  149



>ref|XP_011023749.1| PREDICTED: 40S ribosomal protein S4-2-like [Populus euphratica]
Length=263

 Score =   256 bits (653),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/132 (90%), Positives = 129/132 (98%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALT RE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTGRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V++ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+ ++EAK
Sbjct  61   VLAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>emb|CDY58877.1| BnaA03g55550D [Brassica napus]
Length=279

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  79   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  258
            ARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYREV
Sbjct  19   ARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYREV  78

Query  259  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKF  438
            ISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAKF
Sbjct  79   ISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAKF  138

Query  439  KLCKVRSVQFG  471
            KLCKVR++Q G
Sbjct  139  KLCKVRTIQLG  149



>dbj|BAJ94984.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS49926.1| 40S ribosomal protein S4 [Triticum urartu]
 gb|EMT30796.1| 40S ribosomal protein S4 [Aegilops tauschii]
Length=265

 Score =   255 bits (651),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQRH++VDGKVRTDKTYPAGFMD++SIPKT EN+RL YDTKGRFRLHS+ DE+AK
Sbjct  61   VQSILMQRHIMVDGKVRTDKTYPAGFMDIISIPKTGENYRLLYDTKGRFRLHSVRDEDAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>emb|CDY02821.1| BnaC02g10680D [Brassica napus]
Length=275

 Score =   255 bits (651),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +1

Query  67   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  246
            + TM RGLKKH+KRLNAPK W LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALT
Sbjct  14   TPTMTRGLKKHLKRLNAPKIWGLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALT  73

Query  247  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDE  426
            YREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DE
Sbjct  74   YREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDE  133

Query  427  EAKFKLCKVRSVQFG  471
            EAKFKLCKVR++ FG
Sbjct  134  EAKFKLCKVRTISFG  148



>dbj|BAD22763.1| ribosomal protein [Bromus inermis]
Length=265

 Score =   254 bits (649),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQRH++VDGKVRTDKTYPAGFMD++SIPKT EN+RL YDTKGRFRLHS+ DE+AK
Sbjct  61   VQSILMQRHIMVDGKVRTDKTYPAGFMDIISIPKTGENYRLLYDTKGRFRLHSVRDEDAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRSVQFG
Sbjct  121  YKLCKVRSVQFG  132



>sp|P46299.1|RS4_GOSHI RecName: Full=40S ribosomal protein S4 [Gossypium hirsutum]
 emb|CAA55882.1| ribosomal protein, small subunit 4e (RS4e) [Gossypium hirsutum]
 gb|KJB17110.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=262

 Score =   254 bits (648),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 118/132 (89%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRF LH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFCLHAITGDETK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_010087529.1| 40S ribosomal protein S4 [Morus notabilis]
 gb|EXB29260.1| 40S ribosomal protein S4 [Morus notabilis]
Length=318

 Score =   255 bits (652),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 129/146 (88%), Gaps = 15/146 (10%)
 Frame = +1

Query  79   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  258
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREV
Sbjct  41   ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  100

Query  259  ISILMQRHVLVDGKVRTDKTYPAGFM---------------DVVSIPKTNENFRLFYDTK  393
            ISILMQRHVLVDGKVRTDKTYP+GFM               DVVSIPKTNENFRL YDTK
Sbjct  101  ISILMQRHVLVDGKVRTDKTYPSGFMVQVVVFFESNVTLVTDVVSIPKTNENFRLLYDTK  160

Query  394  GRFRLHSIXDEEAKFKLCKVRSVQFG  471
            GRFRLHSI D+EAKFKLCKVRSVQFG
Sbjct  161  GRFRLHSIRDDEAKFKLCKVRSVQFG  186



>gb|EEE63465.1| hypothetical protein OsJ_18278 [Oryza sativa Japonica Group]
Length=398

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  79   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  258
            ARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYREV
Sbjct  137  ARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREV  196

Query  259  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKF  438
            ISILMQRHV+VDGKVRTDKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI DE+AKF
Sbjct  197  ISILMQRHVMVDGKVRTDKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAKF  256

Query  439  KLCKVRSVQFG  471
            KLCKVRSVQFG
Sbjct  257  KLCKVRSVQFG  267



>gb|KHG30303.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   252 bits (644),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYP GFMDVVSIPKTNE+FRL YDTKGRF LH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPTGFMDVVSIPKTNEDFRLLYDTKGRFCLHAITGDETK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_003568916.1| PREDICTED: 40S ribosomal protein S4 [Brachypodium distachyon]
Length=265

