BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF047A21

Length=458
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006353939.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    102   9e-23   Solanum tuberosum [potatoes]
ref|XP_004235401.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...    102   1e-22   Solanum lycopersicum
ref|XP_009792116.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  99.8    7e-22   Nicotiana sylvestris
ref|XP_009630493.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  90.9    1e-18   Nicotiana tomentosiformis
ref|XP_011072066.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  79.0    2e-14   Sesamum indicum [beniseed]
ref|XP_010088395.1|  E3 ubiquitin-protein ligase RING1                78.6    3e-14   Morus notabilis
emb|CDO98567.1|  unnamed protein product                              77.4    7e-14   Coffea canephora [robusta coffee]
ref|XP_008240345.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  77.0    9e-14   Prunus mume [ume]
ref|XP_007209333.1|  hypothetical protein PRUPE_ppa008345mg           76.3    1e-13   
ref|XP_008346897.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  75.5    4e-13   Malus domestica [apple tree]
ref|XP_002317728.2|  hypothetical protein POPTR_0012s03370g           73.9    4e-13   
ref|XP_009357359.1|  PREDICTED: E3 ubiquitin-protein ligase RING1     73.2    9e-13   Pyrus x bretschneideri [bai li]
emb|CBI35278.3|  unnamed protein product                              73.6    2e-12   Vitis vinifera
ref|XP_009355932.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  73.2    3e-12   Pyrus x bretschneideri [bai li]
ref|XP_011003690.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  71.6    5e-12   Populus euphratica
ref|XP_011086955.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  72.0    7e-12   Sesamum indicum [beniseed]
ref|XP_003634328.1|  PREDICTED: E3 ubiquitin-protein ligase RING1     71.6    7e-12   Vitis vinifera
emb|CAN79596.1|  hypothetical protein VITISV_042386                   71.6    8e-12   Vitis vinifera
ref|XP_008393509.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  71.2    1e-11   Malus domestica [apple tree]
ref|XP_006495422.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.8    2e-11   
gb|EYU17802.1|  hypothetical protein MIMGU_mgv1a008418mg              70.5    2e-11   Erythranthe guttata [common monkey flower]
ref|XP_006441411.1|  hypothetical protein CICLE_v10020902mg           70.1    3e-11   Citrus clementina [clementine]
gb|KDO48740.1|  hypothetical protein CISIN_1g0186891mg                69.7    3e-11   Citrus sinensis [apfelsine]
ref|XP_010246216.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  69.7    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_003534093.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  69.7    4e-11   Glycine max [soybeans]
gb|ACT21194.1|  zinc finger protein                                   68.6    7e-11   Carica papaya [mamon]
ref|XP_006493415.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  68.6    9e-11   Citrus sinensis [apfelsine]
ref|XP_003549174.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.8    2e-10   Glycine max [soybeans]
ref|XP_008467256.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    3e-10   Cucumis melo [Oriental melon]
ref|XP_010249658.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.0    3e-10   Nelumbo nucifera [Indian lotus]
ref|XP_006374275.1|  hypothetical protein POPTR_0015s05600g           62.4    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011047757.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  60.5    5e-08   Populus euphratica
ref|XP_004299466.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  60.5    6e-08   Fragaria vesca subsp. vesca
ref|XP_007152550.1|  hypothetical protein PHAVU_004G139600g           59.7    1e-07   Phaseolus vulgaris [French bean]
gb|EYU22293.1|  hypothetical protein MIMGU_mgv1a006235mg              58.9    2e-07   Erythranthe guttata [common monkey flower]
ref|XP_004137524.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  58.5    3e-07   Cucumis sativus [cucumbers]
ref|XP_010935556.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  58.2    4e-07   Elaeis guineensis
gb|EYU29041.1|  hypothetical protein MIMGU_mgv1a026532mg              55.5    7e-07   Erythranthe guttata [common monkey flower]
ref|XP_011070454.1|  PREDICTED: E3 ubiquitin-protein ligase RING1     57.0    7e-07   Sesamum indicum [beniseed]
emb|CDP18533.1|  unnamed protein product                              54.3    5e-06   Coffea canephora [robusta coffee]
ref|XP_004515274.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  54.3    6e-06   Cicer arietinum [garbanzo]
ref|XP_010687250.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  54.3    7e-06   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS73974.1|  hypothetical protein M569_00782                       53.5    9e-06   Genlisea aurea
ref|XP_008803049.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  53.5    1e-05   Phoenix dactylifera
ref|XP_010069512.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  53.9    1e-05   Eucalyptus grandis [rose gum]
ref|XP_010322969.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  52.0    3e-05   Solanum lycopersicum
gb|KFM59559.1|  hypothetical protein X975_00622                       49.3    5e-05   Stegodyphus mimosarum
ref|XP_009788594.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  49.7    2e-04   Nicotiana sylvestris
ref|XP_008811090.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  49.7    2e-04   Phoenix dactylifera
ref|XP_010940373.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  48.9    4e-04   Elaeis guineensis



>ref|XP_006353939.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum tuberosum]
Length=387

