BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF046K07

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAK19067.1|  GIGANTEA                                               307   1e-93   Ipomoea nil [qian niu]
emb|CDP11443.1|  unnamed protein product                                280   7e-84   Coffea canephora [robusta coffee]
emb|CBI22760.3|  unnamed protein product                                268   6e-83   Vitis vinifera
ref|XP_009772049.1|  PREDICTED: protein GIGANTEA-like                   278   6e-83   Nicotiana sylvestris
ref|XP_009631434.1|  PREDICTED: protein GIGANTEA-like isoform X5        277   1e-82   Nicotiana tomentosiformis
ref|XP_009631433.1|  PREDICTED: protein GIGANTEA-like isoform X4        277   1e-82   Nicotiana tomentosiformis
ref|XP_006359040.1|  PREDICTED: protein GIGANTEA-like isoform X2        274   1e-81   Solanum tuberosum [potatoes]
ref|XP_004237832.1|  PREDICTED: protein GIGANTEA                        272   5e-81   Solanum lycopersicum
ref|XP_002264755.1|  PREDICTED: protein GIGANTEA                        271   1e-80   
ref|XP_004252566.1|  PREDICTED: protein GIGANTEA-like isoform X1        270   3e-80   Solanum lycopersicum
ref|XP_009610493.1|  PREDICTED: protein GIGANTEA-like                   270   4e-80   Nicotiana tomentosiformis
ref|XP_006361616.1|  PREDICTED: protein GIGANTEA-like isoform X1        269   8e-80   Solanum tuberosum [potatoes]
ref|XP_009631431.1|  PREDICTED: protein GIGANTEA-like isoform X2        268   2e-79   Nicotiana tomentosiformis
gb|KDP36552.1|  hypothetical protein JCGZ_08319                         267   3e-79   Jatropha curcas
ref|XP_009631429.1|  PREDICTED: protein GIGANTEA-like isoform X1        267   3e-79   Nicotiana tomentosiformis
gb|EYU30283.1|  hypothetical protein MIMGU_mgv1a000455mg                266   7e-79   Erythranthe guttata [common monkey flower]
ref|XP_010314472.1|  PREDICTED: protein GIGANTEA-like isoform X2        265   2e-78   
ref|XP_002307516.1|  GIGANTEA family protein                            265   3e-78   
gb|AII99806.1|  gigantea                                                265   3e-78   Dimocarpus longan [longan]
ref|XP_011074106.1|  PREDICTED: protein GIGANTEA-like isoform X2        264   3e-78   
ref|XP_011074103.1|  PREDICTED: protein GIGANTEA-like isoform X1        265   3e-78   Sesamum indicum [beniseed]
ref|XP_011044276.1|  PREDICTED: protein GIGANTEA-like                   264   3e-78   Populus euphratica
ref|XP_007019603.1|  Gigantea protein isoform 3                         264   4e-78   
ref|XP_007019601.1|  Gigantea protein isoform 1                         264   4e-78   
ref|XP_006361617.1|  PREDICTED: protein GIGANTEA-like isoform X2        264   4e-78   Solanum tuberosum [potatoes]
ref|XP_007019604.1|  Gigantea protein isoform 4                         264   5e-78   
ref|XP_009802612.1|  PREDICTED: protein GIGANTEA-like                   263   8e-78   Nicotiana sylvestris
gb|KHG25928.1|  Protein GIGANTEA                                        258   2e-77   Gossypium arboreum [tree cotton]
gb|AJC01622.1|  gigantea                                                259   2e-76   Prunus dulcis [sweet almond]
gb|AES62297.2|  gigantea protein 1B                                     259   2e-76   Medicago truncatula
gb|ABP81863.1|  LATE BLOOMER 1                                          259   2e-76   Pisum sativum [garden pea]
gb|KJB28963.1|  hypothetical protein B456_005G077100                    258   3e-76   Gossypium raimondii
gb|KJB28960.1|  hypothetical protein B456_005G077100                    258   3e-76   Gossypium raimondii
ref|XP_011100590.1|  PREDICTED: protein GIGANTEA-like                   259   3e-76   Sesamum indicum [beniseed]
ref|XP_008237480.1|  PREDICTED: protein GIGANTEA                        258   4e-76   
gb|AES62299.2|  gigantea protein 1B                                     258   5e-76   Medicago truncatula
gb|KJB28964.1|  hypothetical protein B456_005G077100                    258   5e-76   Gossypium raimondii
ref|XP_003592048.1|  Protein GIGANTEA                                   258   6e-76   
ref|XP_003592046.1|  Protein GIGANTEA                                   258   6e-76   
gb|KJB28962.1|  hypothetical protein B456_005G077100                    258   7e-76   Gossypium raimondii
gb|KJB28961.1|  hypothetical protein B456_005G077100                    258   7e-76   Gossypium raimondii
ref|XP_006473104.1|  PREDICTED: protein GIGANTEA-like isoform X1        256   2e-75   Citrus sinensis [apfelsine]
ref|XP_004290483.1|  PREDICTED: protein GIGANTEA                        256   2e-75   Fragaria vesca subsp. vesca
dbj|BAM67030.1|  gigantea-like                                          256   2e-75   Chrysanthemum seticuspe f. boreale
ref|XP_011042897.1|  PREDICTED: protein GIGANTEA-like                   256   3e-75   Populus euphratica
gb|KJB59493.1|  hypothetical protein B456_009G258800                    255   3e-75   Gossypium raimondii
gb|KJB59491.1|  hypothetical protein B456_009G258800                    254   4e-75   Gossypium raimondii
ref|XP_010268583.1|  PREDICTED: protein GIGANTEA-like isoform X1        255   5e-75   Nelumbo nucifera [Indian lotus]
ref|XP_007151935.1|  hypothetical protein PHAVU_004G088300g             255   6e-75   Phaseolus vulgaris [French bean]
gb|KJB59492.1|  hypothetical protein B456_009G258800                    254   6e-75   Gossypium raimondii
dbj|BAJ22595.1|  GIGANTEA                                               255   7e-75   Glycine max [soybeans]
gb|KJB59494.1|  hypothetical protein B456_009G258800                    255   8e-75   Gossypium raimondii
gb|EYU36555.1|  hypothetical protein MIMGU_mgv1a000427mg                254   9e-75   Erythranthe guttata [common monkey flower]
gb|KHN41309.1|  Protein GIGANTEA                                        254   1e-74   Glycine soja [wild soybean]
ref|XP_002300901.2|  GIGANTEA family protein                            254   1e-74   
ref|XP_006386299.1|  hypothetical protein POPTR_0002s06490g             254   1e-74   
ref|XP_008381855.1|  PREDICTED: protein GIGANTEA-like                   254   1e-74   
ref|XP_009336496.1|  PREDICTED: protein GIGANTEA-like                   254   2e-74   Pyrus x bretschneideri [bai li]
ref|XP_007143577.1|  hypothetical protein PHAVU_007G083500g             254   2e-74   Phaseolus vulgaris [French bean]
gb|AGL61504.1|  gigantea-like protein                                   253   4e-74   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010268589.1|  PREDICTED: protein GIGANTEA-like isoform X2        251   1e-73   Nelumbo nucifera [Indian lotus]
ref|XP_004496435.1|  PREDICTED: protein GIGANTEA-like isoform X1        251   1e-73   Cicer arietinum [garbanzo]
ref|NP_001239995.1|  uncharacterized protein LOC100800578               251   2e-73   
dbj|BAN82581.1|  gigantea                                               250   3e-73   Glycine max [soybeans]
dbj|BAN82586.1|  gigantea                                               250   3e-73   Glycine max [soybeans]
ref|XP_010261024.1|  PREDICTED: protein GIGANTEA-like isoform X1        249   7e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010261026.1|  PREDICTED: protein GIGANTEA-like isoform X3        249   9e-73   Nelumbo nucifera [Indian lotus]
gb|ACA24490.1|  gigantea-like protein 2                                 248   1e-72   Glycine max [soybeans]
ref|XP_003556164.1|  PREDICTED: protein GIGANTEA isoformX1              248   2e-72   
gb|ACJ65312.1|  GI1 protein                                             248   2e-72   Glycine max [soybeans]
ref|XP_010097648.1|  hypothetical protein L484_023788                   248   3e-72   
gb|AFK65758.1|  GIGANTEA                                                247   5e-72   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|EPS65289.1|  hypothetical protein M569_09488                         232   7e-72   Genlisea aurea
ref|XP_010681263.1|  PREDICTED: protein GIGANTEA                        246   1e-71   
gb|KCW69153.1|  hypothetical protein EUGRSUZ_F02686                     246   1e-71   Eucalyptus grandis [rose gum]
ref|XP_010062087.1|  PREDICTED: protein GIGANTEA isoform X1             246   1e-71   Eucalyptus grandis [rose gum]
dbj|BAN82589.1|  gigantea                                               246   2e-71   Glycine max [soybeans]
gb|AGU91438.1|  GIGANTEA-like protein                                   244   3e-71   Chrysanthemum boreale
gb|KFK44368.1|  gigantea                                                245   4e-71   Arabis alpina [alpine rockcress]
ref|XP_006416158.1|  hypothetical protein EUTSA_v10006603mg             244   4e-71   
gb|ACJ09478.1|  putative gigantea                                       227   5e-71   Oryza sativa Japonica Group [Japonica rice]
gb|KHN17039.1|  Protein GIGANTEA                                        244   5e-71   Glycine soja [wild soybean]
gb|ACJ09482.1|  putative gigantea                                       226   5e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006588466.1|  PREDICTED: uncharacterized protein LOC100800...    244   6e-71   Glycine max [soybeans]
ref|XP_009631432.1|  PREDICTED: protein GIGANTEA-like isoform X3        244   6e-71   Nicotiana tomentosiformis
gb|ACJ09481.1|  putative gigantea                                       226   6e-71   Oryza sativa Indica Group [Indian rice]
ref|XP_006416159.1|  hypothetical protein EUTSA_v10006603mg             243   1e-70   
ref|XP_009335139.1|  PREDICTED: protein GIGANTEA-like                   243   1e-70   Pyrus x bretschneideri [bai li]
gb|ACT22764.1|  GIGANTEA                                                243   2e-70   Allium cepa
gb|ACJ09488.1|  putative gigantea                                       225   2e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006306336.1|  hypothetical protein CARUB_v10012213mg             242   3e-70   Capsella rubella
gb|ACJ09480.1|  putative gigantea                                       224   5e-70   Oryza sativa Indica Group [Indian rice]
gb|ABP96488.1|  GIGANTEA                                                241   6e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAF00023.1|  GIGANTEA                                                241   6e-70   Arabidopsis thaliana [mouse-ear cress]
gb|ACT22765.1|  GIGANTEA                                                241   6e-70   Allium cepa
gb|ABP96485.1|  GIGANTEA                                                241   6e-70   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96484.1|  GIGANTEA                                                241   7e-70   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96483.1|  GIGANTEA                                                241   7e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564180.1|  protein GIGANTEA                                      241   7e-70   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96498.1|  GIGANTEA                                                241   7e-70   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96497.1|  GIGANTEA                                                241   7e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAT97404.1|  gigantea                                                241   7e-70   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96482.1|  GIGANTEA                                                241   8e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008386373.1|  PREDICTED: protein GIGANTEA-like                   241   9e-70   
emb|CAA72908.1|  hypothetical protein                                   241   9e-70   Arabidopsis thaliana [mouse-ear cress]
gb|ABP96496.1|  GIGANTEA                                                241   1e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AAT80910.1|  GIGANTEA                                                241   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477545.1|  PREDICTED: protein GIGANTEA-like isoform X3        241   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010477546.1|  PREDICTED: protein GIGANTEA-like isoform X4        240   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010498761.1|  PREDICTED: protein GIGANTEA                        240   1e-69   Camelina sativa [gold-of-pleasure]
dbj|BAD97864.1|  GI homologue 1                                         240   1e-69   Lemna aequinoctialis
ref|XP_010462850.1|  PREDICTED: protein GIGANTEA-like                   240   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_004139688.1|  PREDICTED: protein GIGANTEA-like                   240   2e-69   
ref|XP_002890532.1|  hypothetical protein ARALYDRAFT_889789             239   3e-69   Arabidopsis lyrata subsp. lyrata
ref|XP_009115601.1|  PREDICTED: protein GIGANTEA                        239   5e-69   Brassica rapa
ref|NP_001288824.1|  protein GIGANTEA                                   239   7e-69   Brassica rapa
gb|ACJ09483.1|  putative gigantea                                       221   7e-69   Oryza sativa Japonica Group [Japonica rice]
emb|CDY21388.1|  BnaA09g30390D                                          238   7e-69   Brassica napus [oilseed rape]
gb|ABP96481.1|  GIGANTEA                                                238   1e-68   Arabidopsis lyrata subsp. petraea
ref|XP_004160322.1|  PREDICTED: protein GIGANTEA-like                   236   1e-68   
ref|XP_010477544.1|  PREDICTED: protein GIGANTEA-like isoform X2        237   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010477543.1|  PREDICTED: protein GIGANTEA-like isoform X1        237   2e-68   Camelina sativa [gold-of-pleasure]
dbj|BAD97869.1|  GI homologue                                           237   2e-68   Lemna gibba
ref|XP_004140955.1|  PREDICTED: protein GIGANTEA-like                   236   4e-68   Cucumis sativus [cucumbers]
ref|XP_008456743.1|  PREDICTED: protein GIGANTEA-like                   236   4e-68   Cucumis melo [Oriental melon]
emb|CDY04787.1|  BnaC05g18020D                                          236   4e-68   
ref|XP_009408935.1|  PREDICTED: protein GIGANTEA-like isoform X2        235   9e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010915066.1|  PREDICTED: protein GIGANTEA-like                   235   1e-67   Elaeis guineensis
ref|XP_009408933.1|  PREDICTED: protein GIGANTEA-like isoform X1        235   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008786518.1|  PREDICTED: protein GIGANTEA-like                   233   6e-67   
ref|XP_009381150.1|  PREDICTED: protein GIGANTEA-like                   232   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008793464.1|  PREDICTED: protein GIGANTEA-like                   232   2e-66   Phoenix dactylifera
ref|XP_010925341.1|  PREDICTED: protein GIGANTEA-like                   232   2e-66   Elaeis guineensis
pir||T00767  hypothetical protein T22J18.6 - Arabidopsis thaliana       231   2e-66
ref|NP_001042220.1|  Os01g0182600                                       229   1e-65   
gb|EEE54000.1|  hypothetical protein OsJ_00641                          230   1e-65   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70061.1|  hypothetical protein OsI_00663                          229   1e-65   Oryza sativa Indica Group [Indian rice]
gb|ADP92454.1|  GIGANTEA 1                                              229   2e-65   x Doritaenopsis hybrid cultivar
ref|XP_006643836.1|  PREDICTED: protein GIGANTEA-like isoform X1        229   2e-65   Oryza brachyantha
gb|ACJ65314.1|  GI3 protein                                             228   2e-65   Glycine max [soybeans]
ref|XP_010535090.1|  PREDICTED: protein GIGANTEA                        227   8e-65   Tarenaya hassleriana [spider flower]
ref|XP_002524341.1|  Protein GIGANTEA, putative                         226   2e-64   
gb|AAW66945.1|  gigantea-like protein                                   224   7e-64   Hordeum vulgare [barley]
gb|AFW80279.1|  gigantea1A isoform 1                                    222   1e-63   
gb|AFW80282.1|  gigantea1A                                              222   4e-63   
ref|NP_001288586.1|  gigantea like1a                                    222   4e-63   Zea mays [maize]
gb|AFW80281.1|  gigantea1A                                              222   4e-63   
gb|AAT79487.1|  gigantea 3                                              222   7e-63   Triticum aestivum [Canadian hard winter wheat]
gb|AAT79486.1|  gigantea 2                                              221   9e-63   Triticum aestivum [Canadian hard winter wheat]
gb|AIC83986.1|  gigantea-like protein                                   221   1e-62   Festuca pratensis [meadow ryegrass]
ref|XP_003564357.1|  PREDICTED: protein GIGANTEA                        221   1e-62   
emb|CDM81775.1|  unnamed protein product                                221   1e-62   Triticum aestivum [Canadian hard winter wheat]
gb|AAQ11738.1|  gigantea                                                221   1e-62   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008672375.1|  PREDICTED: uncharacterized protein LOC100272...    221   2e-62   Zea mays [maize]
ref|NP_001140728.1|  uncharacterized protein LOC100272803               221   2e-62   
gb|ABZ81992.1|  gigantea                                                220   3e-62   Zea mays [maize]
emb|CAY26028.1|  GIGANTEA                                               220   3e-62   Lolium perenne [perennial ryegrass]
ref|XP_009380419.1|  PREDICTED: protein GIGANTEA-like isoform X1        220   3e-62   
ref|XP_004968438.1|  PREDICTED: protein GIGANTEA-like                   219   5e-62   Setaria italica
ref|XP_008461912.1|  PREDICTED: protein GIGANTEA-like isoform X1        219   6e-62   Cucumis melo [Oriental melon]
ref|XP_006359039.1|  PREDICTED: protein GIGANTEA-like isoform X1        219   7e-62   Solanum tuberosum [potatoes]
gb|ACJ09479.1|  putative gigantea                                       203   1e-61   Oryza sativa Japonica Group [Japonica rice]
gb|AGW52153.1|  GI                                                      216   1e-60   Populus tomentosa [Chinese white poplar]
gb|ADR51711.1|  GI                                                      215   1e-60   Secale cereale
gb|ABR18021.1|  unknown                                                 214   3e-60   Picea sitchensis
gb|AGH20049.1|  GI                                                      211   4e-59   Picea abies
gb|ACY30446.1|  gigantea-like protein                                   207   1e-57   Liriodendron tulipifera
ref|XP_004496436.1|  PREDICTED: protein GIGANTEA-like isoform X2        206   3e-57   
gb|KHN46389.1|  Protein GIGANTEA                                        203   3e-56   Glycine soja [wild soybean]
ref|XP_002961231.1|  hypothetical protein SELMODRAFT_140066             201   8e-56   
ref|XP_002969462.1|  hypothetical protein SELMODRAFT_170553             201   9e-56   
gb|AIR93790.1|  gigantea                                                196   1e-53   Kalanchoe fedtschenkoi [lavender-scallops]
gb|AEK05858.1|  gigantea-5                                              179   2e-53   Populus balsamifera [balsam poplar]
gb|AEK05878.1|  gigantea-5                                              179   3e-53   Populus balsamifera [balsam poplar]
gb|AEK05888.1|  gigantea-5                                              179   3e-53   Populus balsamifera [balsam poplar]
gb|AEK26574.1|  gigantea 5                                              179   3e-53   Populus tremula [European aspen]
gb|AEK05813.1|  gigantea-5                                              178   6e-53   Populus balsamifera [balsam poplar]
gb|AEK05848.1|  gigantea-5                                              177   8e-53   Populus balsamifera [balsam poplar]
ref|XP_006842209.1|  hypothetical protein AMTR_s00078p00173230          192   2e-52   
dbj|BAO66507.1|  GIGANTEA                                               191   5e-52   Marchantia polymorpha
dbj|BAP76055.1|  putative GI                                            185   1e-49   Cryptomeria japonica
gb|AEK05795.1|  gigantea 2                                              177   3e-47   Populus balsamifera [balsam poplar]
gb|AEK05801.1|  gigantea 2                                              177   3e-47   Populus balsamifera [balsam poplar]
gb|AEK05793.1|  gigantea 2                                              177   3e-47   Populus balsamifera [balsam poplar]
gb|AEK05803.1|  gigantea 2                                              177   3e-47   Populus balsamifera [balsam poplar]
gb|AEK05799.1|  gigantea 2                                              177   3e-47   Populus balsamifera [balsam poplar]
gb|AEK05807.1|  gigantea 2                                              177   3e-47   Populus balsamifera [balsam poplar]
gb|AEK05791.1|  gigantea 2                                              177   3e-47   Populus balsamifera [balsam poplar]
gb|AEK05790.1|  gigantea 2                                              177   3e-47   Populus balsamifera [balsam poplar]
gb|AEK05802.1|  gigantea 2                                              177   3e-47   Populus balsamifera [balsam poplar]
gb|ADX35837.1|  gigantea                                                158   1e-45   Brachypodium rupestre
gb|ADX35845.1|  gigantea                                                158   1e-45   Brachypodium mexicanum
gb|ADX35839.1|  gigantea                                                158   2e-45   Brachypodium retusum
gb|ADX35848.1|  gigantea                                                157   4e-45   Brachypodium distachyon [annual false brome]
gb|ADX35844.1|  gigantea                                                157   5e-45   Brachypodium mexicanum
gb|ADX35846.1|  gigantea                                                156   7e-45   Brachypodium distachyon [annual false brome]
gb|AFB78142.1|  gigantea                                                155   1e-44   Brachypodium boissieri
gb|KDO83806.1|  hypothetical protein CISIN_1g001216mg                   166   5e-43   Citrus sinensis [apfelsine]
emb|CAN81809.1|  hypothetical protein VITISV_032939                     156   8e-40   Vitis vinifera
ref|XP_004173872.1|  PREDICTED: protein GIGANTEA-like                   142   2e-39   
gb|AGM20686.1|  GI1-2                                                   154   5e-39   Populus tomentosa [Chinese white poplar]
ref|XP_007199688.1|  hypothetical protein PRUPE_ppa000556mg             137   5e-33   
ref|XP_006434519.1|  hypothetical protein CICLE_v10004044mg             135   2e-32   
ref|XP_010261025.1|  PREDICTED: protein GIGANTEA-like isoform X2        130   6e-31   Nelumbo nucifera [Indian lotus]
gb|EMS55238.1|  hypothetical protein TRIUR3_30834                     82.8    2e-14   Triticum urartu
gb|EMT06342.1|  hypothetical protein F775_28583                       82.4    2e-14   
dbj|BAO74118.1|  GIGANTEA                                             75.9    2e-12   Lotus japonicus
dbj|BAO74110.1|  GIGANTEA                                             75.9    2e-12   Lotus japonicus
emb|CDP21210.1|  unnamed protein product                              53.9    8e-07   Coffea canephora [robusta coffee]
gb|AEK05812.1|  gigantea-5                                            50.8    9e-06   Populus balsamifera [balsam poplar]
gb|KGN44454.1|  LATE BLOOMER 1                                        52.0    1e-05   Cucumis sativus [cucumbers]
dbj|BAI40156.1|  gigantea-like protein                                49.7    8e-05   Diospyros kaki [Japanese persimmon]