 Score =   252 bits (644),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQR +LVDGKVRTDKTYPAGFMD++SIPKT EN+RL YDTKGRFRLHS+ DE++K
Sbjct  61   VQSILMQRQILVDGKVRTDKTYPAGFMDIISIPKTGENYRLLYDTKGRFRLHSVRDEDSK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>gb|EMT14698.1| 40S ribosomal protein S4 [Aegilops tauschii]
Length=259

 Score =   252 bits (643),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 127/132 (96%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWM++KLGGAFAPKPSSGPHK+RECLPL+L++RNRLKYALTY E
Sbjct  1    MARGLKKHVKRLNAPKHWMVEKLGGAFAPKPSSGPHKARECLPLILMLRNRLKYALTYSE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V+SI+MQRH++VDGKVRTDKTYPAGFMDVVSIPKT ENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VVSIMMQRHIMVDGKVRTDKTYPAGFMDVVSIPKTGENFRLLYDTKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVR+VQ G
Sbjct  121  FKLCKVRTVQCG  132



>emb|CDY32700.1| BnaA02g07620D [Brassica napus]
Length=301

 Score =   253 bits (645),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 119/133 (89%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +1

Query  73   TMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYR  252
            TMARGLKKH+KRLNAP  W LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYR
Sbjct  42   TMARGLKKHLKRLNAPTIWGLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYR  101

Query  253  EVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEA  432
            EVI+ILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE FRL YDTKGRFRLHSI DEEA
Sbjct  102  EVIAILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNECFRLLYDTKGRFRLHSIKDEEA  161

Query  433  KFKLCKVRSVQFG  471
            KFKLCKVR++ FG
Sbjct  162  KFKLCKVRTISFG  174



>gb|KJB29915.1| hypothetical protein B456_005G123400 [Gossypium raimondii]
Length=262

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/132 (88%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            M RGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MTRGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKT+E+FRL YDTKGRF LH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTSEDFRLLYDTKGRFCLHAITSDETK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  121  FKLCKVRSVQFG  132



>ref|XP_009126753.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X2 [Brassica 
rapa]
Length=319

 Score =   251 bits (641),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +1

Query  67   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  246
            + TMARGLKKH+KRLNAP  W LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALT
Sbjct  58   TPTMARGLKKHLKRLNAPTIWGLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALT  117

Query  247  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDE  426
            YREVI+ILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE FRL YDTKGRFRLHSI DE
Sbjct  118  YREVIAILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNECFRLLYDTKGRFRLHSIKDE  177

Query  427  EAKFKLCKVRSVQFG  471
            EAKFKLCKVR++ FG
Sbjct  178  EAKFKLCKVRTISFG  192



>ref|XP_009781828.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=259

 Score =   246 bits (628),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 124/132 (94%), Gaps = 5/132 (4%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPK+WMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKYWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VISILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS     AK
Sbjct  61   VISILMQRQVMVDSKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHS-----AK  115

Query  436  FKLCKVRSVQFG  471
            FKLCKVRS+QFG
Sbjct  116  FKLCKVRSIQFG  127



>gb|ABK22322.1| unknown [Picea sitchensis]
 gb|ABK22679.1| unknown [Picea sitchensis]
 gb|ACN39835.1| unknown [Picea sitchensis]
 gb|ACN40504.1| unknown [Picea sitchensis]
 gb|ACN40833.1| unknown [Picea sitchensis]
Length=263

 Score =   244 bits (623),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV++IRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKGRECLPLVVLIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+I+MQR + VDGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRFRLHSI DEEAK
Sbjct  61   VIAIVMQRLISVDGKVRTDKCYPAGFMDVLSIAKTNENFRLLYDAKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRSVQFG
Sbjct  121  YKLCKVRSVQFG  132



>gb|ABK21170.1| unknown [Picea sitchensis]
 gb|ABK22318.1| unknown [Picea sitchensis]
 gb|ABR17884.1| unknown [Picea sitchensis]
Length=263

 Score =   244 bits (623),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV++IRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKGRECLPLVVLIRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+I+MQR + VDGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRFRLHSI DEEAK
Sbjct  61   VIAIVMQRLISVDGKVRTDKCYPAGFMDVLSIAKTNENFRLLYDAKGRFRLHSIKDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRSVQFG
Sbjct  121  YKLCKVRSVQFG  132



>ref|XP_008810991.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008810992.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X2 [Phoenix 
dactylifera]
Length=130

 Score =   239 bits (609),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120