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 73/125 (58%), Gaps = 9/125 (7%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ+Y CY CE+TVTITP PNSEL CPNCNG FLEE+ETA    PSN NP      +    
Sbjct  17   PQNYHCYQCEQTVTITPSPNSELSCPNCNGTFLEESETA---PPSNPNPNTHPFFSAATT  73

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAA------GRSPNQFHPLLFLQN  442
                 G G        + + +GG +  DDLSALFGGMA       GRSPNQF P  FL N
Sbjct  74   DDLPFGGGFPIVFSSNAASPAGGAVGFDDLSALFGGMAGGSAALPGRSPNQFDPFAFLNN  133

Query  443  YLQTM  457
            Y  +M
Sbjct  134  YFSSM  138



>ref|XP_004235401.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_004235402.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_010318345.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
 ref|XP_010318346.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=383

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 73/125 (58%), Gaps = 9/125 (7%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ+Y CY CE+TVTITP PNSEL CPNCNG FLEE+ETA    PSN NP      +    
Sbjct  17   PQNYHCYQCEQTVTITPSPNSELSCPNCNGTFLEESETA---PPSNPNPNTHPFFSAATT  73

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAA------GRSPNQFHPLLFLQN  442
                 G G        + + +GG +  DDLSALFGGMA       GRSPNQF P  FL N
Sbjct  74   DDLPFGGGFPIVFSSNAASPAGGAVGFDDLSALFGGMAGGSAALPGRSPNQFDPFAFLNN  133

Query  443  YLQTM  457
            Y  +M
Sbjct  134  YFSSM  138



>ref|XP_009792116.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
 ref|XP_009792117.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
sylvestris]
Length=398

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 75/127 (59%), Gaps = 8/127 (6%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ+Y CY CE+TVTITP PNSEL CPNCNG FLEE+ETAPP +  NN   FP   A    
Sbjct  21   PQNYHCYQCEQTVTITPSPNSELTCPNCNGTFLEESETAPPPSNPNNPDNFPFFSAATTD  80

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAA--------GRSPNQFHPLLFL  436
                GG G        + + +GG +A DDLSAL  G+A          RSPNQF P  FL
Sbjct  81   DLPFGGGGFPIVFSSSAASPAGGAVAFDDLSALLSGIAGGAGGAAFPSRSPNQFDPFAFL  140

Query  437  QNYLQTM  457
             NY+ TM
Sbjct  141  NNYMSTM  147



>ref|XP_009630493.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nicotiana 
tomentosiformis]
Length=399

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 76/127 (60%), Gaps = 8/127 (6%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ+Y CY CE+TVTITP PNSEL CPNCNG FLEE+ETAPP +  NN   FP   A    
Sbjct  21   PQNYHCYQCEQTVTITPSPNSELTCPNCNGTFLEESETAPPPSNPNNPDNFPFFSAATTD  80

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAA--------GRSPNQFHPLLFL  436
                GG G        + + +GG +ALDDLSAL  G++          RSP+QF P  FL
Sbjct  81   DLPFGGGGFPIAFSSSAASPAGGAVALDDLSALLSGISGGAGGAAFPSRSPHQFDPFAFL  140

Query  437  QNYLQTM  457
             NY+ TM
Sbjct  141  NNYVSTM  147



>ref|XP_011072066.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=380

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 70/121 (58%), Gaps = 6/121 (5%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITP--LPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafp  274
            P+ YFCY CER VTI P   P +ELVCP+C G FLEE+ETAPP+NP N        D FP
Sbjct  19   PRQYFCYQCERQVTIAPPLSPTAELVCPDCQGGFLEESETAPPSNPENPISNPFLPDNFP  78

Query  275  fgfgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQT  454
               G             FS +S GGG   DDLSALFG     RSPN+F+P  FL NY+  
Sbjct  79   SLGGFPIIFSSAPGASAFSVSSGGGGGGFDDLSALFG----PRSPNEFNPFAFLNNYINN  134

Query  455  M  457
            +
Sbjct  135  L  135



>ref|XP_010088395.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
 gb|EXC35976.1| E3 ubiquitin-protein ligase RING1 [Morus notabilis]
Length=378

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 64/123 (52%), Gaps = 8/123 (7%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ YFC+ C RTV+ITP P S+LVCP C G FLEE +        +  P      +F   
Sbjct  18   PQPYFCHQCNRTVSITPSPTSDLVCPVCGGGFLEEVQNP----NPSPEPSPNSFFSFSSD  73

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGG----MAAGRSPNQFHPLLFLQNYL  448
                G  G        S++  GGG  +DDL ALFGG    ++     + F+P  FLQNYL
Sbjct  74   DSSFGARGFPLLFTTTSSSGHGGGALVDDLPALFGGPLTRVSQSEDTDAFNPFAFLQNYL  133

Query  449  QTM  457
            QT+
Sbjct  134  QTL  136



>emb|CDO98567.1| unnamed protein product [Coffea canephora]
Length=391

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 75/123 (61%), Gaps = 7/123 (6%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPN--SELVCPNCNGNFLEEAETApptnpsnnnpffpgadafp  274
            PQ+YFCY C+RTVTI+P P+  SELVCPNC+G FLEE+E+A                   
Sbjct  21   PQNYFCYQCQRTVTISPSPSPTSELVCPNCHGGFLEESESADEPPSPPAVGPDLFFPPIF  80