>dbj|BAK19067.1| GIGANTEA [Ipomoea nil]
Length=1166

 Score =   307 bits (787),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAASCERWIDRLQFSSLFWPPPQDAQQR DQITAYVEYFGQFTSEHFPEDIAELIRNRYP
Sbjct  1    MAASCERWIDRLQFSSLFWPPPQDAQQRKDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN
Sbjct  61   SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            ELSEQWALACGEILRILTHYNRP
Sbjct  121  ELSEQWALACGEILRILTHYNRP  143



>emb|CDP11443.1| unnamed protein product [Coffea canephora]
Length=1167

 Score =   280 bits (717),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/143 (91%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAASCERWID LQFSSLFWPPPQDA+QR  QITAYVEYFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MAASCERWIDGLQFSSLFWPPPQDAEQRKAQITAYVEYFGQFTSEAFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+ENRLFDDVLATF+LHHPEHGHAVI PIISCIIDG LEYDKN PPFASFISLVCP+S+N
Sbjct  61   SEENRLFDDVLATFVLHHPEHGHAVILPIISCIIDGLLEYDKNCPPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>emb|CBI22760.3| unnamed protein product [Vitis vinifera]
Length=549

 Score =   268 bits (685),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+SCERWID LQFSSLFWPPPQD QQR  QITAYV+YFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MASSCERWIDGLQFSSLFWPPPQDVQQRKAQITAYVDYFGQFTSEQFPEDIAELIRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD+ +PPFASFISLVCP+S+N
Sbjct  61   SKEQRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRCTPPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_009772049.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1155

 Score =   278 bits (710),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQFSSLFWPPPQDAQQR  QITAYVEYFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPEDIAELIRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKENRLFDDVLATF+LHHP+HGHAVI PIISCIIDGTL+YDK+ PPFASFISLVCPNS+ 
Sbjct  61   SKENRLFDDVLATFVLHHPDHGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPNSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_009631434.1| PREDICTED: protein GIGANTEA-like isoform X5 [Nicotiana tomentosiformis]
Length=1155

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQFSSLFWPPPQDAQQR  QITAYVEYFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPEDIAELIRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKENRLFDDVLATF+LHHPEHGHAVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+ 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_009631433.1| PREDICTED: protein GIGANTEA-like isoform X4 [Nicotiana tomentosiformis]
Length=1159

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 135/143 (94%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQFSSLFWPPPQDAQQR  QITAYVEYFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPEDIAELIRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKENRLFDDVLATF+LHHPEHGHAVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+ 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_006359040.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1166

 Score =   274 bits (700),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQ+SS+FWPPPQDAQQR  QITAYVEYFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MAATCERWIDGLQYSSIFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKENRLFDDVLATF+LHHPEHGH VI PIISCIIDGTL+YDK+ PPF SFISLVCP+S+ 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHTVILPIISCIIDGTLDYDKSCPPFTSFISLVCPSSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_004237832.1| PREDICTED: protein GIGANTEA [Solanum lycopersicum]
Length=1167

 Score =   272 bits (696),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQ+SS+FWPPPQDAQQR  QITAYVEYF QFTSE FPEDIAELIRNRYP
Sbjct  1    MAATCERWIDGLQYSSIFWPPPQDAQQRKAQITAYVEYFVQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKENRLFDDVLATF+LHHPEHGH VI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+ 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHTVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_002264755.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665061.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
 ref|XP_010665062.1| PREDICTED: protein GIGANTEA [Vitis vinifera]
Length=1170

 Score =   271 bits (693),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+SCERWID LQFSSLFWPPPQD QQR  QITAYV+YFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MASSCERWIDGLQFSSLFWPPPQDVQQRKAQITAYVDYFGQFTSEQFPEDIAELIRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD+ +PPFASFISLVCP+S+N
Sbjct  61   SKEQRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRCTPPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_004252566.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum lycopersicum]
Length=1167

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWID L FSSLFW PPQ A+QR DQITAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MASSSERWIDSLHFSSLFWVPPQAAEQRKDQITAYVKYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKENRLFDDVLATF+LHHPEHGHAV+HPIISCIIDGTLEYDK+SPPFASFISLVC +S+ 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHAVVHPIISCIIDGTLEYDKSSPPFASFISLVCSSSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_009610493.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
 ref|XP_009610494.1| PREDICTED: protein GIGANTEA-like [Nicotiana tomentosiformis]
Length=1158

 Score =   270 bits (689),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +3

Query  186  ASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSK  365
            A+ ERWID L FSSLFWPPPQDAQQR  Q TAYV+YFGQ TSE FPEDIAELIRNRYPSK
Sbjct  6    AASERWIDGLHFSSLFWPPPQDAQQRKAQTTAYVKYFGQSTSEQFPEDIAELIRNRYPSK  65

Query  366  ENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNEL  545
            ENRLFDDVLATF+LHHPEHGHAVIHPIISCIIDGTLEYDK+SPPFASFISLVCP+S+N  
Sbjct  66   ENRLFDDVLATFVLHHPEHGHAVIHPIISCIIDGTLEYDKSSPPFASFISLVCPSSENGY  125

Query  546  SEQWALACGEILRILTHYNRP  608
            SEQWALACGEILRILTHYNRP
Sbjct  126  SEQWALACGEILRILTHYNRP  146



>ref|XP_006361616.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1171

 Score =   269 bits (687),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S  RWID L FSSLFW PPQDA+QR DQITAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MASSSTRWIDSLHFSSLFWLPPQDAEQRKDQITAYVKYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKENRLFDDVLATF+LHHPEHGHAV+HPIISCIIDGTLEYDK+SPPFASFISLVC  S+ 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHAVVHPIISCIIDGTLEYDKSSPPFASFISLVCSRSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_009631431.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nicotiana tomentosiformis]
Length=1169

 Score =   268 bits (684),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 135/157 (86%), Gaps = 14/157 (9%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQFSSLFWPPPQDAQQR  QITAYVEYFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPEDIAELIRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQ-  536
            SKENRLFDDVLATF+LHHPEHGHAVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+ 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEV  120