>ref|XP_001759591.1| predicted protein [Physcomitrella patens]
 gb|EDQ75503.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH+I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHNISAEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRS QFG
Sbjct  121  YKLCKVRSAQFG  132



>ref|XP_001759850.1| predicted protein [Physcomitrella patens]
 gb|EDQ75354.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH+I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHNISAEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRS QFG
Sbjct  121  YKLCKVRSAQFG  132



>ref|XP_001780588.1| predicted protein [Physcomitrella patens]
 gb|EDQ54571.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHHISAEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRS QFG
Sbjct  121  YKLCKVRSAQFG  132



>ref|XP_001751877.1| predicted protein [Physcomitrella patens]
 gb|EDQ83312.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH+I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHNISAEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRS QFG
Sbjct  121  YKLCKVRSAQFG  132



>ref|XP_001785339.1| predicted protein [Physcomitrella patens]
 gb|EDQ49851.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   234 bits (597),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHHISAEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVR+ QFG
Sbjct  121  YKLCKVRAAQFG  132



>sp|O81363.1|RS4_PRUAR RecName: Full=40S ribosomal protein S4 [Prunus armeniaca]
 gb|AAC24585.1| 40S ribosomal protein S4 [Prunus armeniaca]
Length=261

 Score =   233 bits (595),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 4/132 (3%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V+SILMQRH+LVDGK+     +     DVVSIPKTNENFRL YDTKGRFRLHSI DEE+K
Sbjct  61   VVSILMQRHILVDGKIH----FCIRLSDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  116

Query  436  FKLCKVRSVQFG  471
            FKLCKVRSVQFG
Sbjct  117  FKLCKVRSVQFG  128



>ref|XP_001766039.1| predicted protein [Physcomitrella patens]
 gb|EDQ69098.1| predicted protein [Physcomitrella patens]
Length=308

 Score =   235 bits (599),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHHISAEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRS QFG
Sbjct  121  YKLCKVRSAQFG  132



>ref|XP_009126752.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X1 [Brassica 
rapa]
Length=348

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 126/164 (77%), Gaps = 29/164 (18%)
 Frame = +1

Query  67   STTMARGLKKHMKRLNAPKHWMLDKLGGAF-----------------------------A  159
            + TMARGLKKH+KRLNAP  W LDKLGGAF                             A
Sbjct  58   TPTMARGLKKHLKRLNAPTIWGLDKLGGAFVCLLVSLYTHAFHLFIVWMTMLARIGSKQA  117

Query  160  PKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMD  339
            PKPSSGPHKSRECLPLVLIIRN+LKYALTYREVI+ILMQRH+ VDGKVRTDKTYPAGFMD
Sbjct  118  PKPSSGPHKSRECLPLVLIIRNKLKYALTYREVIAILMQRHIQVDGKVRTDKTYPAGFMD  177

Query  340  VVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            VVSIPKTNE FRL YDTKGRFRLHSI DEEAKFKLCKVR++ FG
Sbjct  178  VVSIPKTNECFRLLYDTKGRFRLHSIKDEEAKFKLCKVRTISFG  221



>emb|CDP06439.1| unnamed protein product [Coffea canephora]
Length=246

 Score =   230 bits (586),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVISILMQRH+LVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVISILMQRHILVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAKFKLCKVRSVQFG
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFG  114



>dbj|BAB10257.1| ribosomal protein S4 [Arabidopsis thaliana]
Length=244

 Score =   229 bits (585),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAKFKLCKVRS+QFG
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFG  114



>ref|NP_001031846.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
 gb|AED91108.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
Length=244

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/114 (96%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAKFKLCKVRS+QFG
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFG  114



>emb|CBI15899.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   229 bits (585),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAKFKLCKVRSVQFG
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFG  114



>gb|KDO67006.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=247

 Score =   228 bits (582),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVD KVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAKFKLCKVRSVQFG
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFG  114



>ref|XP_008778562.1| PREDICTED: 40S ribosomal protein S4-3-like [Phoenix dactylifera]
Length=247

 Score =   228 bits (582),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAKFKLCKVRSVQFG
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFG  114



>gb|KHN03095.1| 40S ribosomal protein S4 [Glycine soja]
Length=246

 Score =   228 bits (582),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEE+KFKLCKVRSVQFG
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESKFKLCKVRSVQFG  114



>gb|KDO63242.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=244

 Score =   228 bits (580),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/114 (94%), Positives = 112/114 (98%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPL+L++RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAKFKLCKVRSVQFG
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFG  114