Query  275  fgfgggggvggggeglvfSTASSGGGIALDDLSALFGGMAA--GRSPNQFHPLLFLQNYL  448
             G GGGGG GGG   +  S++  GG I   DLSALFGG A    +SPN+F+P  FL NYL
Sbjct  81   GGGGGGGGGGGGFPVIFSSSSGGGGEI---DLSALFGGAAGYPAQSPNEFNPFAFLNNYL  137

Query  449  QTM  457
              +
Sbjct  138  NNL  140



>ref|XP_008240345.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Prunus mume]
Length=381

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 66/123 (54%), Gaps = 13/123 (11%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ YFC+ C+RTV++ P P S+LVCP C+G F+EE ET        N  F   +   P  
Sbjct  18   PQLYFCHQCDRTVSLNPPPTSDLVCPICSGGFVEEMETPNSNPFPPNPFFSVPSSDAPPF  77

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQ----FHPLLFLQNYL  448
               G  +           ++ G G   DDLSALFGG  A  SP Q    F+P +FLQNYL
Sbjct  78   ASSGFPLLF---------SAPGPGNFSDDLSALFGGAPARSSPFQDPDAFNPFVFLQNYL  128

Query  449  QTM  457
            QT+
Sbjct  129  QTL  131



>ref|XP_007209333.1| hypothetical protein PRUPE_ppa008345mg [Prunus persica]
 gb|EMJ10532.1| hypothetical protein PRUPE_ppa008345mg [Prunus persica]
Length=336

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 67/123 (54%), Gaps = 13/123 (11%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ YFC+ C+RTV++ P P S+LVCP C+G F+EE E + P     N  F   +   P  
Sbjct  18   PQLYFCHQCDRTVSLNPPPTSDLVCPICSGGFVEEMEASNPNPFPPNPFFSVPSSDAPPF  77

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQ----FHPLLFLQNYL  448
               G  +           ++ G G   DDLSALFGG  A  SP Q    F+P +FLQNYL
Sbjct  78   ASSGFPLLF---------SAPGPGNFSDDLSALFGGAPARSSPFQDPDAFNPFVFLQNYL  128

Query  449  QTM  457
            QT+
Sbjct  129  QTL  131



>ref|XP_008346897.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
 ref|XP_008346898.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
Length=381

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 63/123 (51%), Gaps = 7/123 (6%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ YFC+ C+RTV++TP P S+LVCP C+G FLEE ET    NPS   P    +      
Sbjct  17   PQLYFCHECDRTVSLTPSPTSDLVCPLCSGGFLEEMETP---NPSPFPPNPFFSFPSSDA  73

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS----PNQFHPLLFLQNYL  448
                               + G     DDLSALFGG     S    P+ F+P +FLQNYL
Sbjct  74   PPFASSGFPLLFSSSAPGPAPGPANIADDLSALFGGAPQRSSPFHDPDAFNPFVFLQNYL  133

Query  449  QTM  457
            QT+
Sbjct  134  QTL  136



>ref|XP_002317728.2| hypothetical protein POPTR_0012s03370g [Populus trichocarpa]
 gb|EEE95948.2| hypothetical protein POPTR_0012s03370g [Populus trichocarpa]
Length=269

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 61/138 (44%), Gaps = 50/138 (36%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ YFCY C+RTVTITP P S+L CPNC   FLEE E+  P++                 
Sbjct  10   PQLYFCYQCDRTVTITPSPTSDLSCPNCQEGFLEECESPNPSSNPV--------------  55

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAG-------------------R  403
                              +  G  I LD+ +++FGGMA                     +
Sbjct  56   -----------------DSGLGPAILLDEFASIFGGMAPTPRSSNNSTTTNSSSASPLFQ  98

Query  404  SPNQFHPLLFLQNYLQTM  457
             P+ F+P  FLQNYLQTM
Sbjct  99   DPDGFNPFAFLQNYLQTM  116



>ref|XP_009357359.1| PREDICTED: E3 ubiquitin-protein ligase RING1, partial [Pyrus 
x bretschneideri]
Length=304

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ YFC+ C+RTV++TP P S+LVCP C+G FLEE ET  P     N  F   +   P  
Sbjct  17   PQLYFCHQCDRTVSLTPSPTSDLVCPLCSGGFLEEMETPNPNPFPPNPFFSFPSSDAPPF  76

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS----PNQFHPLLFLQNYL  448
               G  +         +   +   IA DDLSALFGG     S    P+ F+P +FLQNYL
Sbjct  77   ASSGFPLLFSSSASGSAPGPA--NIA-DDLSALFGGAPQRSSPFPDPDAFNPFVFLQNYL  133

Query  449  QTM  457
            QT+
Sbjct  134  QTL  136



>emb|CBI35278.3| unnamed protein product [Vitis vinifera]
Length=416

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 60/122 (49%), Gaps = 9/122 (7%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ YFCY C  TV+ITP P S+ +CP+CN  FLEE E   P       P      +    
Sbjct  66   PQSYFCYQCNLTVSITPSPTSDPLCPHCNDGFLEEVENPNPNPIPVPIPNPFLGFSDLPS  125