Query  537  -------------NELSEQWALACGEILRILTHYNRP  608
                          E SEQWALACGEILRILTHYNRP
Sbjct  121  LRILNYQFEGLSHKEYSEQWALACGEILRILTHYNRP  157



>gb|KDP36552.1| hypothetical protein JCGZ_08319 [Jatropha curcas]
Length=1168

 Score =   267 bits (683),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWID LQFSSLFWP PQD QQR  QITAYVEYFGQFTSE FP+DIAELIRNRYP
Sbjct  1    MASSSERWIDGLQFSSLFWPAPQDVQQRKAQITAYVEYFGQFTSEQFPDDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RLFDDVLATF+LHHPEHGHAV+ PIISC+IDGTL YD++SPPFASFISLVCP+S+N
Sbjct  61   SKEKRLFDDVLATFVLHHPEHGHAVVLPIISCLIDGTLVYDRSSPPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_009631429.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009631430.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nicotiana tomentosiformis]
Length=1173

 Score =   267 bits (683),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 135/157 (86%), Gaps = 14/157 (9%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQFSSLFWPPPQDAQQR  QITAYVEYFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPEDIAELIRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQ-  536
            SKENRLFDDVLATF+LHHPEHGHAVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+ 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEV  120

Query  537  -------------NELSEQWALACGEILRILTHYNRP  608
                          E SEQWALACGEILRILTHYNRP
Sbjct  121  LRILNYQFEGLSHKEYSEQWALACGEILRILTHYNRP  157



>gb|EYU30283.1| hypothetical protein MIMGU_mgv1a000455mg [Erythranthe guttata]
Length=1141

 Score =   266 bits (680),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S E+WID LQ SSLFWPPPQDA+QR  QITAYVEYFGQFTSEHFP++IAELIR+RYP
Sbjct  1    MATSNEKWIDSLQPSSLFWPPPQDAEQRKAQITAYVEYFGQFTSEHFPDEIAELIRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKENRLFDDVLATF+LHHPEHGH+VIHPIISCIID TLEYDK+ PPFASFISLV P S+N
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHSVIHPIISCIIDSTLEYDKSGPPFASFISLVSPKSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_010314472.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum lycopersicum]
Length=1166

 Score =   265 bits (677),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWID L FSSLFW PPQ A+QR DQITAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MASSSERWIDSLHFSSLFWVPPQAAEQRKDQITAYVKYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKENRLFDDVLATF+LHHPEHGHAV+HPIISCIIDGTLEYDK+SPPFASFISLVC +S+ 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHAVVHPIISCIIDGTLEYDKSSPPFASFISLVCSSSE-  119

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  120  EYSEQWALACGEILRILTHYNRP  142



>ref|XP_002307516.1| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE94512.1| GIGANTEA family protein [Populus trichocarpa]
Length=1171

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSLFWPPPQDAQQR  QITAYV+YFGQ TSEHFP+DI+ELIRNRYPS
Sbjct  3    SSSSERWIDGLQFSSLFWPPPQDAQQRKAQITAYVDYFGQCTSEHFPDDISELIRNRYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
            K+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE
Sbjct  63   KDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENE  122

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  123  YSEQWALACGEILRILTHYNRP  144



>gb|AII99806.1| gigantea [Dimocarpus longan]
Length=1171

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWID LQFSSLFWPPPQDAQQR  Q TAYVEYFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MASSSERWIDGLQFSSLFWPPPQDAQQRKAQTTAYVEYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RLFDDVLA F+LHHPEHGHAV+ PIIS II+GTL YDK+SPPFASFISLVCP+S+N
Sbjct  61   SKEMRLFDDVLAMFVLHHPEHGHAVVLPIISSIIEGTLVYDKSSPPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_011074106.1| PREDICTED: protein GIGANTEA-like isoform X2 [Sesamum indicum]
Length=1138

 Score =   264 bits (675),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWID LQFSSLFWPPPQD +QR  QI AYVE+FGQFTSE FP+DIAELIRNRYP
Sbjct  1    MATSNERWIDSLQFSSLFWPPPQDVKQRKAQIAAYVEFFGQFTSEQFPDDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S ENRLFDDVLATF+LHHPEHGHAVI PIISCIIDG+LEYD++ PPFASFISLVCPNS+ 
Sbjct  61   SNENRLFDDVLATFVLHHPEHGHAVILPIISCIIDGSLEYDRSGPPFASFISLVCPNSEM  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E +EQWALACGEILRILTHYNRP
Sbjct  121  EYTEQWALACGEILRILTHYNRP  143



>ref|XP_011074103.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
 ref|XP_011074105.1| PREDICTED: protein GIGANTEA-like isoform X1 [Sesamum indicum]
Length=1169

 Score =   265 bits (676),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWID LQFSSLFWPPPQD +QR  QI AYVE+FGQFTSE FP+DIAELIRNRYP
Sbjct  1    MATSNERWIDSLQFSSLFWPPPQDVKQRKAQIAAYVEFFGQFTSEQFPDDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S ENRLFDDVLATF+LHHPEHGHAVI PIISCIIDG+LEYD++ PPFASFISLVCPNS+ 
Sbjct  61   SNENRLFDDVLATFVLHHPEHGHAVILPIISCIIDGSLEYDRSGPPFASFISLVCPNSEM  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E +EQWALACGEILRILTHYNRP
Sbjct  121  EYTEQWALACGEILRILTHYNRP  143



>ref|XP_011044276.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1171

 Score =   264 bits (675),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSLFWPPPQDAQQR  QITAYV+YFGQ TSEHFP+DI+ELIRNRYPS
Sbjct  3    SSSSERWIDGLQFSSLFWPPPQDAQQRKAQITAYVDYFGQCTSEHFPDDISELIRNRYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
            K+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE
Sbjct  63   KDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENE  122

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  123  YSEQWALACGEILRILTHYNRP  144



>ref|XP_007019603.1| Gigantea protein isoform 3 [Theobroma cacao]
 gb|EOY16828.1| Gigantea protein isoform 3 [Theobroma cacao]
Length=1171

 Score =   264 bits (675),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+  ERWID LQFSSLFWPPPQD QQR  QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MASPSERWIDGLQFSSLFWPPPQDPQQRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
             KE RLFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YDK++PPFASFISLVCP+S+N
Sbjct  61   HKEQRLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDKSTPPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_007019601.1| Gigantea protein isoform 1 [Theobroma cacao]
 ref|XP_007019602.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16826.1| Gigantea protein isoform 1 [Theobroma cacao]
 gb|EOY16827.1| Gigantea protein isoform 1 [Theobroma cacao]
Length=1170

 Score =   264 bits (675),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+  ERWID LQFSSLFWPPPQD QQR  QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MASPSERWIDGLQFSSLFWPPPQDPQQRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
             KE RLFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YDK++PPFASFISLVCP+S+N
Sbjct  61   HKEQRLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDKSTPPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_006361617.1| PREDICTED: protein GIGANTEA-like isoform X2 [Solanum tuberosum]
Length=1170

 Score =   264 bits (675),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 132/143 (92%), Gaps = 1/143 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S  RWID L FSSLFW PPQDA+QR DQITAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MASSSTRWIDSLHFSSLFWLPPQDAEQRKDQITAYVKYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKENRLFDDVLATF+LHHPEHGHAV+HPIISCIIDGTLEYDK+SPPFASFISLVC  S+ 
Sbjct  61   SKENRLFDDVLATFVLHHPEHGHAVVHPIISCIIDGTLEYDKSSPPFASFISLVCSRSE-  119

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  120  EYSEQWALACGEILRILTHYNRP  142



>ref|XP_007019604.1| Gigantea protein isoform 4 [Theobroma cacao]
 gb|EOY16829.1| Gigantea protein isoform 4 [Theobroma cacao]
Length=1147

 Score =   264 bits (674),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+  ERWID LQFSSLFWPPPQD QQR  QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MASPSERWIDGLQFSSLFWPPPQDPQQRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
             KE RLFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YDK++PPFASFISLVCP+S+N
Sbjct  61   HKEQRLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDKSTPPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_009802612.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
 ref|XP_009802613.1| PREDICTED: protein GIGANTEA-like [Nicotiana sylvestris]
Length=1156

 Score =   263 bits (672),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWID L  SSLFWPPPQDAQQR  Q  AYV+YFGQ TSE FPEDIAELIRNRYPSK+NR
Sbjct  9    ERWIDGLHVSSLFWPPPQDAQQRKAQTAAYVKYFGQSTSEQFPEDIAELIRNRYPSKQNR  68

Query  375  LFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LFDDVLATF+LHHPEHGHAVIHPIISCIIDGTLEYDK+SPPFASFISLVCP+S+N  SEQ
Sbjct  69   LFDDVLATFVLHHPEHGHAVIHPIISCIIDGTLEYDKSSPPFASFISLVCPSSENGYSEQ  128

Query  555  WALACGEILRILTHYNRP  608
            WALACGEILRILTHYNRP
Sbjct  129  WALACGEILRILTHYNRP  146



>gb|KHG25928.1| Protein GIGANTEA [Gossypium arboreum]
 gb|KHG25929.1| Protein GIGANTEA [Gossypium arboreum]
Length=755

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   ERWID LQFSSLF PPPQD Q R  QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S E RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDKN+PPF+SFISLVCP+S+N
Sbjct  61   SDEQRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKNAPPFSSFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>gb|AJC01622.1| gigantea [Prunus dulcis]
Length=1170

 Score =   259 bits (663),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERWIDRLQFSSLF PPPQDA +R  Q+TAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MAATSERWIDRLQFSSLFGPPPQDALRRKAQVTAYVDYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+  RLFDDVLA F+LHHPEHGHAVI PIISCIIDGTL Y++ SPPFASFISLVCP+S+N
Sbjct  61   SEVKRLFDDVLAMFVLHHPEHGHAVILPIISCIIDGTLAYERTSPPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>gb|AES62297.2| gigantea protein 1B [Medicago truncatula]
Length=975

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +3

Query  165  LVDRYMAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELI  344
            +    MAA+ ERWIDRLQFSSLFWPPPQD QQ+ DQI AYVEY  QFTSE F +DIAELI
Sbjct  1    MTSSSMAATSERWIDRLQFSSLFWPPPQDVQQKKDQIAAYVEYLIQFTSEQFADDIAELI  60

Query  345  RNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVC  524
            RNRYPSKE  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFAS ISLVC
Sbjct  61   RNRYPSKEIILFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVC  120

Query  525  PNSQNELSEQWALACGEILRILTHYNRP  608
            P  +NE SEQWALACGEILRILTHYNRP
Sbjct  121  PKDENEYSEQWALACGEILRILTHYNRP  148



>gb|ABP81863.1| LATE BLOOMER 1 [Pisum sativum]
Length=1175

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERWIDRLQFSSLFWPPPQD QQ+ DQI AYVEY  QFTSE F +DIAELIRNRYP
Sbjct  5    MAATSERWIDRLQFSSLFWPPPQDGQQKKDQIAAYVEYLIQFTSEQFADDIAELIRNRYP  64

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFAS ISLVCP ++N
Sbjct  65   SKEILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKNEN  124

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  125  EYSEQWALACGEILRILTHYNRP  147



>gb|KJB28963.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=970

 Score =   258 bits (659),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   ERWID LQFSSLF PPPQD Q R  QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S E RLFDDVLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+N
Sbjct  61   SDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>gb|KJB28960.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1001

 Score =   258 bits (659),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   ERWID LQFSSLF PPPQD Q R  QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S E RLFDDVLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+N
Sbjct  61   SDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_011100590.1| PREDICTED: protein GIGANTEA-like [Sesamum indicum]
Length=1166

 Score =   259 bits (661),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S E+WID LQFSSLFWPPPQDA+QR  Q+TAYVEYFGQFTSE FP+DIAELIR+RYP
Sbjct  1    MATSNEKWIDSLQFSSLFWPPPQDAEQRKAQVTAYVEYFGQFTSEQFPDDIAELIRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RLFDDVLATF+LHHPEHGHAVI PIISCIID +LEYD++SPPFASFISLV PNS+N
Sbjct  61   SKEIRLFDDVLATFVLHHPEHGHAVILPIISCIIDCSLEYDRSSPPFASFISLVYPNSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E  EQWALACGEILRILTHYNRP
Sbjct  121  EYLEQWALACGEILRILTHYNRP  143



>ref|XP_008237480.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237481.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237482.1| PREDICTED: protein GIGANTEA [Prunus mume]
 ref|XP_008237483.1| PREDICTED: protein GIGANTEA [Prunus mume]
Length=1170

 Score =   258 bits (660),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERWIDRLQFSSLF PPPQDA +R  Q+TAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MAATSERWIDRLQFSSLFGPPPQDALRRKAQVTAYVDYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+  RLFDDVLA F+LHHPEHGHAVI PIISCIIDGTL Y++ SPPFASFISLVCP+S+N
Sbjct  61   SEVKRLFDDVLAMFVLHHPEHGHAVILPIISCIIDGTLAYERISPPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>gb|AES62299.2| gigantea protein 1B [Medicago truncatula]
Length=1177

 Score =   258 bits (660),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +3

Query  165  LVDRYMAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELI  344
            +    MAA+ ERWIDRLQFSSLFWPPPQD QQ+ DQI AYVEY  QFTSE F +DIAELI
Sbjct  1    MTSSSMAATSERWIDRLQFSSLFWPPPQDVQQKKDQIAAYVEYLIQFTSEQFADDIAELI  60

Query  345  RNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVC  524
            RNRYPSKE  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFAS ISLVC
Sbjct  61   RNRYPSKEIILFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVC  120

Query  525  PNSQNELSEQWALACGEILRILTHYNRP  608
            P  +NE SEQWALACGEILRILTHYNRP
Sbjct  121  PKDENEYSEQWALACGEILRILTHYNRP  148



>gb|KJB28964.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1080

 Score =   258 bits (659),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   ERWID LQFSSLF PPPQD Q R  QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S E RLFDDVLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+N
Sbjct  61   SDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_003592048.1| Protein GIGANTEA [Medicago truncatula]
Length=1200

 Score =   258 bits (660),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERWIDRLQFSSLFWPPPQD QQ+ DQI AYVEY  QFTSE F +DIAELIRNRYP
Sbjct  1    MAATSERWIDRLQFSSLFWPPPQDVQQKKDQIAAYVEYLIQFTSEQFADDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFAS ISLVCP  +N
Sbjct  61   SKEIILFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKDEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_003592046.1| Protein GIGANTEA [Medicago truncatula]
Length=1172