>emb|CBI18118.3| unnamed protein product [Vitis vinifera]
Length=205

 Score =   226 bits (576),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAKFKLCKV+ VQFG
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVKGVQFG  114



>ref|XP_010509192.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=244

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/114 (95%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHSI DEEAKFKLCKVRS+QFG
Sbjct  61   DKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSIQFG  114



>emb|CBI25428.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHIFVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAKFKLCKVRSVQFG
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAKFKLCKVRSVQFG  114



>gb|KFK40122.1| hypothetical protein AALP_AA3G333200 [Arabis alpina]
Length=216

 Score =   224 bits (570),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIR+RLKYALTY EVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRDRLKYALTYSEVISILMQRHIQVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAKFKLCKVRS+QFG
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSIQFG  114



>gb|AAT38019.1| putative 40S ribosomal protein S4 [Oryza sativa Japonica Group]
Length=245

 Score =   223 bits (569),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYREVISILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREVISILMQRHVMVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI DE+AKFKLCKVRSVQFG
Sbjct  61   DKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAKFKLCKVRSVQFG  114



>gb|KHG11751.1| 40S ribosomal S4 [Gossypium arboreum]
Length=244

 Score =   222 bits (566),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E+KFKLCKVRSVQFG
Sbjct  61   DKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDESKFKLCKVRSVQFG  114



>gb|KJB38000.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=244

 Score =   222 bits (565),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E+KFKLCKVRSVQFG
Sbjct  61   DKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDESKFKLCKVRSVQFG  114



>gb|KJB77064.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=244

 Score =   221 bits (563),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E KFKLCKVRSVQFG
Sbjct  61   DKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETKFKLCKVRSVQFG  114



>gb|AGT17062.1| ribosomal protein S4 [Saccharum hybrid cultivar R570]
Length=141

 Score =   217 bits (553),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  64   LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYAL  243
            L +  ARGLKKH+KRLNAPKH MLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYAL
Sbjct  3    LFSEQARGLKKHLKRLNAPKHRMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYAL  62

Query  244  TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRL  408
            TYREVISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT+EN+RL YDTKGRF L
Sbjct  63   TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTDENYRLLYDTKGRFCL  117



>gb|KDD75424.1| hypothetical protein H632_c691p0 [Helicosporidium sp. ATCC 50920]
Length=262

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            M RG KKH+KRLNAPKHWMLDKLGG FAPKPSSGPHK+RECLPL+L++RNRLKYALT RE
Sbjct  1    MVRGPKKHLKRLNAPKHWMLDKLGGIFAPKPSSGPHKTRECLPLILMLRNRLKYALTGRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILM R V VDGKVRTDKTYP GFMDVV+IPKT+E+FRL YD+KGRF +H I  EEA 
Sbjct  61   VTSILMNRLVEVDGKVRTDKTYPVGFMDVVTIPKTSEHFRLIYDSKGRFAVHRITPEEAT  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+ +QFG
Sbjct  121  YKLCKVKRMQFG  132



>ref|XP_002984314.1| hypothetical protein SELMODRAFT_271698 [Selaginella moellendorffii]
 gb|EFJ14824.1| hypothetical protein SELMODRAFT_271698 [Selaginella moellendorffii]
Length=258

 Score =   220 bits (560),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            M RG KKH+K LNAPKHWML KLGGAFAPKPSSGPHK RECLPLV+++RNRL YALTYRE
Sbjct  1    MVRGPKKHLKVLNAPKHWMLSKLGGAFAPKPSSGPHKERECLPLVIVLRNRLNYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V++I+MQ+ + +DGKVRTDK YPAGFMDV+++ K +EN+RL YD+KGRF LHSI  EEAK
Sbjct  61   VVAIVMQKLISIDGKVRTDKCYPAGFMDVLTVGKVDENYRLLYDSKGRFTLHSINSEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVR+V+FG
Sbjct  121  FKLCKVRAVRFG  132



>ref|XP_002972484.1| hypothetical protein SELMODRAFT_148442 [Selaginella moellendorffii]
 gb|EFJ26570.1| hypothetical protein SELMODRAFT_148442 [Selaginella moellendorffii]
Length=258

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            M RG KKH+K LNAPKHWML KLGGAFAPKPSSGPHK RECLPLV+++RNRL YALTYRE
Sbjct  1    MVRGPKKHLKVLNAPKHWMLSKLGGAFAPKPSSGPHKERECLPLVIVLRNRLNYALTYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V++I+MQ+ + +DGKVRTDK YPAGFMDV+++ K +EN+RL YD+KGRF LHSI  EEAK
Sbjct  61   VVAIVMQKLISIDGKVRTDKCYPAGFMDVLTVGKVDENYRLLYDSKGRFTLHSINAEEAK  120