Query  281  fgggggvggggeglvfSTASSGGGIALD---DLSALFGGMAAGRSPNQFHPLLFLQNYLQ  451
                G        LVFSTA +GG I L    D   LFG       P+ FHP  FLQNYLQ
Sbjct  126  LSAAGATATAFPPLVFSTA-AGGSIDLQNSVDFPGLFGA-----DPDAFHPFAFLQNYLQ  179

Query  452  TM  457
            T+
Sbjct  180  TL  181



>ref|XP_009355932.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
 ref|XP_009355933.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Pyrus x bretschneideri]
Length=381

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ YFC+ C+RTV++TP P S+LVCP C+G FLEE ET  P     N  F   +   P  
Sbjct  17   PQLYFCHQCDRTVSLTPSPTSDLVCPLCSGGFLEEMETPNPNPFPPNPFFSFPSSDAPPF  76

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS----PNQFHPLLFLQNYL  448
               G  +         +   +   IA DDLSALFGG     S    P+ F+P +FLQNYL
Sbjct  77   ASSGFPLLFSSSASGSAPGPA--NIA-DDLSALFGGAPQRSSPFHDPDAFNPFVFLQNYL  133

Query  449  QTM  457
            QT+
Sbjct  134  QTL  136



>ref|XP_011003690.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=346

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 61/138 (44%), Gaps = 50/138 (36%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ YFCY C+RTVTI P P S+L CPNC+  FLEE E+  P++                 
Sbjct  10   PQLYFCYQCDRTVTINPSPTSDLSCPNCHEGFLEEYESPNPSSNPV--------------  55

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAG-------------------R  403
                              +  G  I LD+ +++FGGMA                     +
Sbjct  56   -----------------DSGLGPAILLDEFASIFGGMAPTPRSSNNSTTTNSSSASPLFQ  98

Query  404  SPNQFHPLLFLQNYLQTM  457
             P+ F+P  FLQNYLQTM
Sbjct  99   DPDGFNPFAFLQNYLQTM  116



>ref|XP_011086955.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
 ref|XP_011086956.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
 ref|XP_011086957.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Sesamum indicum]
Length=382

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 75/126 (60%), Gaps = 12/126 (10%)
 Frame = +2

Query  104  QDYFCYHCERTVTITPLPN--SELVCPNCNGNFLEEAETApptnpsnn------npffpg  259
            + YFCY CER VTITP P+  +ELVCPNC+G+FLEE+ETAPP+NP++          FP 
Sbjct  17   RQYFCYQCERHVTITPPPSPTAELVCPNCDGSFLEESETAPPSNPTDTFPNPFFAEDFPA  76

Query  260  adafpfgfgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQ  439
            + AF               G  FS +S GG    DDLSALFG     RSPN+F+P  FL 
Sbjct  77   SAAFGGFPVVFSSSSAAPAGGSFSISSGGGVDGFDDLSALFG----TRSPNEFNPFAFLS  132

Query  440  NYLQTM  457
            NY+  +
Sbjct  133  NYMNNL  138



>ref|XP_003634328.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Vitis vinifera]
 ref|XP_010663919.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Vitis vinifera]
Length=369

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 60/122 (49%), Gaps = 9/122 (7%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ YFCY C  TV+ITP P S+ +CP+CN  FLEE E   P       P      +    
Sbjct  22   PQSYFCYQCNLTVSITPSPTSDPLCPHCNDGFLEEVENPNPNPIPVPIPNPFLGFSDLPS  81

Query  281  fgggggvggggeglvfSTASSGGGIALD---DLSALFGGMAAGRSPNQFHPLLFLQNYLQ  451
                G        LVFSTA +GG I L    D   LFG       P+ FHP  FLQNYLQ
Sbjct  82   LSAAGATATAFPPLVFSTA-AGGSIDLQNSVDFPGLFGA-----DPDAFHPFAFLQNYLQ  135

Query  452  TM  457
            T+
Sbjct  136  TL  137



>emb|CAN79596.1| hypothetical protein VITISV_042386 [Vitis vinifera]
Length=371

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 60/122 (49%), Gaps = 9/122 (7%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ YFCY C  TV+ITP P S+ +CP+CN  FLEE E   P       P      +    
Sbjct  24   PQSYFCYQCNLTVSITPSPTSDPLCPHCNDGFLEEVENPNPNPIPVPIPNPFLGFSDLPS  83

Query  281  fgggggvggggeglvfSTASSGGGIALD---DLSALFGGMAAGRSPNQFHPLLFLQNYLQ  451
                G        LVFSTA +GG I L    D   LFG       P+ FHP  FLQNYLQ
Sbjct  84   LSAAGATATAFPPLVFSTA-AGGSIDLQNSVDFPGLFGA-----DPDAFHPFAFLQNYLQ  137

Query  452  TM  457
            T+
Sbjct  138  TL  139



>ref|XP_008393509.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
 ref|XP_008393510.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Malus domestica]
Length=388

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 72/131 (55%), Gaps = 17/131 (13%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ YFC+ C+RTV++TP P  +LVCP C+G FLEE ET      + N   FP    F F 
Sbjct  17   PQLYFCHRCDRTVSLTPSPTYDLVCPLCSGGFLEEMETP-----NPNPNPFPPNPFFSFP  71