 Score =   258 bits (659),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERWIDRLQFSSLFWPPPQD QQ+ DQI AYVEY  QFTSE F +DIAELIRNRYP
Sbjct  1    MAATSERWIDRLQFSSLFWPPPQDVQQKKDQIAAYVEYLIQFTSEQFADDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFAS ISLVCP  +N
Sbjct  61   SKEIILFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKDEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>gb|KJB28962.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1147

 Score =   258 bits (658),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   ERWID LQFSSLF PPPQD Q R  QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S E RLFDDVLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+N
Sbjct  61   SDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>gb|KJB28961.1| hypothetical protein B456_005G077100 [Gossypium raimondii]
Length=1155

 Score =   258 bits (658),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   ERWID LQFSSLF PPPQD Q R  QITAYVEYFGQFTSE FPEDIAEL+RNRYP
Sbjct  1    MANPSERWIDGLQFSSLFRPPPQDPQHRKVQITAYVEYFGQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S E RLFDDVLATF+LHHPEHGHAV+ PII+CIIDGTL YDKN+PPF+SFISLVCP+S+N
Sbjct  61   SDEQRLFDDVLATFVLHHPEHGHAVVLPIIACIIDGTLMYDKNAPPFSSFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_006473104.1| PREDICTED: protein GIGANTEA-like isoform X1 [Citrus sinensis]
 ref|XP_006473105.1| PREDICTED: protein GIGANTEA-like isoform X2 [Citrus sinensis]
 ref|XP_006473106.1| PREDICTED: protein GIGANTEA-like isoform X3 [Citrus sinensis]
 ref|XP_006473107.1| PREDICTED: protein GIGANTEA-like isoform X4 [Citrus sinensis]
Length=1165

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWID LQFSSLFWPPPQDA+QR  Q TAYVEYFGQFTSE FPE+IAELIR+ YP
Sbjct  1    MASSSERWIDGLQFSSLFWPPPQDAEQRKIQTTAYVEYFGQFTSEQFPEEIAELIRSHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
             KE RLFDDVLA F+LHHPEHGHAV  PIISCIIDGTL YDK+SPPFASF+SLVCPNS+N
Sbjct  61   HKERRLFDDVLAMFVLHHPEHGHAVALPIISCIIDGTLVYDKSSPPFASFVSLVCPNSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALAC EILRILTHYNRP
Sbjct  121  EYSEQWALACTEILRILTHYNRP  143



>ref|XP_004290483.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458472.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
 ref|XP_011458473.1| PREDICTED: protein GIGANTEA [Fragaria vesca subsp. vesca]
Length=1178

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWIDRLQFSSLF PPPQDA +R  QITAYVEYFGQFTSE FPEDI+ELIRNRYP
Sbjct  1    MACSSERWIDRLQFSSLFGPPPQDAPRRKAQITAYVEYFGQFTSEQFPEDISELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+  RLFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL Y++ SPPFASFISLVCP+S+ 
Sbjct  61   SEVKRLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLPYERTSPPFASFISLVCPSSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>dbj|BAM67030.1| gigantea-like [Chrysanthemum seticuspe f. boreale]
Length=1145

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA +  RW D LQFSSLFWPPP D QQR +QITAYV+YFGQFTSE FPEDIAEL+R+RYP
Sbjct  1    MADTSTRWTDSLQFSSLFWPPPLDTQQRKEQITAYVDYFGQFTSEQFPEDIAELVRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+E RLFDDVLATF+LHHPEHGH+VI PIISCIIDGT+EYD+++PPFASFISLVCP++  
Sbjct  61   SQEKRLFDDVLATFVLHHPEHGHSVILPIISCIIDGTMEYDRSTPPFASFISLVCPSTDK  120

Query  540  ELSEQWALACGEILRILTHYNRPGLXS  620
            E SEQWALACGEILR+LTHYNRP L +
Sbjct  121  EYSEQWALACGEILRVLTHYNRPILKA  147



>ref|XP_011042897.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042898.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
 ref|XP_011042899.1| PREDICTED: protein GIGANTEA-like [Populus euphratica]
Length=1169

 Score =   256 bits (654),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSLF PPPQDAQQR  QITAYVEYFGQ TSE FP+DIAELIRNRYPS
Sbjct  3    SSSSERWIDGLQFSSLFCPPPQDAQQRKAQITAYVEYFGQCTSEQFPDDIAELIRNRYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
            K+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE
Sbjct  63   KDKHLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENE  122

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  123  YSEQWALACGEILRILTHYNRP  144



>gb|KJB59493.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=973

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   +RWID LQFSSLFWPPPQD Q+R  QITAYVEYFGQFTSE FPEDIAELIR RYP
Sbjct  1    MANPSKRWIDGLQFSSLFWPPPQDPQERKVQITAYVEYFGQFTSEQFPEDIAELIRTRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RLFDDVLATF+LHHPEHGHAV+ PIIS IIDG+L YDK+S PFASFISLVCP+S+N
Sbjct  61   SKEQRLFDDVLATFVLHHPEHGHAVVLPIISGIIDGSLVYDKSSLPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>gb|KJB59491.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=975

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   +RWID LQFSSLFWPPPQD Q+R  QITAYVEYFGQFTSE FPEDIAELIR RYP
Sbjct  1    MANPSKRWIDGLQFSSLFWPPPQDPQERKVQITAYVEYFGQFTSEQFPEDIAELIRTRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RLFDDVLATF+LHHPEHGHAV+ PIIS IIDG+L YDK+S PFASFISLVCP+S+N
Sbjct  61   SKEQRLFDDVLATFVLHHPEHGHAVVLPIISGIIDGSLVYDKSSLPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_010268583.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268584.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268585.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268586.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268587.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
 ref|XP_010268588.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
Length=1083

 Score =   255 bits (651),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWID LQFSSLFWPPPQD QQR  QI AYVEYFGQFTSE FP+DI ELIR+RYP
Sbjct  1    MASSSERWIDGLQFSSLFWPPPQDVQQRQAQINAYVEYFGQFTSERFPDDIGELIRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SK+ RLFD+VLA F+LHHPEHGHAV+ PIISC+IDGTL YDK+SPPF+SFI LVCP+S+N
Sbjct  61   SKDKRLFDEVLAMFVLHHPEHGHAVLLPIISCVIDGTLVYDKSSPPFSSFICLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILR+LTHYNRP
Sbjct  121  EYSEQWALACGEILRVLTHYNRP  143



>ref|XP_007151935.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
 gb|ESW23929.1| hypothetical protein PHAVU_004G088300g [Phaseolus vulgaris]
Length=1169

 Score =   255 bits (652),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAAS ERWIDRLQFSSLFWPPP + QQR DQI AYVEY GQFTSE FP+DIAELIRNRYP
Sbjct  5    MAASSERWIDRLQFSSLFWPPPLEDQQRKDQIAAYVEYIGQFTSEQFPDDIAELIRNRYP  64

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE  LFD+VLA  +LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFISLVCP ++N
Sbjct  65   SKEMLLFDEVLAVLVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASFISLVCPKNEN  124

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILT YNRP
Sbjct  125  EYSEQWALACGEILRILTLYNRP  147



>gb|KJB59492.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1055

 Score =   254 bits (650),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   +RWID LQFSSLFWPPPQD Q+R  QITAYVEYFGQFTSE FPEDIAELIR RYP
Sbjct  1    MANPSKRWIDGLQFSSLFWPPPQDPQERKVQITAYVEYFGQFTSEQFPEDIAELIRTRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RLFDDVLATF+LHHPEHGHAV+ PIIS IIDG+L YDK+S PFASFISLVCP+S+N
Sbjct  61   SKEQRLFDDVLATFVLHHPEHGHAVVLPIISGIIDGSLVYDKSSLPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>dbj|BAJ22595.1| GIGANTEA [Glycine max]
Length=1168

 Score =   255 bits (651),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAAS ERWIDRLQ+SSLFWPPP D QQR DQI AYVEYF QFTSE F +DIAELIRNRYP
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +N
Sbjct  61   SKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>gb|KJB59494.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59495.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59496.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59497.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
 gb|KJB59498.1| hypothetical protein B456_009G258800 [Gossypium raimondii]
Length=1168

 Score =   255 bits (651),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   +RWID LQFSSLFWPPPQD Q+R  QITAYVEYFGQFTSE FPEDIAELIR RYP
Sbjct  1    MANPSKRWIDGLQFSSLFWPPPQDPQERKVQITAYVEYFGQFTSEQFPEDIAELIRTRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RLFDDVLATF+LHHPEHGHAV+ PIIS IIDG+L YDK+S PFASFISLVCP+S+N
Sbjct  61   SKEQRLFDDVLATFVLHHPEHGHAVVLPIISGIIDGSLVYDKSSLPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>gb|EYU36555.1| hypothetical protein MIMGU_mgv1a000427mg [Erythranthe guttata]
Length=1160

 Score =   254 bits (650),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA   ERWID LQFSSLFWPPPQD ++R  QI AYVE+FGQFTSE FP+DIAEL+R+RYP
Sbjct  1    MATQNERWIDSLQFSSLFWPPPQDTEERKAQINAYVEFFGQFTSEQFPDDIAELVRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S +NRLFDDVLA F+LHHPEHGHAVI PIISCIIDG +EY ++ PPFASFISLVCPNS+N
Sbjct  61   SDQNRLFDDVLAKFVLHHPEHGHAVILPIISCIIDGLVEYKRSGPPFASFISLVCPNSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>gb|KHN41309.1| Protein GIGANTEA [Glycine soja]
Length=1166

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            AAS ERW+DRLQFSSLFWPPP D QQR DQ+ AYVEY GQFTSE F EDIAELIRN YPS
Sbjct  3    AASGERWMDRLQFSSLFWPPPLDDQQRKDQVAAYVEYIGQFTSEQFSEDIAELIRNHYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
            KE  LFDDVLA  +LHHPEHGHAV+ PIISCIIDGTL+YDK SPPFASFISLVCP ++NE
Sbjct  63   KEMLLFDDVLAVLVLHHPEHGHAVVLPIISCIIDGTLDYDKTSPPFASFISLVCPKNENE  122

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWA+ACGEILRILTHYNRP
Sbjct  123  YSEQWAMACGEILRILTHYNRP  144



>ref|XP_002300901.2| GIGANTEA family protein [Populus trichocarpa]
 gb|EEE80174.2| GIGANTEA family protein [Populus trichocarpa]
Length=1194

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSLF PPPQDAQQR  QITAYVEYFGQ TSE FP+DIAELIRNRYPS
Sbjct  3    SSSSERWIDGLQFSSLFCPPPQDAQQRKAQITAYVEYFGQCTSEQFPDDIAELIRNRYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
            K+  LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE
Sbjct  63   KDKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENE  122

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  123  YSEQWALACGEILRILTHYNRP  144



>ref|XP_006386299.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
 gb|ERP64096.1| hypothetical protein POPTR_0002s06490g [Populus trichocarpa]
Length=1171

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSLF PPPQDAQQR  QITAYVEYFGQ TSE FP+DIAELIRNRYPS
Sbjct  3    SSSSERWIDGLQFSSLFCPPPQDAQQRKAQITAYVEYFGQCTSEQFPDDIAELIRNRYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
            K+  LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPFASFISLVCP+S+NE
Sbjct  63   KDKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPFASFISLVCPSSENE  122

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  123  YSEQWALACGEILRILTHYNRP  144



>ref|XP_008381855.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1170

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERW DRLQFSSLF PPPQDA +R  QITAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MAATSERWFDRLQFSSLFGPPPQDALRRKAQITAYVDYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+  RLFDDVLA F+LHHPEHGHAVI PIISCIIDGTL Y  +SPPFASFISLVCP+S+ 
Sbjct  61   SEVKRLFDDVLAMFVLHHPEHGHAVILPIISCIIDGTLXYKSSSPPFASFISLVCPSSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_009336496.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1170

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERW DRLQFSSLF PPPQDA +R  QITAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MAATSERWFDRLQFSSLFGPPPQDALRRKAQITAYVDYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+  RLFDDVLA F+LHHPEHGHAVI PIISCIIDGTL Y  +SPPFASFISLVCP+S+ 
Sbjct  61   SEVKRLFDDVLAMFVLHHPEHGHAVILPIISCIIDGTLAYKSSSPPFASFISLVCPSSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_007143577.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 ref|XP_007143578.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15571.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
 gb|ESW15572.1| hypothetical protein PHAVU_007G083500g [Phaseolus vulgaris]
Length=1199

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA  E+WIDRLQFSSLFWPPP D QQR DQI AYVEYF QFTSE F +DIAELIRNRYP
Sbjct  8    MAAPSEKWIDRLQFSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFTDDIAELIRNRYP  67

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +N
Sbjct  68   SKEILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKVEN  127

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  128  EYSEQWALACGEILRILTHYNRP  150



>gb|AGL61504.1| gigantea-like protein [Chrysanthemum x morifolium]
Length=1145

 Score =   253 bits (645),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA +  RW D LQFSSLFWPPP D QQ  +QITAYV+YFGQFTSE FPEDIAEL+R+RYP
Sbjct  1    MADTSTRWTDSLQFSSLFWPPPLDTQQCKEQITAYVDYFGQFTSEQFPEDIAELVRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+E RLFDDVLATF+LHHPEHGH+VI PIISCIIDGT+EYD+++PPFASFISLVCP++  
Sbjct  61   SQEKRLFDDVLATFVLHHPEHGHSVILPIISCIIDGTMEYDRSTPPFASFISLVCPSTDK  120

Query  540  ELSEQWALACGEILRILTHYNRPGLXS  620
            E SEQWALACGEILR+LTHYNRP L +
Sbjct  121  EYSEQWALACGEILRVLTHYNRPILKA  147



>ref|XP_010268589.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nelumbo nucifera]
Length=1081

 Score =   251 bits (641),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 129/143 (90%), Gaps = 2/143 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWID LQFSSLFWPPPQD QQR  QI AYVEYFGQFTSE FP+DI ELIR+RYP
Sbjct  1    MASSSERWIDGLQFSSLFWPPPQDVQQR--QINAYVEYFGQFTSERFPDDIGELIRSRYP  58