Query  436  FKLCKVRSVQFG  471
            FKLCKVR+V+FG
Sbjct  121  FKLCKVRAVRFG  132



>ref|XP_005850141.1| hypothetical protein CHLNCDRAFT_59606 [Chlorella variabilis]
 gb|EFN58039.1| hypothetical protein CHLNCDRAFT_59606 [Chlorella variabilis]
Length=261

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARG KKH+KRLNAPKHWMLDKLGG FAPKPS GPHK+RECLPL+L++RNRLKYALT +E
Sbjct  1    MARGPKKHLKRLNAPKHWMLDKLGGIFAPKPSPGPHKTRECLPLILLLRNRLKYALTGKE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQR V VDGKVRTDKTYP GFMDV+ IPKT+E+FRL YD KGRF +H I  EEA 
Sbjct  61   VTSILMQRLVEVDGKVRTDKTYPVGFMDVIDIPKTDEHFRLVYDAKGRFVVHRITKEEAS  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+ + FG
Sbjct  121  YKLCKVKRLAFG  132



>gb|KJB29916.1| hypothetical protein B456_005G123400 [Gossypium raimondii]
Length=244

 Score =   216 bits (549),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +1

Query  130  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  309
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  310  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DKTYPAGFMDVVSIPKT+E+FRL YDTKGRF LH+I  +E KFKLCKVRSVQFG
Sbjct  61   DKTYPAGFMDVVSIPKTSEDFRLLYDTKGRFCLHAITSDETKFKLCKVRSVQFG  114



>ref|XP_011402198.1| 40S ribosomal protein S4-3 [Auxenochlorella protothecoides]
 gb|KFM29145.1| 40S ribosomal protein S4-3 [Auxenochlorella protothecoides]
Length=263

 Score =   214 bits (545),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            M RG KKH+KRLNAPKHWMLDKLGG FAPKPS+GPHK+RECLPL+L++RNRLKYALT RE
Sbjct  1    MVRGPKKHLKRLNAPKHWMLDKLGGIFAPKPSAGPHKTRECLPLILLLRNRLKYALTGRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V++IL  R V VDGKVRTDKTYP GFMD ++IPKT+E+FRL YD KGRF +H I  EEA 
Sbjct  61   VVAILKNRLVQVDGKVRTDKTYPVGFMDTITIPKTDEHFRLVYDAKGRFVVHRISKEEAT  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+ +QFG
Sbjct  121  YKLCKVKRMQFG  132



>dbj|GAN07411.1| 40S ribosomal protein S4 [Mucor ambiguus]
 dbj|GAN00618.1| 40S ribosomal protein S4 [Mucor ambiguus]
Length=262

 Score =   214 bits (545),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARG KKHMKRL APKHWMLDKL GA+APKPSSGPHK RECLPL++ IRNRLKYAL  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGAYAPKPSSGPHKQRECLPLIVFIRNRLKYALNGRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQR V VDGKVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+ V  G
Sbjct  121  YKLCKVKKVLIG  132



>gb|EIE83303.1| 40S ribosomal protein S4 [Rhizopus delemar RA 99-880]
Length=263

 Score =   213 bits (542),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARG KKHMKRL APKHWMLDKL G++APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQR V VDGKVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+ V  G
Sbjct  121  YKLCKVKKVLIG  132



>emb|CEG70586.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
 emb|CEI95018.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
Length=263

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            M RG KKHMKRL APKHWMLDKL G +APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGNYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQR V VDGKVRTD T+PAGFMDV+S+ KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISVEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVR V  G
Sbjct  121  YKLCKVRKVMIG  132



>gb|KGG52703.1| hypothetical protein DI09_141p50 [Microsporidia sp. UGP3]
Length=261

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARG+KKH+KR+ APK WMLDKL G FAP+PS+GPHK RECLPL++ +RNRLKYALT +E
Sbjct  1    MARGIKKHLKRMAAPKSWMLDKLSGTFAPRPSTGPHKLRECLPLIVFLRNRLKYALTRKE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V+SILMQR V VD KVRTD TYPAGFMDV+SI KTNENFRL YDTKGRF +H I +EEAK
Sbjct  61   VMSILMQRLVKVDHKVRTDTTYPAGFMDVISIEKTNENFRLLYDTKGRFVIHRISEEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+  Q G
Sbjct  121  YKLCKVKKCQLG  132