Query  281  fgggggvggggeglvfSTASSGGGIAL--------DDLSALFGGMAAGRSPNQ----FHP  424
                      G  L+FS+++SG             DDLS+LFGG  +  SP Q    F+P
Sbjct  72   SSDAPPFASSGFPLLFSSSASGPAPDSAPAPANLADDLSSLFGGAPSRSSPFQDPDAFNP  131

Query  425  LLFLQNYLQTM  457
             +FLQNYLQT+
Sbjct  132  FVFLQNYLQTL  142



>ref|XP_006495422.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like, partial [Citrus 
sinensis]
Length=125

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 56/119 (47%), Gaps = 36/119 (30%)
 Frame = +2

Query  110  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  289
            YFC+ C RTV +TP P+S+L+CP+CNG F+EE ET                         
Sbjct  24   YFCHQCNRTVRVTPSPSSDLLCPSCNGGFIEELETP------------------------  59

Query  290  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS---PNQFHPLLFLQNYLQTM  457
                       V    +      LDDLS L  GM   RS   P++F+P +FLQNYLQ +
Sbjct  60   --------NPSVNPNPNPMDAFLLDDLSTLL-GMGPTRSFTDPSEFNPFVFLQNYLQNL  109



>gb|EYU17802.1| hypothetical protein MIMGU_mgv1a008418mg [Erythranthe guttata]
Length=374

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 75/127 (59%), Gaps = 11/127 (9%)
 Frame = +2

Query  101  PQDYFCYHCERTVTI--TPLPNSELVCPNCNGNFLEEAETApptnpsnn------npffp  256
            P+ YFCY CER VTI   P P +E+ CP+C+G FLEE++TAP +NP++       +  FP
Sbjct  18   PKQYFCYQCERNVTIGPPPSPTAEIFCPDCHGGFLEESDTAPSSNPTDALPNPFFDDSFP  77

Query  257  gadafpfgfgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFL  436
             + A+               G  FS +S GG    DDLSALFGG    +SPN+F+PL FL
Sbjct  78   TSAAYGAPPVIFSSSSAAPGGTSFSFSSGGGAGGFDDLSALFGGT---QSPNEFNPLAFL  134

Query  437  QNYLQTM  457
             NY+ ++
Sbjct  135  TNYVNSL  141



>ref|XP_006441411.1| hypothetical protein CICLE_v10020902mg [Citrus clementina]
 gb|ESR54651.1| hypothetical protein CICLE_v10020902mg [Citrus clementina]
Length=350

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 56/119 (47%), Gaps = 36/119 (30%)
 Frame = +2

Query  110  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  289
            YFC+ C RTV +TP P+S+LVCP+CNG F+EE ET                         
Sbjct  24   YFCHQCNRTVRVTPSPSSDLVCPSCNGGFIEELETP------------------------  59

Query  290  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS---PNQFHPLLFLQNYLQTM  457
                       V    +      LDDLS L  GM   RS   P++F+P +FLQNYLQ +
Sbjct  60   --------NPSVNPNPNPMDAFLLDDLSTLL-GMGPTRSFTDPSEFNPFVFLQNYLQNL  109



>gb|KDO48740.1| hypothetical protein CISIN_1g0186891mg [Citrus sinensis]
Length=352

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 56/119 (47%), Gaps = 36/119 (30%)
 Frame = +2

Query  110  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  289
            YFC+ C RTV +TP P+S+LVCP+CNG F+EE ET                         
Sbjct  24   YFCHQCNRTVRVTPSPSSDLVCPSCNGGFIEELETP------------------------  59

Query  290  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS---PNQFHPLLFLQNYLQTM  457
                       V    +      LDDLS L  GM   RS   P++F+P +FLQNYLQ +
Sbjct  60   --------NPSVNPNPNPMDAFLLDDLSTLL-GMGPTRSFTDPSEFNPFVFLQNYLQNL  109



>ref|XP_010246216.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=361

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 63/126 (50%), Gaps = 13/126 (10%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            P+ YFCY C RTV ITP P S+LVCP+CNG FLEE E        N  P       F   
Sbjct  17   PRPYFCYQCNRTVLITPSPTSDLVCPDCNGGFLEEYENP------NPRPSLNPDPFFDNL  70

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS-------PNQFHPLLFLQ  439
             G      G G  ++ ST++SG      +LS LFG     RS       P  F+P  FLQ
Sbjct  71   AGFPSFATGIGLPVLLSTSTSGDFQGPTELSTLFGPALRHRSTSASFQEPEVFNPFAFLQ  130

Query  440  NYLQTM  457
            NYLQ +
Sbjct  131  NYLQAL  136



>ref|XP_003534093.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoformX2 [Glycine 
max]
 ref|XP_006587425.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X3 
[Glycine max]
 ref|XP_006587426.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X4 
[Glycine max]
Length=376

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 57/119 (48%), Gaps = 13/119 (11%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            P+ YFC+ C RTV+I+P P+S+L+CP CNG FLEE E   P     N  F          
Sbjct  17   PRQYFCHQCNRTVSISPSPSSDLLCPTCNGGFLEELEIPIPDPNPPNPFFSDFPLGGAAT  76