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SK+ RLFD+VLA F+LHHPEHGHAV+ PIISC+IDGTL YDK+SPPF+SFI LVCP+S+N
Sbjct  59   SKDKRLFDEVLAMFVLHHPEHGHAVLLPIISCVIDGTLVYDKSSPPFSSFICLVCPSSEN  118

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILR+LTHYNRP
Sbjct  119  EYSEQWALACGEILRVLTHYNRP  141



>ref|XP_004496435.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cicer arietinum]
Length=1180

 Score =   251 bits (642),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWIDRLQ+SSLFWPPPQD QQ+ DQI AYVEY  QFTSE F +DIAE+IRNRYPSKE  
Sbjct  11   ERWIDRLQYSSLFWPPPQDGQQKKDQIAAYVEYLIQFTSEQFADDIAEMIRNRYPSKEIL  70

Query  375  LFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFAS ISLVCP ++NE SEQ
Sbjct  71   LFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKTSPPFASLISLVCPKNENEYSEQ  130

Query  555  WALACGEILRILTHYNRP  608
            WALACGEILRILTHYNRP
Sbjct  131  WALACGEILRILTHYNRP  148



>ref|NP_001239995.1| uncharacterized protein LOC100800578 [Glycine max]
 gb|ACJ65313.1| GI2 protein [Glycine max]
 dbj|BAJ22594.1| GIGANTEA [Glycine max]
Length=1170

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAAS ERWIDRLQ+SSLFWPPP D QQR DQI AYVEYF QFTSE F +DIAELIRN YP
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +N
Sbjct  61   SKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SE+WALACGEILRILTHYNRP
Sbjct  121  EYSEEWALACGEILRILTHYNRP  143



>dbj|BAN82581.1| gigantea [Glycine max]
 dbj|BAN82582.1| gigantea [Glycine max]
 dbj|BAN82583.1| gigantea [Glycine max]
 dbj|BAN82584.1| gigantea [Glycine max]
 dbj|BAN82585.1| gigantea [Glycine max]
 dbj|BAN82587.1| gigantea [Glycine max]
 dbj|BAN82588.1| gigantea [Glycine max]
Length=1170

 Score =   250 bits (639),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAAS ERWIDRLQ+SSLFWPPP D QQR DQI AYVEYF QFTSE F +DIAELIRN YP
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +N
Sbjct  61   SKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SE+WALACGEILRILTHYNRP
Sbjct  121  EYSEEWALACGEILRILTHYNRP  143



>dbj|BAN82586.1| gigantea [Glycine max]
 dbj|BAN82590.1| gigantea [Glycine max]
 dbj|BAN82591.1| gigantea [Glycine max]
 dbj|BAN82592.1| gigantea [Glycine max]
Length=1170

 Score =   250 bits (639),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAAS ERWIDRLQ+SSLFWPPP D QQR DQI AYVEYF QFTSE F +DIAELIRN YP
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +N
Sbjct  61   SKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SE+WALACGEILRILTHYNRP
Sbjct  121  EYSEEWALACGEILRILTHYNRP  143



>ref|XP_010261024.1| PREDICTED: protein GIGANTEA-like isoform X1 [Nelumbo nucifera]
Length=1174

 Score =   249 bits (637),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M++SCERWID LQFSSLFWP PQDAQQR  QITAYVEYFGQFTSE F EDI ELIR  YP
Sbjct  1    MSSSCERWIDGLQFSSLFWPSPQDAQQRQAQITAYVEYFGQFTSERFAEDIGELIRCHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+  RLFD+VLA F+LHHPEHGHAV+ P+ISCIID TL Y+KNSPPF+SFISLVCP+++N
Sbjct  61   SQNKRLFDEVLAMFVLHHPEHGHAVLLPLISCIIDDTLAYNKNSPPFSSFISLVCPSNEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWA+ACGEILR+LTHYNRP
Sbjct  121  EYSEQWAMACGEILRVLTHYNRP  143



>ref|XP_010261026.1| PREDICTED: protein GIGANTEA-like isoform X3 [Nelumbo nucifera]
Length=1079

 Score =   249 bits (635),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M++SCERWID LQFSSLFWP PQDAQQR  QITAYVEYFGQFTSE F EDI ELIR  YP
Sbjct  1    MSSSCERWIDGLQFSSLFWPSPQDAQQRQAQITAYVEYFGQFTSERFAEDIGELIRCHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+  RLFD+VLA F+LHHPEHGHAV+ P+ISCIID TL Y+KNSPPF+SFISLVCP+++N
Sbjct  61   SQNKRLFDEVLAMFVLHHPEHGHAVLLPLISCIIDDTLAYNKNSPPFSSFISLVCPSNEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWA+ACGEILR+LTHYNRP
Sbjct  121  EYSEQWAMACGEILRVLTHYNRP  143



>gb|ACA24490.1| gigantea-like protein 2 [Glycine max]
Length=990

 Score =   248 bits (633),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWIDRLQ+SSLFWPPP D QQR DQI AYVEYF QFTSE F +DIAELIRNRYPSK+  
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNRYPSKDIL  72

Query  375  LFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SEQ
Sbjct  73   LFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEQ  132

Query  555  WALACGEILRILTHYNRP  608
            WALACGEILRILTHYNRP
Sbjct  133  WALACGEILRILTHYNRP  150



>ref|XP_003556164.1| PREDICTED: protein GIGANTEA isoformX1 [Glycine max]
 ref|XP_006606175.1| PREDICTED: protein GIGANTEA isoform X2 [Glycine max]
 ref|XP_006606176.1| PREDICTED: protein GIGANTEA isoform X3 [Glycine max]
 ref|XP_006606177.1| PREDICTED: protein GIGANTEA isoform X4 [Glycine max]
 gb|ACA24489.1| gigantea-like protein 1 [Glycine max]
Length=1175

 Score =   248 bits (634),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWIDRLQ+SSLFWPPP D QQR DQI AYVEYF QFTSE F +DIAELIRNRYPSK+  
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNRYPSKDIL  72

Query  375  LFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SEQ
Sbjct  73   LFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEQ  132

Query  555  WALACGEILRILTHYNRP  608
            WALACGEILRILTHYNRP
Sbjct  133  WALACGEILRILTHYNRP  150



>gb|ACJ65312.1| GI1 protein [Glycine max]
Length=1176

 Score =   248 bits (634),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWIDRLQ+SSLFWPPP D QQR DQI AYVEYF QFTSE F +DIAELIRNRYPSK+  
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNRYPSKDIL  72

Query  375  LFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SEQ
Sbjct  73   LFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEQ  132

Query  555  WALACGEILRILTHYNRP  608
            WALACGEILRILTHYNRP
Sbjct  133  WALACGEILRILTHYNRP  150



>ref|XP_010097648.1| hypothetical protein L484_023788 [Morus notabilis]
 gb|EXB70603.1| hypothetical protein L484_023788 [Morus notabilis]
Length=1195

 Score =   248 bits (633),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA + ERWIDRLQFSSLF  P QDA Q+  Q+ AYV+YFGQFTSE FP+DIAELIRNRYP
Sbjct  1    MADTRERWIDRLQFSSLFCHPSQDAHQKKAQVIAYVDYFGQFTSEQFPDDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE+RLFDDVLATF+LHHPEHGHAV+ PIIS IIDGTL YD+ +PPFASFISLVCP+S+N
Sbjct  61   SKEHRLFDDVLATFVLHHPEHGHAVVLPIISGIIDGTLVYDRTTPPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>gb|AFK65758.1| GIGANTEA, partial [Chrysanthemum x morifolium]
Length=1151

 Score =   247 bits (630),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA +  RW D LQ SSLF PPP D QQR +QITAYV+YFGQFTSE FPEDIAEL+R+ YP
Sbjct  2    MADTSTRWTDSLQLSSLFSPPPLDTQQRKEQITAYVDYFGQFTSEQFPEDIAELVRHHYP  61

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+E RLFDDVLATF+LHHPEHGH+VI PIISCIIDGT+EYD+++PPFASFISLVCP++  
Sbjct  62   SQEKRLFDDVLATFVLHHPEHGHSVILPIISCIIDGTMEYDRSTPPFASFISLVCPSTDK  121

Query  540  ELSEQWALACGEILRILTHYNRPGLXS  620
            E SEQWALACGEILR+LTHYNRP L +
Sbjct  122  EYSEQWALACGEILRVLTHYNRPILKA  148



>gb|EPS65289.1| hypothetical protein M569_09488 [Genlisea aurea]
Length=305

 Score =   232 bits (592),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA  E+W D LQFSSLFWPPPQD  QR  Q+ A+VEYFGQFTSE FP++IAELIR+RYP
Sbjct  1    MAALTEKWTDSLQFSSLFWPPPQDEGQRKAQVAAFVEYFGQFTSEQFPDEIAELIRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+ +RLFDDVLATF+LHHPEHGH VI PIISC+ID ++EYDK+  PF+SFISL   N++N
Sbjct  61   SQRSRLFDDVLATFVLHHPEHGHDVILPIISCVIDSSVEYDKDGAPFSSFISLFSLNTEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILRILTHYNRP
Sbjct  121  DYSEQWALACGEILRILTHYNRP  143



>ref|XP_010681263.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
 ref|XP_010681268.1| PREDICTED: protein GIGANTEA [Beta vulgaris subsp. vulgaris]
Length=1178

 Score =   246 bits (629),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWID LQFSSLFWPPPQ+ QQR  Q TAYVEYFGQF SE FPED+AELIR+RYP  E R
Sbjct  6    ERWIDGLQFSSLFWPPPQETQQRKAQTTAYVEYFGQFISEQFPEDLAELIRSRYPFDEKR  65

Query  375  LFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LFDDVLATF+LHHPEHGHAV+ PIIS IIDGTL YDK  PPFASFISL CPN +NE SEQ
Sbjct  66   LFDDVLATFVLHHPEHGHAVVLPIISIIIDGTLVYDKERPPFASFISLFCPNDENEYSEQ  125

Query  555  WALACGEILRILTHYNRP  608
            WALACGEILRILTHYNRP
Sbjct  126  WALACGEILRILTHYNRP  143



>gb|KCW69153.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1167

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  186  ASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSK  365
            A+CERWID LQ+SSLFWPPPQD  Q+  Q+ AYVE FGQFTSE FP+DIAELIR+RYPSK
Sbjct  2    AACERWIDGLQYSSLFWPPPQDILQKKAQVNAYVELFGQFTSEQFPDDIAELIRSRYPSK  61

Query  366  ENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNEL  545
            E  LFDDVLATF+LHHPEHGHAV+ PIISC+IDG+L YD++ PPFASFISLVCP+S+NE 
Sbjct  62   EKCLFDDVLATFVLHHPEHGHAVVLPIISCLIDGSLVYDRDKPPFASFISLVCPSSENEY  121

Query  546  SEQWALACGEILRILTHYNRP  608
            SEQWALACGEILR+LT YNRP
Sbjct  122  SEQWALACGEILRMLTLYNRP  142



>ref|XP_010062087.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062088.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 ref|XP_010062089.1| PREDICTED: protein GIGANTEA isoform X1 [Eucalyptus grandis]
 gb|KCW69154.1| hypothetical protein EUGRSUZ_F02686 [Eucalyptus grandis]
Length=1166

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  186  ASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSK  365
            A+CERWID LQ+SSLFWPPPQD  Q+  Q+ AYVE FGQFTSE FP+DIAELIR+RYPSK
Sbjct  2    AACERWIDGLQYSSLFWPPPQDILQKKAQVNAYVELFGQFTSEQFPDDIAELIRSRYPSK  61

Query  366  ENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNEL  545
            E  LFDDVLATF+LHHPEHGHAV+ PIISC+IDG+L YD++ PPFASFISLVCP+S+NE 
Sbjct  62   EKCLFDDVLATFVLHHPEHGHAVVLPIISCLIDGSLVYDRDKPPFASFISLVCPSSENEY  121

Query  546  SEQWALACGEILRILTHYNRP  608
            SEQWALACGEILR+LT YNRP
Sbjct  122  SEQWALACGEILRMLTLYNRP  142



>dbj|BAN82589.1| gigantea [Glycine max]
Length=1171

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 125/144 (87%), Gaps = 1/144 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAE-LIRNRY  356
            MAAS ERWIDRLQ+SSLFWPPP D QQR DQI AYVEYF QFTSE F +DIAE LIRN Y
Sbjct  1    MAASSERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAEVLIRNHY  60

Query  357  PSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQ  536
            PSK+  LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +
Sbjct  61   PSKDILLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIE  120

Query  537  NELSEQWALACGEILRILTHYNRP  608
            NE SE+WALACGEILRILTHYNRP
Sbjct  121  NEYSEEWALACGEILRILTHYNRP  144



>gb|AGU91438.1| GIGANTEA-like protein, partial [Chrysanthemum boreale]
Length=949

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERWID LQFSSLF PPPQD  QR  QITAYV+YF QFTSE FPEDIAEL+RNRYP
Sbjct  1    MAATSERWIDGLQFSSLFRPPPQDPDQRKAQITAYVDYFAQFTSEQFPEDIAELVRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S E RL DDVLA F+LHHPEHG AV+ PIISCIIDGT+EY++++PPFASFISL+CP++ N
Sbjct  61   SSEKRLIDDVLAMFVLHHPEHGDAVMLPIISCIIDGTIEYERSTPPFASFISLICPSTDN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALAC EILR+LTHYNRP
Sbjct  121  EYSEQWALACVEILRMLTHYNRP  143



>gb|KFK44368.1| gigantea [Arabis alpina]
Length=1173

 Score =   245 bits (625),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R +YP
Sbjct  1    MATSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRQQYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N
Sbjct  61   SNEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILRILTHYNRP
Sbjct  121  DYSEQWALACGEILRILTHYNRP  143



>ref|XP_006416158.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34511.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
Length=984

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YP
Sbjct  1    MATSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S E RL DDVLA F+LHHPEHGHAVI P+ISC+IDG+L Y K + PFASFISLVCP+S+N
Sbjct  61   STEKRLLDDVLAMFVLHHPEHGHAVILPMISCLIDGSLVYSKEAHPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILRILTHYNRP
Sbjct  121  DYSEQWALACGEILRILTHYNRP  143