>ref|XP_006576177.1| PREDICTED: uncharacterized protein LOC100500000 isoform X2 [Glycine 
max]
Length=248

 Score =   211 bits (537),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 107/116 (92%), Gaps = 2/116 (2%)
 Frame = +1

Query  130  MLDKLG--GAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKV  303
            ML   G   + APKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKV
Sbjct  1    MLQNTGCLTSLAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKV  60

Query  304  RTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            RTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEE+KFKLCKVRSVQFG
Sbjct  61   RTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESKFKLCKVRSVQFG  116



>gb|EIE90129.1| 40S ribosomal protein S4-A [Rhizopus delemar RA 99-880]
Length=262

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            M RG KKHMKRL APKHWMLDKL G++APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQR V VDGKVRTD T+PAGFMDV+S+ KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISVEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+ V  G
Sbjct  121  YKLCKVKKVMIG  132



>gb|EIE79548.1| 40S ribosomal protein S4-A [Rhizopus delemar RA 99-880]
Length=262

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            M RG KKHMKRL APKHWMLDKL G++APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQR V VDGKVRTD T+PAGFMDV+S+ KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISVEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+ V  G
Sbjct  121  YKLCKVKKVMIG  132



>emb|CEP14949.1| hypothetical protein [Parasitella parasitica]
Length=264

 Score =   211 bits (537),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            M RG KKHMKRL APKHWMLDKL G++APKPSSGPHK RECLPL++ IRNRLKYAL  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKQRECLPLIVFIRNRLKYALNGRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQR V VDGKVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+ V  G
Sbjct  121  YKLCKVKKVLVG  132



>gb|KFH71854.1| 40S ribosomal protein S4 [Mortierella verticillata NRRL 6337]
Length=259

 Score =   211 bits (536),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARG KKH+KRLNAPKHWMLDKL G +AP+P++GPHK RECLPLV++IRNRLKYAL  +E
Sbjct  1    MARGPKKHLKRLNAPKHWMLDKLTGTYAPRPTAGPHKLRECLPLVILIRNRLKYALNGKE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQR V VDGKVRTD TYPAGFMD ++I KT ENFRL YDTKGRF +H I  EEA+
Sbjct  61   VQSILMQRLVKVDGKVRTDSTYPAGFMDAITIEKTGENFRLVYDTKGRFTVHRITAEEAQ  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+ VQ G
Sbjct  121  YKLCKVKKVQLG  132



>ref|XP_002502247.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63505.1| predicted protein [Micromonas sp. RCC299]
Length=258

 Score =   211 bits (536),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            M RG KKH+KRLNAPKHWMLDKLGG FAPKPS+GPHK+RECLPL LI+RNRLKYALTY+E
Sbjct  1    MPRGPKKHLKRLNAPKHWMLDKLGGVFAPKPSAGPHKTRECLPLCLILRNRLKYALTYKE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V +ILMQR V VDGK R DK YPAGFMDVVSI KT+E+FRL YD KGRF +H I   EA+
Sbjct  61   VTTILMQRLVKVDGKTRVDKCYPAGFMDVVSIDKTDEHFRLIYDAKGRFVVHRISSTEAQ  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV++ + G
Sbjct  121  YKLCKVKTKRLG  132



>ref|XP_001421876.1| Ribosomal protein S4, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP00170.1| Ribosomal protein S4, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=253

 Score =   210 bits (535),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARGLKKH+KRLNAPKHWMLDKLGG FAPKPS GPHKSRECLPL LI+RNRLKYALTY+E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGVFAPKPSPGPHKSRECLPLCLILRNRLKYALTYKE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V +ILMQR V VDGK+R DK YP G MDVVSI K++E+FRL YD KGRF +H I   EA+
Sbjct  61   VTTILMQRVVKVDGKIRMDKCYPCGIMDVVSIEKSDEHFRLIYDNKGRFVVHRIEAIEAQ  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+S + G
Sbjct  121  YKLCKVKSKKLG  132



>gb|ABZ04256.1| ribosomal protein rps4 [Lineus viridis]
Length=153

 Score =   207 bits (526),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            M RG KKH+KRLNAPKHWMLDKL G FAPKPS GPHK RECLPL + +RNRLKYALTY E
Sbjct  1    MPRGPKKHLKRLNAPKHWMLDKLSGVFAPKPSCGPHKMRECLPLTIFLRNRLKYALTYDE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
             + I+MQR + VDGKVRTDK YPAGFMDVVSI KTNENFRL YD KGRF +H I  EEAK
Sbjct  61   CVKIVMQRLIKVDGKVRTDKNYPAGFMDVVSIEKTNENFRLIYDVKGRFAIHRITPEEAK  120