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTM  457
                                +       DLSALFG  +   + + F+PL+FLQNY QT+
Sbjct  77   IPLVL-------------PGAATSPPFGDLSALFGDRSDAAASDAFNPLVFLQNYFQTL  122



>gb|ACT21194.1| zinc finger protein [Carica papaya]
Length=340

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 61/127 (48%), Gaps = 29/127 (23%)
 Frame = +2

Query  104  QDYFCYHCERTVTITP--LPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpf  277
            Q YFCY C RTV I+P   P+S+L+CP CNG FLEE E   P   + N   F     F  
Sbjct  6    QPYFCYQCNRTVRISPSPCPSSDLLCPTCNGGFLEELENPNPNQQTLNLNPFDSPFPFL-  64

Query  278  gfgggggvggggeglvfSTASSGGGIALDDLSALFGGM----AAGRSPNQ---FHPLLFL  436
                               +S       DDLSA FGGM    +A   PN    F+P LFL
Sbjct  65   -------------------SSPNSPHPFDDLSAFFGGMVPPPSATARPNDTEVFNPFLFL  105

Query  437  QNYLQTM  457
            QNYLQT+
Sbjct  106  QNYLQTL  112



>ref|XP_006493415.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Citrus sinensis]
Length=352

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 56/119 (47%), Gaps = 36/119 (30%)
 Frame = +2

Query  110  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  289
            YFC+ C RTV +TP P+S+L+CP+CNG F+EE ET                         
Sbjct  24   YFCHQCNRTVRVTPSPSSDLLCPSCNGGFIEELETP------------------------  59

Query  290  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS---PNQFHPLLFLQNYLQTM  457
                       V    +      LDDLS L  GM   RS   P++F+P +FLQNYLQ +
Sbjct  60   --------NPSVNPNPNPMDAFLLDDLSTLL-GMGPTRSFTDPSEFNPFVFLQNYLQNL  109



>ref|XP_003549174.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=369

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 57/119 (48%), Gaps = 12/119 (10%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            P+ YFC+ C RTV+I+P P+S+L+CP CNG FLEE E   P    N    F         
Sbjct  17   PRQYFCHQCNRTVSISPSPSSDLLCPTCNGGFLEELEFPIPNPNPNPPNPFFPDFPLAGA  76

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLFLQNYLQTM  457
                                +      +DLSALFG      + + F+PL+FLQNY QT+
Sbjct  77   ATIPLV-----------LPGAAASPPFEDLSALFGNRPDAAA-DAFNPLVFLQNYFQTL  123



>ref|XP_008467256.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
 ref|XP_008467264.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Cucumis melo]
Length=377

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 72/126 (57%), Gaps = 8/126 (6%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadaf---  271
            PQ YFCY C RTVTITP  +S+L+CPNCN +F+EE E+  P      NPF          
Sbjct  21   PQLYFCYTCNRTVTITPSSSSDLLCPNCNDSFVEEMESPNPNPSPVPNPFLSFTSEAFPP  80

Query  272  -pfgfgggggvggggeglvfSTASSGGGIALDDLSALFGG----MAAGRSPNQFHPLLFL  436
               G GG GG          S    GGG  ++DLSAL GG     ++ ++P+ F+PLLFL
Sbjct  81   FSTGGGGNGGFPIIFSTTSSSGGIGGGGSMMNDLSALLGGGSLRSSSLQNPDGFNPLLFL  140

Query  437  QNYLQT  454
            QNYLQ+
Sbjct  141  QNYLQS  146



>ref|XP_010249658.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Nelumbo nucifera]
Length=363

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 63/127 (50%), Gaps = 11/127 (9%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            PQ YFCY C RTV ITP P+S+LVCP+CNG FLEE E     NPS  +            
Sbjct  17   PQQYFCYQCNRTVLITPSPSSDLVCPSCNGGFLEEYENP---NPSPASNLDSLLGFSDNF  73

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS--------PNQFHPLLFL  436
             G    V G G    F   +SG      DLS LFG     RS        P  F+PL FL
Sbjct  74   SGLPSLVAGLGFSPFFPAPTSGDPQNPTDLSGLFGPGFRLRSSPTYLQEGPEAFNPLAFL  133

Query  437  QNYLQTM  457
            Q+YLQ +
Sbjct  134  QSYLQAL  140



>ref|XP_006374275.1| hypothetical protein POPTR_0015s05600g [Populus trichocarpa]
 gb|ABK95038.1| unknown [Populus trichocarpa]
 gb|ERP52072.1| hypothetical protein POPTR_0015s05600g [Populus trichocarpa]
Length=345

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 58/138 (42%), Gaps = 52/138 (38%)
 Frame = +2

Query  104  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgf  283
            Q YFCY C RTVTITP P + L CPNC+  FLEE ++  P+                   
Sbjct  10   QLYFCYQCNRTVTITP-PTTALSCPNCHEGFLEELDSPNPSPNPF---------------  53