>gb|ACJ09478.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09484.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09485.1| putative gigantea, partial [Oryza sativa Indica Group]
 gb|ACJ09486.1| putative gigantea, partial [Oryza sativa Indica Group]
 gb|ACJ09487.1| putative gigantea, partial [Oryza sativa]
 gb|ACJ09489.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09490.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09491.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09492.1| putative gigantea, partial [Oryza sativa Japonica Group]
 gb|ACJ09493.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   227 bits (578),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD+QQ+  QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>gb|KHN17039.1| Protein GIGANTEA [Glycine soja]
Length=1149

 Score =   244 bits (623),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWIDRLQ+SSLFWPPP D QQR DQI AYVEYF QFTSE F +DIAELIRN YPSK+  
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNHYPSKDIL  72

Query  375  LFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE+
Sbjct  73   LFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEE  132

Query  555  WALACGEILRILTHYNRP  608
            WALACGEILRILTHYNRP
Sbjct  133  WALACGEILRILTHYNRP  150



>gb|ACJ09482.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   226 bits (577),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD+QQ+  QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTANSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>ref|XP_006588466.1| PREDICTED: uncharacterized protein LOC100800578 isoform X1 [Glycine 
max]
 ref|XP_006588467.1| PREDICTED: uncharacterized protein LOC100800578 isoform X2 [Glycine 
max]
 ref|XP_006588468.1| PREDICTED: uncharacterized protein LOC100800578 isoform X3 [Glycine 
max]
Length=1177

 Score =   244 bits (623),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWIDRLQ+SSLFWPPP D QQR DQI AYVEYF QFTSE F +DIAELIRN YPSK+  
Sbjct  13   ERWIDRLQYSSLFWPPPPDGQQRKDQIAAYVEYFIQFTSEQFADDIAELIRNHYPSKDIL  72

Query  375  LFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YDK SPPFASFIS VCP  +NE SE+
Sbjct  73   LFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEE  132

Query  555  WALACGEILRILTHYNRP  608
            WALACGEILRILTHYNRP
Sbjct  133  WALACGEILRILTHYNRP  150



>ref|XP_009631432.1| PREDICTED: protein GIGANTEA-like isoform X3 [Nicotiana tomentosiformis]
Length=1165

 Score =   244 bits (623),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 127/157 (81%), Gaps = 22/157 (14%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+CERWID LQFSSLFWPPPQDAQQR  QITAYVEYFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MAATCERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPEDIAELIRHRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQ-  536
            SKENRLFDDVL        EHGHAVI PIISCIIDGTL+YDK+ PPFASFISLVCP+S+ 
Sbjct  61   SKENRLFDDVL--------EHGHAVILPIISCIIDGTLDYDKSCPPFASFISLVCPSSEV  112

Query  537  -------------NELSEQWALACGEILRILTHYNRP  608
                          E SEQWALACGEILRILTHYNRP
Sbjct  113  LRILNYQFEGLSHKEYSEQWALACGEILRILTHYNRP  149



>gb|ACJ09481.1| putative gigantea, partial [Oryza sativa Indica Group]
Length=208

 Score =   226 bits (577),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD+QQ+  Q+ AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQVLAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>ref|XP_006416159.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 ref|XP_006416160.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34512.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
 gb|ESQ34513.1| hypothetical protein EUTSA_v10006603mg [Eutrema salsugineum]
Length=1171

 Score =   243 bits (621),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YP
Sbjct  1    MATSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S E RL DDVLA F+LHHPEHGHAVI P+ISC+IDG+L Y K + PFASFISLVCP+S+N
Sbjct  61   STEKRLLDDVLAMFVLHHPEHGHAVILPMISCLIDGSLVYSKEAHPFASFISLVCPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILRILTHYNRP
Sbjct  121  DYSEQWALACGEILRILTHYNRP  143



>ref|XP_009335139.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
 ref|XP_009335140.1| PREDICTED: protein GIGANTEA-like [Pyrus x bretschneideri]
Length=1169

 Score =   243 bits (621),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERW DRLQ SSLF PPPQD   R  QITAYV+YFGQFTSE FPEDIAELIRNRYP
Sbjct  1    MAATSERWFDRLQCSSLFGPPPQDTLPRKAQITAYVDYFGQFTSEQFPEDIAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+  RLFDDVLA F+LHHPEHGHAVI PIISCIIDGTL Y  +SPPFASFISLVCP+S+ 
Sbjct  61   SEVKRLFDDVLAMFVLHHPEHGHAVILPIISCIIDGTLAYKSSSPPFASFISLVCPSSE-  119

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  120  EYSEQWALACGEILRILTHYNRP  142



>gb|ACT22764.1| GIGANTEA [Allium cepa]
Length=1109

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+  CE+WID LQ+SSL WPPPQD  QR  QI AYVEYFGQFTSE FPED+A+LI+N YP
Sbjct  1    MSVVCEKWIDGLQYSSLLWPPPQDEHQRQAQILAYVEYFGQFTSEQFPEDVAQLIQNHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RL D+VLATF+LHHPEHGHA++HPI+SCIIDGTL YDK+ PPF+SFISL   NS+ 
Sbjct  61   SKEQRLLDEVLATFVLHHPEHGHAIVHPILSCIIDGTLVYDKHDPPFSSFISLFNQNSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILR+LTHYNRP
Sbjct  121  EYSEQWALACGEILRVLTHYNRP  143



>gb|ACJ09488.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD+QQ+  QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRALTHYNRP  145



>ref|XP_006306336.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
 gb|EOA39234.1| hypothetical protein CARUB_v10012213mg [Capsella rubella]
Length=1171

 Score =   242 bits (618),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            A S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  3    ATSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  63   NEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  122

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  123  YSEQWALACGEILRILTHYNRP  144



>gb|ACJ09480.1| putative gigantea, partial [Oryza sativa Indica Group]
Length=208

 Score =   224 bits (571),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQF SLFWPPPQD+QQ+  QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFPSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>gb|ABP96488.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   241 bits (616),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>gb|AAF00023.1| GIGANTEA [Arabidopsis thaliana]
Length=1155

 Score =   241 bits (615),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>gb|ACT22765.1| GIGANTEA [Allium cepa]
Length=1109

 Score =   241 bits (614),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+  CE+WID L++SSL WPPPQD  QR  QI AYVEYFGQFTSE FPED+A+LI+N YP
Sbjct  1    MSVVCEKWIDGLRYSSLLWPPPQDEHQRQAQILAYVEYFGQFTSEQFPEDVAQLIQNHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RL D+VLATF+LHHPEHGHA++HPI+SCIIDGTL YDK+ PPF+SFISL   NS+ 
Sbjct  61   SKEQRLLDEVLATFVLHHPEHGHAIVHPILSCIIDGTLVYDKHDPPFSSFISLFNQNSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILR+LTHYNRP
Sbjct  121  EYSEQWALACGEILRVLTHYNRP  143



>gb|ABP96485.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96486.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96499.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   241 bits (616),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>gb|ABP96484.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96487.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96489.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96500.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96501.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   241 bits (616),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>gb|ABP96483.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96490.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96491.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96492.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96493.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96494.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96495.1| GIGANTEA, partial [Arabidopsis thaliana]
 gb|ABP96502.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   241 bits (616),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>ref|NP_564180.1| protein GIGANTEA [Arabidopsis thaliana]
 sp|Q9SQI2.2|GIGAN_ARATH RecName: Full=Protein GIGANTEA [Arabidopsis thaliana]
 gb|AAF00092.1|AF105064_1 GIGANTEA [Arabidopsis thaliana]
 emb|CAB56039.1| gigantea protein [Arabidopsis thaliana]
 gb|AAT97405.1| gigantea [Arabidopsis thaliana]
 gb|AEE30286.1| gigantea protein (GI) [Arabidopsis thaliana]
Length=1173

 Score =   241 bits (616),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>gb|ABP96498.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   241 bits (615),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>gb|ABP96497.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   241 bits (615),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>gb|AAT97404.1| gigantea [Arabidopsis thaliana]
Length=1173

 Score =   241 bits (615),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>gb|ABP96482.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   241 bits (615),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>ref|XP_008386373.1| PREDICTED: protein GIGANTEA-like [Malus domestica]
Length=1169

 Score =   241 bits (615),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MAA+ ERW DRLQFSSLF PPP D  +R  +ITAYV+YFGQFTSE FPED+AELIRNRYP
Sbjct  1    MAATSERWFDRLQFSSLFGPPPPDNLRRKAEITAYVDYFGQFTSEQFPEDVAELIRNRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+  RLFDDVLA F+LHHPEHGHAVI PIISCIIDGTL Y  + PPFASFISLVCP+S+ 
Sbjct  61   SEVKRLFDDVLAMFVLHHPEHGHAVILPIISCIIDGTLAYKSSGPPFASFISLVCPSSE-  119

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  120  EYSEQWALACGEILRILTHYNRP  142



>emb|CAA72908.1| hypothetical protein [Arabidopsis thaliana]
Length=1167

 Score =   241 bits (615),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>gb|ABP96496.1| GIGANTEA, partial [Arabidopsis thaliana]
Length=1172

 Score =   241 bits (614),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASF+SLVCP+S+N+
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFVSLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>gb|AAT80910.1| GIGANTEA [Arabidopsis thaliana]
Length=1173

 Score =   241 bits (614),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASF+SLVCP+S+N+
Sbjct  64   TEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFVSLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>ref|XP_010477545.1| PREDICTED: protein GIGANTEA-like isoform X3 [Camelina sativa]
Length=1169

 Score =   241 bits (614),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            A S ERWID LQFSS+ WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   DEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>ref|XP_010477546.1| PREDICTED: protein GIGANTEA-like isoform X4 [Camelina sativa]
Length=1169

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            A S ERWID LQFSS+ WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   DEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>ref|XP_010498761.1| PREDICTED: protein GIGANTEA [Camelina sativa]
Length=1169

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            A S ERWID LQFSS+ WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   DEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>dbj|BAD97864.1| GI homologue 1 [Lemna paucicostata]
Length=1115

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M AS ERWID LQFSSLFWPPP D QQR  Q  AYVEYF QFTSE FPED+A+LI+N YP
Sbjct  1    MVASTERWIDGLQFSSLFWPPPPDEQQRQAQTMAYVEYFVQFTSERFPEDVAQLIQNNYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RL DDVLATF+LHHPEH HA++HPI+SCIIDG+L YDKN PPF+SFISLV  N++ 
Sbjct  61   SKEIRLLDDVLATFVLHHPEHSHAIVHPILSCIIDGSLLYDKNEPPFSSFISLVGQNNEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWA+ACGEILR+LTHYNRP
Sbjct  121  EYSEQWAMACGEILRVLTHYNRP  143



>ref|XP_010462850.1| PREDICTED: protein GIGANTEA-like [Camelina sativa]
Length=1138

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            A S ERWID LQFSS+ WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+
Sbjct  64   DEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEND  123

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWALACGEILRILTHYNRP
Sbjct  124  YSEQWALACGEILRILTHYNRP  145



>ref|XP_004139688.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
Length=1168

 Score =   240 bits (612),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWIDRLQ SSLFWPPP D QQR  Q +AYVEY GQFTSE F EDIAELIR R+ 
Sbjct  1    MATSSERWIDRLQLSSLFWPPPDDDQQRKVQCSAYVEYLGQFTSERFSEDIAELIRIRFQ  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RLFDDVLA F+LHHPE+GHA+I PIISCI DG LEY++N PPFASFISL CP  +N
Sbjct  61   SKEKRLFDDVLALFVLHHPENGHAIILPIISCIFDGALEYNRNDPPFASFISLFCPGIEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILRILTHYNRP
Sbjct  121  DYSEQWALACGEILRILTHYNRP  143



>ref|XP_002890532.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66791.1| hypothetical protein ARALYDRAFT_889789 [Arabidopsis lyrata subsp. 
lyrata]
Length=1174

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS E R
Sbjct  9    ERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPSTEKR  68

Query  375  LFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            L DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQ
Sbjct  69   LLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQ  128

Query  555  WALACGEILRILTHYNRP  608
            WALACGEILRILTHYNRP
Sbjct  129  WALACGEILRILTHYNRP  146



>ref|XP_009115601.1| PREDICTED: protein GIGANTEA [Brassica rapa]
Length=1171

 Score =   239 bits (609),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  SCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKE  368
            S ERW D LQFSSL W PP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+RN+YPS E
Sbjct  6    SSERWTDGLQFSSLLWSPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRNQYPSTE  65

Query  369  NRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELS  548
             RL DDVLA F+LHHPEHGHAVI PIISC+IDGTL Y K + PFASFISLV PNS+N+ S
Sbjct  66   KRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGTLVYSKEAHPFASFISLVSPNSENDYS  125

Query  549  EQWALACGEILRILTHYNRP  608
            EQWALACGEILRILTHYNRP
Sbjct  126  EQWALACGEILRILTHYNRP  145



>ref|NP_001288824.1| protein GIGANTEA [Brassica rapa]
 gb|AEB33730.1| GIGANTEA [Brassica rapa]
Length=1183

 Score =   239 bits (609),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  SCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKE  368
            S ERW D LQFSSL W PP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+RN+YPS E
Sbjct  6    SSERWTDGLQFSSLLWSPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRNQYPSTE  65

Query  369  NRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELS  548
             RL DDVLA F+LHHPEHGHAVI PIISC+IDGTL Y K + PFASFISLV PNS+N+ S
Sbjct  66   KRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGTLVYSKEAHPFASFISLVSPNSENDYS  125

Query  549  EQWALACGEILRILTHYNRP  608
            EQWALACGEILRILTHYNRP
Sbjct  126  EQWALACGEILRILTHYNRP  145



>gb|ACJ09483.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   221 bits (563),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+A  E+WID LQFSSLFWPPPQD+QQ+  QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSAPNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEI R+LTHYNRP
Sbjct  121  EKEYSEQWALACGEIPRVLTHYNRP  145



>emb|CDY21388.1| BnaA09g30390D [Brassica napus]
Length=1171

 Score =   238 bits (608),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  SCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKE  368
            S ERW D LQFSSL W PP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+RN+YPS E
Sbjct  6    SSERWTDGLQFSSLLWSPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRNQYPSTE  65