Query  436  FKLCKVRSV  462
            +KLCKV+ +
Sbjct  121  YKLCKVKKL  129



>ref|XP_006679983.1| hypothetical protein BATDEDRAFT_35382 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79221.1| hypothetical protein BATDEDRAFT_35382 [Batrachochytrium dendrobatidis 
JAM81]
Length=293

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = +1

Query  61   QLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYA  240
            +LS+   RG KKH+KRLNAPKHWMLDKL G +APKPS+GPHK+RECLPL++ IRNRL+YA
Sbjct  26   RLSSDNGRGPKKHLKRLNAPKHWMLDKLTGTWAPKPSAGPHKTRECLPLIVFIRNRLRYA  85

Query  241  LTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIX  420
            LT +E  +I+ QR + VDGKVRTD TYPAGFMDV+SI KT ENFRL YD KGRF +H I 
Sbjct  86   LTNQETKAIVNQRLIKVDGKVRTDMTYPAGFMDVISIEKTGENFRLIYDVKGRFTIHRIT  145

Query  421  DEEAKFKLCKVRSVQFG  471
            DEEAK+KLCKVR V+ G
Sbjct  146  DEEAKYKLCKVRQVKIG  162



>ref|XP_002954897.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ44096.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=261

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            M RG KKH+KRLNAP HWMLDKL G FAPKPS+GPHK RECLPL+LI+RNRLKYALT +E
Sbjct  1    MVRGPKKHLKRLNAPYHWMLDKLSGIFAPKPSAGPHKQRECLPLLLILRNRLKYALTGKE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQR V VDGKVRTD TYP GFMDV+SI KT+E+FRL  DTKGRF +H I  EEA 
Sbjct  61   VQSILMQRLVKVDGKVRTDHTYPTGFMDVISIEKTDEHFRLVLDTKGRFVVHRISKEEAA  120

Query  436  FKLCKVRSVQFG  471
            +KLC+VR VQFG
Sbjct  121  YKLCRVRKVQFG  132



>emb|CEI87363.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
Length=263

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARG KKHMKRL APKHWMLDKL G +APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGNYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQR V VDGKVRTD T+PAGFMDV+ I KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVIQIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+ V  G
Sbjct  121  YKLCKVKKVLIG  132



>gb|KDO63240.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=284

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/108 (92%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = +1

Query  148  GAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPA  327
            G  APKPSSGPHKSRECLPL+L++RNRLKYALTYREVI+ILMQRHVLVDGKVRTDKTYPA
Sbjct  47   GLQAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPA  106

Query  328  GFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            GFMDVVSIPKTNENFRL YDTKGRFRLHS+ DEEAKFKLCKVRSVQFG
Sbjct  107  GFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFG  154



>emb|CEG72922.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
 emb|CEI90971.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
Length=263

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARG KKHMKRL APKHWMLDKL G +APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGNYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQR V VDGKVRTD T+PAGFMDV+ I KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVIQIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+ V  G
Sbjct  121  YKLCKVKKVLVG  132



>ref|XP_009022208.1| hypothetical protein HELRODRAFT_185809 [Helobdella robusta]
 gb|ESN99868.1| hypothetical protein HELRODRAFT_185809 [Helobdella robusta]
Length=190

 Score =   207 bits (527),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            M RG +KH+KR+ APKHWMLDKLGG FAP+PS GPHK RECLPLV+ +RNRLKYALTY E
Sbjct  1    MVRGPRKHLKRVVAPKHWMLDKLGGVFAPRPSCGPHKLRECLPLVIFLRNRLKYALTYEE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V  IL QR V VDGKVRTDKTYPAGFMDV+SI +TNENFRL YD KGRF +H I  EEAK
Sbjct  61   VKKILKQRLVKVDGKVRTDKTYPAGFMDVISIERTNENFRLIYDAKGRFAVHRIQSEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+ +  G
Sbjct  121  YKLCKVKKILIG  132



>ref|XP_001691218.1| ribosomal protein S4, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDP04951.1| ribosomal protein S4 [Chlamydomonas reinhardtii]
Length=261