Query  284  gggggvggggeglvfSTASSGGGIALDDLSALFGGMAAG--------------------R  403
                             A  G  + LDD +++FGGM                       +
Sbjct  54   ----------------DAGLGPALLLDDFASIFGGMNPTPRSSTTSTTATNSSSASPLFQ  97

Query  404  SPNQFHPLLFLQNYLQTM  457
             P+ F+P +FLQNYLQTM
Sbjct  98   DPDGFNPFVFLQNYLQTM  115



>ref|XP_011047757.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Populus euphratica]
Length=345

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 57/138 (41%), Gaps = 52/138 (38%)
 Frame = +2

Query  104  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgf  283
            Q YFCY C RTVTITP P + L CPNC+  FLEE ++  P+                   
Sbjct  10   QLYFCYKCNRTVTITP-PATALSCPNCHEGFLEELDSPNPSPNPL---------------  53

Query  284  gggggvggggeglvfSTASSGGGIALDDLSALFGGMAAG--------------------R  403
                                G  + LDD +++FGGM                       +
Sbjct  54   ----------------DGGLGPALLLDDFASIFGGMNPTPRSSTTSTTTTNSSSASPLFQ  97

Query  404  SPNQFHPLLFLQNYLQTM  457
             P+ F+P +FLQNYLQTM
Sbjct  98   DPDGFNPFVFLQNYLQTM  115



>ref|XP_004299466.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Fragaria vesca 
subsp. vesca]
Length=379

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 61/125 (49%), Gaps = 18/125 (14%)
 Frame = +2

Query  110  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  289
            YFC+ C+RTVT+ P P S+L CP C+G FLEE E++        NP       FP     
Sbjct  20   YFCHQCDRTVTLNPSPTSDLACPVCSGGFLEEMESS--------NPNPIPNPFFPSDGPP  71

Query  290  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRS---------PNQFHPLLFLQN  442
                G         TA++G     +DLSA+ GG A  RS         P+ F P  FL++
Sbjct  72   FPSAGFPTFLFGAPTAAAGPRNLAEDLSAILGG-AGSRSTSRASPFHDPDAFDPFRFLES  130

Query  443  YLQTM  457
            YLQ +
Sbjct  131  YLQGL  135



>ref|XP_007152550.1| hypothetical protein PHAVU_004G139600g [Phaseolus vulgaris]
 gb|ESW24544.1| hypothetical protein PHAVU_004G139600g [Phaseolus vulgaris]
Length=359

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  211
            P+ YFC+ C RTV++TP P+S+L+CP+CN  FLEE E
Sbjct  13   PRQYFCHQCNRTVSVTPSPSSDLICPDCNSGFLEELE  49



>gb|EYU22293.1| hypothetical protein MIMGU_mgv1a006235mg [Erythranthe guttata]
Length=451

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 66/128 (52%), Gaps = 16/128 (13%)
 Frame = +2

Query  110  YFCYHCERTVTITP--LPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgf  283
            YFCY C+R V+I P   P +E+VCPNC G FLEE+++ PP+   N       +D+FP   
Sbjct  89   YFCYQCDRHVSIVPPTSPTAEIVCPNCQGGFLEESDSPPPSIADNPIHNPFFSDSFPSAA  148

Query  284  ----------gggggvggggeglvfSTASSGGGIALDDLSALFGGMAAGRSPNQFHPLLF  433
                        G G    G     S+   GGG   DDLSAL G     RSPN+F+P  F
Sbjct  149  PFGGFPIILSSAGAGAAHAGSAFTMSSGGGGGGGGFDDLSALLG----SRSPNEFNPFSF  204

Query  434  LQNYLQTM  457
            L NY+  +
Sbjct  205  LNNYINNL  212



>ref|XP_004137524.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004137525.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004137526.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 3 [Cucumis 
sativus]
 ref|XP_004161827.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004161828.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004161829.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform 3 [Cucumis 
sativus]
 gb|KGN64207.1| hypothetical protein Csa_1G043100 [Cucumis sativus]
Length=378

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  214
            PQ YFCY C RTVTITP  +S+L+CPNCN +F+EE E+
Sbjct  21   PQLYFCYTCNRTVTITPSSSSDLLCPNCNDSFVEEMES  58



>ref|XP_010935556.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
Length=358

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  205
            PQ YFC+ C+RTVT+TP P++E+ CP C+G FLEE
Sbjct  13   PQRYFCHQCDRTVTLTPSPDAEIACPICHGGFLEE  47



>gb|EYU29041.1| hypothetical protein MIMGU_mgv1a026532mg, partial [Erythranthe 
guttata]
Length=189

 Score = 55.5 bits (132),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  205
            PQ YFC+ CERT TI P P  E++CP+CN  F+EE
Sbjct  14   PQMYFCHQCERTATIAPSPGGEILCPSCNSGFVEE  48



>ref|XP_011070454.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
 ref|XP_011070455.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
 ref|XP_011070456.1| PREDICTED: E3 ubiquitin-protein ligase RING1 [Sesamum indicum]
Length=330

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  205
            PQ YFC+ CERTVTITP P  +++CP+CN  F+EE
Sbjct  30   PQMYFCHQCERTVTITPSPGGDILCPSCNSGFVEE  64