Query  369  NRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELS  548
             RL DDVLA F+LHHPEHGHAVI PIISC+IDGTL Y K + PFASFISLV PNS+N+ S
Sbjct  66   KRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGTLVYSKEAHPFASFISLVSPNSENDYS  125

Query  549  EQWALACGEILRILTHYNRP  608
            EQWALACGEILRILTHYNRP
Sbjct  126  EQWALACGEILRILTHYNRP  145



>gb|ABP96481.1| GIGANTEA [Arabidopsis lyrata subsp. petraea]
Length=1173

 Score =   238 bits (607),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ERWID LQFSSL WPPP+D QQ  DQ+ AYV+YFGQFTSE FP+DIAEL+R++YPS E R
Sbjct  9    ERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVDYFGQFTSEQFPDDIAELVRHQYPSTEKR  68

Query  375  LFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            L DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S+N+ SEQ
Sbjct  69   LLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQ  128

Query  555  WALACGEILRILTHYNRP  608
            WALACGEILRILTHYNRP
Sbjct  129  WALACGEILRILTHYNRP  146



>ref|XP_004160322.1| PREDICTED: protein GIGANTEA-like, partial [Cucumis sativus]
Length=994

 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWIDRLQFSSLFW PP+D QQR  +IT YVE  GQFTSE FPEDIAELIR+ YP
Sbjct  2    MASSSERWIDRLQFSSLFWTPPRDEQQRKAEITTYVECLGQFTSEQFPEDIAELIRSHYP  61

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
             KE RL DDVLATF+LHHPEHGHAVI PIISCIIDGT+ Y K+  PF+SFISL CP++++
Sbjct  62   WKEKRLIDDVLATFVLHHPEHGHAVILPIISCIIDGTMVYCKDGSPFSSFISLFCPDTEH  121

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILRILTHYNRP
Sbjct  122  DYSEQWALACGEILRILTHYNRP  144



>ref|XP_010477544.1| PREDICTED: protein GIGANTEA-like isoform X2 [Camelina sativa]
Length=1170

 Score =   237 bits (605),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            A S ERWID LQFSS+ WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS-QN  539
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S QN
Sbjct  64   DEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEQN  123

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILRILTHYNRP
Sbjct  124  DYSEQWALACGEILRILTHYNRP  146



>ref|XP_010477543.1| PREDICTED: protein GIGANTEA-like isoform X1 [Camelina sativa]
Length=1170

 Score =   237 bits (605),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            A S ERWID LQFSS+ WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    ATSSERWIDGLQFSSVLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS-QN  539
             E RL DDVLA F+LHHPEHGHAVI PIISC+IDG+L Y K + PFASFISLVCP+S QN
Sbjct  64   DEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSEQN  123

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILRILTHYNRP
Sbjct  124  DYSEQWALACGEILRILTHYNRP  146



>dbj|BAD97869.1| GI homologue [Lemna gibba]
Length=1116

 Score =   237 bits (604),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M +S ERWID LQF SLFWPPPQD QQR  Q TAYVEYF QFTSE FPED+A+LI+N YP
Sbjct  1    MPSSTERWIDGLQFPSLFWPPPQDEQQRQAQTTAYVEYFVQFTSERFPEDVAQLIQNHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE+RL D+VLATF+LHHPEHGHA++HP +SCII+G+L Y KN PPF SFISLV  N++ 
Sbjct  61   SKESRLLDEVLATFVLHHPEHGHAIVHPTLSCIIEGSLVYSKNVPPFNSFISLVSQNNEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILR+LTHYNRP
Sbjct  121  EYSEQWALACGEILRVLTHYNRP  143



>ref|XP_004140955.1| PREDICTED: protein GIGANTEA-like [Cucumis sativus]
 gb|KGN46115.1| hypothetical protein Csa_6G055360 [Cucumis sativus]
Length=1170

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWIDRLQFSSLFW PP+D QQR  +IT YVE  GQFTSE FPEDIAELIR+ YP
Sbjct  2    MASSSERWIDRLQFSSLFWTPPRDEQQRKAEITTYVECLGQFTSEQFPEDIAELIRSHYP  61

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
             KE RL DDVLATF+LHHPEHGHAVI PIISCIIDGT+ Y K+  PF+SFISL CP++++
Sbjct  62   WKEKRLIDDVLATFVLHHPEHGHAVILPIISCIIDGTMVYCKDGSPFSSFISLFCPDTEH  121

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILRILTHYNRP
Sbjct  122  DYSEQWALACGEILRILTHYNRP  144



>ref|XP_008456743.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456744.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
 ref|XP_008456745.1| PREDICTED: protein GIGANTEA-like [Cucumis melo]
Length=1170

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S ERWIDRLQFSSLFW PP+D QQR  +IT YVE  GQFTSE FPEDIAELIR+ YP
Sbjct  2    MASSSERWIDRLQFSSLFWTPPRDEQQRKAEITTYVECLGQFTSEQFPEDIAELIRSHYP  61

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
             +E RL DDVLATF+LHHPEHGHAVI PIISCIIDGT+ Y K+  PF+SFISL CP++++
Sbjct  62   WREKRLIDDVLATFVLHHPEHGHAVILPIISCIIDGTMAYCKDGSPFSSFISLFCPDTEH  121

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILRILTHYNRP
Sbjct  122  DYSEQWALACGEILRILTHYNRP  144



>emb|CDY04787.1| BnaC05g18020D [Brassica napus]
Length=1170

 Score =   236 bits (602),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  189  SCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKE  368
            S ERW D LQFSSL W PP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+RN+YPS E
Sbjct  6    SSERWTDGLQFSSLLWSPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRNQYPSTE  65

Query  369  NRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELS  548
             RL DDVLA F+LHHPEHGHAVI PIISC+IDGTL Y K + PFASFISLV P S+N+ S
Sbjct  66   KRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGTLVYSKEAHPFASFISLVSPTSENDYS  125

Query  549  EQWALACGEILRILTHYNRP  608
            EQWALACGEILRILTHYNRP
Sbjct  126  EQWALACGEILRILTHYNRP  145



>ref|XP_009408935.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1163

 Score =   235 bits (600),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S E+WID LQFSSLFWPPPQD  QR  Q+ AYVEYF QFTSE FPEDIA+LI++ YP
Sbjct  1    MAVSNEKWIDGLQFSSLFWPPPQDETQRQAQVLAYVEYFSQFTSEEFPEDIAQLIQSHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RL D+VLA F+LHHPEHGHA++HPI+S IIDGTL Y++N+PPF+SFISLV  NS+ 
Sbjct  61   SKEKRLLDEVLALFILHHPEHGHAIVHPILSLIIDGTLVYNRNNPPFSSFISLVSQNSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILRILTHYNRP
Sbjct  121  QCSEQWALACGEILRILTHYNRP  143



>ref|XP_010915066.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1171

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+ S E+WID LQFSSL WPPPQD QQR  QI AYVEYFGQF SE FPED+A+LI+N YP
Sbjct  1    MSVSNEKWIDGLQFSSLLWPPPQDEQQRQAQIVAYVEYFGQFISEQFPEDVAQLIQNYYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RL DDVLA F+LHHPEHGHA++HPI+S IIDGTL YDKN PPF+SFISL   N++ 
Sbjct  61   SKEKRLLDDVLAIFVLHHPEHGHAIVHPILSRIIDGTLVYDKNDPPFSSFISLFSQNNEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + +EQWALACGEILR+LTHYNRP
Sbjct  121  DYNEQWALACGEILRVLTHYNRP  143



>ref|XP_009408933.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009408934.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1205

 Score =   235 bits (600),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S E+WID LQFSSLFWPPPQD  QR  Q+ AYVEYF QFTSE FPEDIA+LI++ YP
Sbjct  1    MAVSNEKWIDGLQFSSLFWPPPQDETQRQAQVLAYVEYFSQFTSEEFPEDIAQLIQSHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RL D+VLA F+LHHPEHGHA++HPI+S IIDGTL Y++N+PPF+SFISLV  NS+ 
Sbjct  61   SKEKRLLDEVLALFILHHPEHGHAIVHPILSLIIDGTLVYNRNNPPFSSFISLVSQNSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILRILTHYNRP
Sbjct  121  QCSEQWALACGEILRILTHYNRP  143



>ref|XP_008786518.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786528.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
 ref|XP_008786537.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1170

 Score =   233 bits (594),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+ S  +WID LQFSSL WPPP D QQR  QITAYVEYFGQFTSE FPED+A+LI+N YP
Sbjct  1    MSISYGKWIDGLQFSSLLWPPPHDEQQRQAQITAYVEYFGQFTSEQFPEDVAQLIQNYYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RL D+VLA F+LHHPEHGHA++HPI+S IIDGTL YDKN PPF+SFI LV  N++ 
Sbjct  61   SKEKRLLDEVLAIFVLHHPEHGHAIVHPILSRIIDGTLVYDKNDPPFSSFIYLVSQNNEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E +EQWALACGEILR+LTHYNRP
Sbjct  121  EYNEQWALACGEILRVLTHYNRP  143



>ref|XP_009381150.1| PREDICTED: protein GIGANTEA-like [Musa acuminata subsp. malaccensis]
Length=1171

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+ S E+WID LQFSSLFWPPPQD  QR  Q+ AYVEYF QFT+E FPEDI +LI+  YP
Sbjct  1    MSISNEKWIDGLQFSSLFWPPPQDENQRQAQVLAYVEYFSQFTTEEFPEDITQLIQTHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S+E RL D+VLA F+LHHPEHGHA++HPI+S IIDGTL YD+N PPF+SFISLV  NS+ 
Sbjct  61   SQEKRLLDEVLAIFILHHPEHGHAIVHPILSLIIDGTLVYDRNDPPFSSFISLVGQNSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILRILTHYNRP
Sbjct  121  EYSEQWALACGEILRILTHYNRP  143



>ref|XP_008793464.1| PREDICTED: protein GIGANTEA-like [Phoenix dactylifera]
Length=1169

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+ S E+WID LQFSSL W PPQD +QR  QI AYVEYFGQFTSE FPED+A+LI+N YP
Sbjct  1    MSVSNEKWIDGLQFSSLLWRPPQDERQRQAQIVAYVEYFGQFTSEQFPEDVAQLIQNYYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RL DDVLA F+LHHPEHGHA++HPI+S IIDGTL YDKN PPF+SFISL   N++ 
Sbjct  61   SKEKRLLDDVLAIFVLHHPEHGHAIVHPILSRIIDGTLVYDKNDPPFSSFISLFSQNNEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + +EQWALACGEILR+LTHYNRP
Sbjct  121  DYNEQWALACGEILRVLTHYNRP  143



>ref|XP_010925341.1| PREDICTED: protein GIGANTEA-like [Elaeis guineensis]
Length=1170

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+ S E+WID LQFSSLFWPPPQD QQR  QI AYVEYFGQFTSE FPED+A+LI+N YP
Sbjct  1    MSVSYEKWIDGLQFSSLFWPPPQDEQQRQVQIMAYVEYFGQFTSERFPEDVAQLIQNYYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
             KE RL D+VLA F+LHHPEHGHA++HPI+S IIDGTL YDKN PPF SFI LV  N++ 
Sbjct  61   YKEKRLLDEVLAIFVLHHPEHGHAIVHPILSRIIDGTLVYDKNDPPFCSFIYLVSQNNEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E +EQWALAC EILR+LTHYNRP
Sbjct  121  EYNEQWALACAEILRVLTHYNRP  143



>pir||T00767 hypothetical protein T22J18.6 - Arabidopsis thaliana
 gb|AAC25507.1|AAC25507 T22J18.6 [Arabidopsis thaliana]
Length=1070

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 123/154 (80%), Gaps = 12/154 (8%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            ++S ERWID LQFSSL WPPP+D QQ  DQ+ AYVEYFGQFTSE FP+DIAEL+R++YPS
Sbjct  4    SSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPS  63

Query  363  KENRLFDDVLAT------------FLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFAS  506
             E RL DDVL              F+LHHPEHGHAVI PIISC+IDG+L Y K + PFAS
Sbjct  64   TEKRLLDDVLGMINIYDPHFSFSMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFAS  123

Query  507  FISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            FISLVCP+S+N+ SEQWALACGEILRILTHYNRP
Sbjct  124  FISLVCPSSENDYSEQWALACGEILRILTHYNRP  157



>ref|NP_001042220.1| Os01g0182600 [Oryza sativa Japonica Group]
 sp|Q9AWL7.2|GIGAN_ORYSJ RecName: Full=Protein GIGANTEA [Oryza sativa Japonica Group]
 dbj|BAD68052.1| putative gigantea [Oryza sativa Japonica Group]
 dbj|BAF04134.1| Os01g0182600 [Oryza sativa Japonica Group]
Length=1160

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD+QQ+  QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>gb|EEE54000.1| hypothetical protein OsJ_00641 [Oryza sativa Japonica Group]
Length=1176

 Score =   230 bits (586),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD+QQ+  QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>gb|EEC70061.1| hypothetical protein OsI_00663 [Oryza sativa Indica Group]
Length=1176

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD+QQ+  QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>gb|ADP92454.1| GIGANTEA 1 [x Doritaenopsis hybrid cultivar]
Length=1160

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M++S ++WID LQFSSL WPPPQD QQR  QI AYVEYF QFTSE FPEDIA+LI+  YP
Sbjct  1    MSSSSQKWIDGLQFSSLLWPPPQDEQQRQVQIMAYVEYFAQFTSEQFPEDIAQLIQRHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
             KE R+ DDVLA F+LHHPEHGHA++HPI+SCIIDGTL + KN+PPF+SFISL+   ++ 
Sbjct  61   VKEKRVLDDVLAIFVLHHPEHGHAIVHPILSCIIDGTLVHGKNNPPFSSFISLIGQTTEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILR+LT YNRP
Sbjct  121  EYSEQWALACGEILRVLTLYNRP  143



>ref|XP_006643836.1| PREDICTED: protein GIGANTEA-like isoform X1 [Oryza brachyantha]
 ref|XP_006643837.1| PREDICTED: protein GIGANTEA-like isoform X2 [Oryza brachyantha]
Length=1162

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD QQ+  QI AYVEYFGQFT  SE FPEDIA+LI++ 
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDVQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGT+ YD+N  PF SFISL    S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTMSYDRNGFPFKSFISLFSHTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>gb|ACJ65314.1| GI3 protein [Glycine max]
Length=1155