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            M RG KKH+KRLNAP HWMLDKL G FAPKPS+GPHK RECLPL+LI+RNRLKYALT +E
Sbjct  1    MVRGPKKHLKRLNAPYHWMLDKLSGIFAPKPSAGPHKQRECLPLLLILRNRLKYALTGKE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V SILMQR V VDGKVRTD TYP GFMDV+S+ KT+ENFRL  DTKGRF +H I  EEA 
Sbjct  61   VQSILMQRLVKVDGKVRTDHTYPTGFMDVISMEKTDENFRLVLDTKGRFVVHRISKEEAA  120

Query  436  FKLCKVRSVQFG  471
            +KLC+VR V+FG
Sbjct  121  YKLCRVRKVEFG  132



>gb|KDO63241.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=254

 Score =   209 bits (531),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/105 (93%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  157  APKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFM  336
            APKPSSGPHKSRECLPL+L++RNRLKYALTYREVI+ILMQRHVLVDGKVRTDKTYPAGFM
Sbjct  20   APKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFM  79

Query  337  DVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAKFKLCKVRSVQFG  471
            DVVSIPKTNENFRL YDTKGRFRLHS+ DEEAKFKLCKVRSVQFG
Sbjct  80   DVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFG  124



>gb|EQL02576.1| Ribosomal protein S4e [Ophiocordyceps sinensis CO18]
Length=258

 Score =   209 bits (531),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARG+KKH KRL+AP HW+LDKL G +APKPS+GPHK R+C+PL++ IRNRLKYAL YRE
Sbjct  1    MARGIKKHQKRLSAPSHWLLDKLSGVYAPKPSAGPHKLRDCMPLIVFIRNRLKYALNYRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
              +ILMQR V VDGKVRTD TYPAGFMDV++I KT ENFRL YDTKGRF +H I  EEA+
Sbjct  61   TKAILMQRLVKVDGKVRTDMTYPAGFMDVITIDKTGENFRLIYDTKGRFTVHRIQTEEAE  120

Query  436  FKLCKVRSVQFG  471
            +KLCKV+ VQ G
Sbjct  121  YKLCKVKRVQLG  132



>emb|CEG00570.1| Ribosomal protein S4e [Ostreococcus tauri]
Length=254

 Score =   208 bits (530),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARG KKH+KRLNAPKHWMLDKLGG FAPKPS GPHK RECLPL LI+RNRLKYALTY+E
Sbjct  1    MARGPKKHLKRLNAPKHWMLDKLGGVFAPKPSPGPHKQRECLPLCLILRNRLKYALTYKE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V +ILMQR V VDGK+R DK +P G MDVVSI K++E+FRL YDTKGRF +H I   EA+
Sbjct  61   VTTILMQRCVKVDGKIRMDKCFPCGIMDVVSIEKSDEHFRLIYDTKGRFVVHRIEAVEAQ  120

Query  436  FKLCKVRSVQFG  471
            +KLCKVRS + G
Sbjct  121  YKLCKVRSKKLG  132



>ref|XP_007872809.1| hypothetical protein PNEG_00898 [Pneumocystis murina B123]
 gb|EMR10749.1| hypothetical protein PNEG_00898 [Pneumocystis murina B123]
Length=261

 Score =   208 bits (530),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARG +KHMKR+NAP HW+LDKLGG +AP+PS GPHK R+CLPL++ +RNRLKYAL  RE
Sbjct  1    MARGPRKHMKRINAPSHWLLDKLGGTYAPRPSPGPHKLRDCLPLIIFLRNRLKYALNNRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
             I+ILMQR + VDGKVRTD TYPAGFMDV+SI KT ENFRL YDTKGRF +H I   EAK
Sbjct  61   TIAILMQRLIKVDGKVRTDHTYPAGFMDVISIEKTGENFRLVYDTKGRFTIHRITSTEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLCK++ +Q G
Sbjct  121  YKLCKIKKIQLG  132



>emb|CDH52779.1| 40s ribosomal protein s4 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=263

 Score =   208 bits (529),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  255
            MARG KKHMKRLNAPKHWMLDKL G++APKPS+GPHK+RECLPL++ +RNRLKYAL  RE
Sbjct  1    MARGPKKHMKRLNAPKHWMLDKLLGSYAPKPSAGPHKTRECLPLIIFLRNRLKYALNGRE  60

Query  256  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIXDEEAK  435
            V +ILMQR V VD KVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQAILMQRLVKVDHKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAIHRITDEEAK  120

Query  436  FKLCKVRSVQFG  471
            +KLC+V+ +  G
Sbjct  121  YKLCRVKKITIG  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554587825180