>emb|CDP18533.1| unnamed protein product [Coffea canephora]
Length=319

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  211
            PQ YFC+ C RTVTI P P S+L+CP C+  F+EE E
Sbjct  13   PQLYFCHQCNRTVTIIPSPTSDLICPTCHSGFVEEFE  49



>ref|XP_004515274.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Cicer arietinum]
 ref|XP_004515275.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Cicer arietinum]
 ref|XP_004515276.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X3 
[Cicer arietinum]
Length=349

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 56/120 (47%), Gaps = 15/120 (13%)
 Frame = +2

Query  110  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfgfgg  289
            YFC+ CERT  I+   +++L+CPNCNG FLEE ET  P    N NP              
Sbjct  20   YFCHQCERTAFIS-TSSTDLICPNCNGTFLEELETPIPNPNPNPNPNPIPPFFSYTTDFP  78

Query  290  gggvggggeglvfSTASSGGGIALDDLSALFGGMAAGR--SP--NQFHPLLFLQNYLQTM  457
                              G    L+DLS LFG  ++    SP    F+P+ F+QNYLQ +
Sbjct  79   AANFSFPI----------GNSQPLEDLSVLFGNRSSPSPASPFGQAFNPVAFIQNYLQNI  128



>ref|XP_010687250.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 61/128 (48%), Gaps = 16/128 (13%)
 Frame = +2

Query  104  QDYFCYHCERTVTITPLPNS-ELVCPNCNGNFLEEAETApptnpsnnnpffpgadafpfg  280
            Q YFCY C RTV+I+   +S EL CPNCNG FLEE E        N  P           
Sbjct  22   QFYFCYECNRTVSISNPSSSSELFCPNCNGGFLEEVENP------NPFPPPFSPFFSSSP  75

Query  281  fgggggvggggeglvfSTASSGGGIALDDLSALFGG---------MAAGRSPNQFHPLLF  433
                          +F  +SS   I   DLS++FGG          +A + P+ F+PL F
Sbjct  76   SSSAADQLAPFAPFMFPPSSSPPPINPIDLSSIFGGGIANVGGNSRSAFQDPDVFNPLQF  135

Query  434  LQNYLQTM  457
            LQNYLQTM
Sbjct  136  LQNYLQTM  143



>gb|EPS73974.1| hypothetical protein M569_00782, partial [Genlisea aurea]
Length=296

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  205
            PQ YFC+ CERTV I+P P  +++CP+CN  F+EE
Sbjct  13   PQMYFCHQCERTVAISPSPGGDILCPSCNSGFVEE  47



>ref|XP_008803049.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
Length=364

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  205
            PQ YFC+ C+RTVT+TP P +E+ CP C+  F+EE
Sbjct  13   PQRYFCHQCDRTVTLTPSPGAEIACPICHDGFIEE  47



>ref|XP_010069512.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Eucalyptus 
grandis]
 gb|KCW57890.1| hypothetical protein EUGRSUZ_H00641 [Eucalyptus grandis]
Length=394

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  101  PQDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAET  214
            PQ Y+C+ C  TV+I   P ++LVCP+CNG FLEE+E+
Sbjct  18   PQLYYCHQCRSTVSINRSPTADLVCPDCNGEFLEESES  55



>ref|XP_010322969.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum]
Length=359

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 3/34 (9%)
 Frame = +2

Query  107  DYFCYHCERTVTITPLPNSELVCPNCNGNFLEEA  208
            +Y+CY C+ TV   PLPNSEL CPNCNG F+EE+
Sbjct  19   NYYCYGCQSTV---PLPNSELSCPNCNGTFVEES  49



>gb|KFM59559.1| hypothetical protein X975_00622, partial [Stegodyphus mimosarum]
Length=105

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +2

Query  110  YFCYHCERTVTITPLPNSELVCPNCNGNFLEE  205
            YFC+ C R VT++P+  +EL CP C+G FLEE
Sbjct  14   YFCHGCSREVTVSPIHTTELTCPECSGEFLEE  45



>ref|XP_009788594.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009788595.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X2 
[Nicotiana sylvestris]
 ref|XP_009788596.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like isoform X1 
[Nicotiana sylvestris]
Length=311

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  110  YFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  211
            YFC+ C  TVTITP P  +L+CP CN +F+EE +
Sbjct  16   YFCHKCSNTVTITPSPTGDLLCPTCNSDFVEEYD  49



>ref|XP_008811090.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811098.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811103.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811112.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
 ref|XP_008811119.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Phoenix dactylifera]
Length=362

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  104  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEEAE  211
            Q YFC+ C+RTVT+T  P +E+ CP C+G F+EE +
Sbjct  14   QRYFCHQCDRTVTLTVSPGAEIACPICHGGFVEELD  49



>ref|XP_010940373.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940374.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940375.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
 ref|XP_010940376.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Elaeis guineensis]
Length=363

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +2

Query  104  QDYFCYHCERTVTITPLPNSELVCPNCNGNFLEE  205
            Q YFC+ C+RTVT+T  P +E+ CP C+G FLEE
Sbjct  14   QLYFCHQCDRTVTLTLSPGAEIACPICHGGFLEE  47



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566299029105