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 116/142 (82%), Gaps = 11/142 (8%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPS  362
            AAS ERW+DRLQFSSLFWPPP D QQR DQ+ AYVEY GQFTSE F EDIAELIRN YPS
Sbjct  3    AASGERWMDRLQFSSLFWPPPLDDQQRKDQVAAYVEYIGQFTSEQFSEDIAELIRNHYPS  62

Query  363  KENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNE  542
            KE  LFDD           HGHAV+ PIISCIIDGTL+YDK SPPFASFISLVCP ++NE
Sbjct  63   KEMLLFDD-----------HGHAVVLPIISCIIDGTLDYDKTSPPFASFISLVCPKNENE  111

Query  543  LSEQWALACGEILRILTHYNRP  608
             SEQWA+ACGEILRILTHYNRP
Sbjct  112  YSEQWAMACGEILRILTHYNRP  133



>ref|XP_010535090.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535098.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
 ref|XP_010535104.1| PREDICTED: protein GIGANTEA [Tarenaya hassleriana]
Length=1167

 Score =   227 bits (579),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+S E+WID LQFSSLFWPPPQD QQR DQ+ AYVEYFGQFTSE FPEDIAEL+RN+YP
Sbjct  1    MASSSEKWIDGLQFSSLFWPPPQDPQQRQDQVIAYVEYFGQFTSEQFPEDIAELVRNQYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            S E RL DDV+A F+LHHPEHGHAVI PII+CIIDG+L Y+K +PPFASFISLVC +S+N
Sbjct  61   STEKRLLDDVMAMFVLHHPEHGHAVILPIIACIIDGSLVYNKETPPFASFISLVCSSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILRILTHYNRP
Sbjct  121  DYSEQWALACGEILRILTHYNRP  143



>ref|XP_002524341.1| Protein GIGANTEA, putative [Ricinus communis]
 gb|EEF38081.1| Protein GIGANTEA, putative [Ricinus communis]
Length=1161

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 119/141 (84%), Gaps = 7/141 (5%)
 Frame = +3

Query  186  ASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSK  365
            AS ERWID LQFSSLFWPPPQDAQQR  QITAYVEYFGQFTSE FP+DIAE+  + +   
Sbjct  2    ASSERWIDGLQFSSLFWPPPQDAQQRKAQITAYVEYFGQFTSEQFPDDIAEVTASHF---  58

Query  366  ENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNEL  545
                F    ATF+LHHPEHGHAV+ PIISC+IDGTL YD+++PPFASFISLVCP+S+NE 
Sbjct  59   ----FSSNPATFVLHHPEHGHAVVLPIISCLIDGTLVYDRSTPPFASFISLVCPSSENEY  114

Query  546  SEQWALACGEILRILTHYNRP  608
            SEQWALACGEILR+LTHYNRP
Sbjct  115  SEQWALACGEILRVLTHYNRP  135



>gb|AAW66945.1| gigantea-like protein [Hordeum vulgare]
 gb|AAW66946.1| gigantea-like protein [Hordeum vulgare subsp. vulgare]
Length=1155

 Score =   224 bits (572),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNR  353
            M+AS  +WID LQFSSLFWPPP DAQQ+  QI AYVEYFGQFTS  E FPED+A+LI+  
Sbjct  1    MSASNGKWIDGLQFSSLFWPPPHDAQQKQAQILAYVEYFGQFTSDSEQFPEDVAQLIQTC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF SFISL   +S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>gb|AFW80279.1| gigantea1A isoform 1 [Zea mays]
 gb|AFW80280.1| gigantea1A isoform 2 [Zea mays]
Length=968

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQF+SL+WPPP DA+Q+  QI AYVEYFGQFT  ++ FPEDIA+LI++ 
Sbjct  1    MSDSNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFTADTDQFPEDIAQLIQSS  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKENRL D+VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF+SFISL   NS
Sbjct  61   YPSKENRLVDEVLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EQEYSEQWALACGEILRVLTHYNRP  145



>gb|AFW80282.1| gigantea1A [Zea mays]
Length=1085

 Score =   222 bits (565),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQF+SL+WPPP DA+Q+  QI AYVEYFGQFT  ++ FPEDIA+LI++ 
Sbjct  1    MSDSNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFTADTDQFPEDIAQLIQSS  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKENRL D+VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF+SFISL   NS
Sbjct  61   YPSKENRLVDEVLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EQEYSEQWALACGEILRVLTHYNRP  145



>ref|NP_001288586.1| gigantea like1a [Zea mays]
 ref|XP_008655715.1| PREDICTED: protein GIGANTEA [Zea mays]
 ref|XP_008655716.1| PREDICTED: protein GIGANTEA [Zea mays]
 tpg|DAA06172.1| TPA_inf: gigantea 1A [Zea mays]
 gb|AFW80283.1| gigantea isoform 1 [Zea mays]
 gb|AFW80284.1| gigantea isoform 2 [Zea mays]
Length=1162

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQF+SL+WPPP DA+Q+  QI AYVEYFGQFT  ++ FPEDIA+LI++ 
Sbjct  1    MSDSNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFTADTDQFPEDIAQLIQSS  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKENRL D+VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF+SFISL   NS
Sbjct  61   YPSKENRLVDEVLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EQEYSEQWALACGEILRVLTHYNRP  145



>gb|AFW80281.1| gigantea1A [Zea mays]
Length=1086

 Score =   222 bits (565),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 123/145 (85%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQF+SL+WPPP DA+Q+  QI AYVEYFGQFT  ++ FPEDIA+LI++ 
Sbjct  1    MSDSNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFTADTDQFPEDIAQLIQSS  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKENRL D+VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF+SFISL   NS
Sbjct  61   YPSKENRLVDEVLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EQEYSEQWALACGEILRVLTHYNRP  145



>gb|AAT79487.1| gigantea 3 [Triticum aestivum]
Length=1155

 Score =   222 bits (565),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNR  353
            M+ S  +WID LQFSSLFWPPP D QQ+  QI AYVEYFGQFTS  E FPED+A+LI++ 
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFTSDSEQFPEDVAQLIQSY  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF SFISL   +S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>gb|AAT79486.1| gigantea 2 [Triticum aestivum]
Length=1153

 Score =   221 bits (564),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNR  353
            M+ S  +WID LQFSSLFWPPP D QQ+  QI AYVEYFGQFTS  E FPED+A+LI++ 
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFTSDSEQFPEDVAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF SFISL   +S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>gb|AIC83986.1| gigantea-like protein [Festuca pratensis]
Length=1149

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNR  353
            M+AS  +WID LQFSSLFWPPP DAQQ+  Q  AYVEYFGQFTS  E FPED+A+LI++ 
Sbjct  1    MSASNGKWIDGLQFSSLFWPPPHDAQQKQAQTLAYVEYFGQFTSDSEQFPEDVAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDG+L YD++  PF SFISL    +
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGSLSYDRHGSPFNSFISLFTQTA  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>ref|XP_003564357.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230544.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230545.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230546.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
 ref|XP_010230547.1| PREDICTED: protein GIGANTEA [Brachypodium distachyon]
Length=1155

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNR  353
            M+AS  +WID LQ+SSLFWPPP DAQQ+  QI AYVEYFGQFTS  E FPED+A+LI++ 
Sbjct  1    MSASNGKWIDGLQYSSLFWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YP+KE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF SFISL    S
Sbjct  61   YPAKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRHGFPFNSFISLFTQTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>emb|CDM81775.1| unnamed protein product [Triticum aestivum]
Length=1155

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNR  353
            M+ S  +WID LQFSSLFWPPP D QQ+  QI AYVEYFGQFTS  E FPED+A+LI++ 
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFTSDSEQFPEDVAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF SFISL   +S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>gb|AAQ11738.1| gigantea [Triticum aestivum]
Length=1155

 Score =   221 bits (563),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNR  353
            M+ S  +WID LQFSSLFWPPP D QQ+  QI AYVEYFGQFTS  E FPED+A+LI++ 
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFTSDSEQFPEDVAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF SFISL   +S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>ref|XP_008672375.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672376.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 ref|XP_008672377.1| PREDICTED: uncharacterized protein LOC100272803 isoform X1 [Zea 
mays]
 tpg|DAA53146.1| TPA: gigantea1B [Zea mays]
Length=1160

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID L F+SL+WPPPQD +Q+  QI AYVEYFGQFT  SE FPED+A+LI++ 
Sbjct  1    MSESNVKWIDGLHFTSLYWPPPQDVEQKQAQILAYVEYFGQFTADSEQFPEDVAQLIQSS  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE+RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++ PPF+SFISL    S
Sbjct  61   YPSKESRLIDEVLATFVLHHPEHGHAVVHPILSPIIDGTLCYDRHGPPFSSFISLFSHTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EQEYSEQWALACGEILRVLTHYNRP  145



>ref|NP_001140728.1| uncharacterized protein LOC100272803 [Zea mays]
 tpg|DAA06171.1| TPA_inf: gigantea 1B [Zea mays]
Length=1160

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID L F+SL+WPPPQD +Q+  QI AYVEYFGQFT  SE FPED+A+LI++ 
Sbjct  1    MSESNVKWIDGLHFTSLYWPPPQDVEQKQAQILAYVEYFGQFTADSEQFPEDVAQLIQSS  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE+RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++ PPF+SFISL    S
Sbjct  61   YPSKESRLIDEVLATFVLHHPEHGHAVVHPILSPIIDGTLCYDRHGPPFSSFISLFSHTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EQEYSEQWALACGEILRVLTHYNRP  145



>gb|ABZ81992.1| gigantea [Zea mays]
Length=1162

 Score =   220 bits (561),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+ S  +WID LQF+SL+WPPP DA+Q+  QI AYVEYFGQFT  ++ FPEDIA+LI++ 
Sbjct  1    MSESNVKWIDGLQFTSLYWPPPLDAEQKQAQILAYVEYFGQFTADTDQFPEDIAQLIQSS  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKENRL  +VLATF+LHHPEHGHAV HPI+S IIDGTL YD++ PPF+SFISL   NS
Sbjct  61   YPSKENRLVGEVLATFVLHHPEHGHAVAHPILSRIIDGTLCYDRHGPPFSSFISLFSHNS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EQEYSEQWALACGEILRVLTHYNRP  145



>emb|CAY26028.1| GIGANTEA [Lolium perenne]
 gb|ABF83898.2| GIGANTEA [Lolium perenne]
Length=1148

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 119/145 (82%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNR  353
            M+ S  +WID LQFSSLFWPPP DAQQ+  Q  AYVEYFGQFTS  E FPED+A+LI++ 
Sbjct  1    MSVSNGKWIDGLQFSSLFWPPPHDAQQKQAQTLAYVEYFGQFTSDSEQFPEDVAQLIQSY  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDG+L YD++  PF SFISL    +
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGSLSYDRHGSPFNSFISLFTQTA  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>ref|XP_009380419.1| PREDICTED: protein GIGANTEA-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380420.1| PREDICTED: protein GIGANTEA-like isoform X2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380421.1| PREDICTED: protein GIGANTEA-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=1162

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+AS  +W + LQFSSLFWPPP   QQ+  Q+ AYVEYFGQFTSE F EDIA+LI++ YP
Sbjct  1    MSASHGKWTNGLQFSSLFWPPPLGEQQKQAQVMAYVEYFGQFTSEEFQEDIAQLIQSHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SK+ RL D+VLA F+LHHPEHGHA+IHPI+S IIDGTL YD+N  PF SFISL   NS+ 
Sbjct  61   SKDKRLLDEVLAVFVLHHPEHGHAIIHPILSLIIDGTLAYDRNDSPFCSFISLFKQNSEK  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            E SEQWALACGEILR+LTHYNRP
Sbjct  121  EYSEQWALACGEILRVLTHYNRP  143



>ref|XP_004968438.1| PREDICTED: protein GIGANTEA-like [Setaria italica]
Length=1160

 Score =   219 bits (559),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQF+SLF PPPQD  Q+  QI AYVEYFGQFT  SE FPED+A+LI++ 
Sbjct  1    MSASNEKWIDGLQFTSLFCPPPQDVAQKQAQILAYVEYFGQFTADSEQFPEDVAQLIQSC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD++  PF+SFISL    S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLCYDRHGAPFSSFISLFSHTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>ref|XP_008461912.1| PREDICTED: protein GIGANTEA-like isoform X1 [Cucumis melo]
Length=1168

 Score =   219 bits (558),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA S ERWIDRLQ SSLFWPPP D QQR  Q +AYVEY GQFTSE F EDIAELIR R+ 
Sbjct  1    MATSSERWIDRLQLSSLFWPPPDDDQQRKVQCSAYVEYLGQFTSERFSEDIAELIRIRFQ  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            SKE RLFDDVLA F+LHHPE+GHA+I PIISCII+G LEY++N PPFASFISL CP  +N
Sbjct  61   SKEKRLFDDVLALFVLHHPENGHAIILPIISCIINGALEYNRNDPPFASFISLFCPGIEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILRILTHYNRP
Sbjct  121  DYSEQWALACGEILRILTHYNRP  143



>ref|XP_006359039.1| PREDICTED: protein GIGANTEA-like isoform X1 [Solanum tuberosum]
Length=1189

 Score =   219 bits (558),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +3

Query  270  QITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPII  449
            QITAYVEYFGQFTSE FPEDIAELIRNRYPSKENRLFDDVLATF+LHHPEHGH VI PII
Sbjct  54   QITAYVEYFGQFTSEQFPEDIAELIRNRYPSKENRLFDDVLATFVLHHPEHGHTVILPII  113

Query  450  SCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            SCIIDGTL+YDK+ PPF SFISLVCP+S+ E SEQWALACGEILRILTHYNRP
Sbjct  114  SCIIDGTLDYDKSCPPFTSFISLVCPSSEKEYSEQWALACGEILRILTHYNRP  166



>gb|ACJ09479.1| putative gigantea, partial [Oryza sativa Japonica Group]
Length=208

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAELIRNR  353
            M+AS E+WID LQFSSLFWPPPQD QQ+  QI AYVEYFGQFT  SE FPEDIA+LI+  
Sbjct  1    MSASNEKWIDGLQFSSLFWPPPQDPQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQGC  60

Query  354  YPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS  533
            YPSKE RL D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD+N  PF SFISL    S
Sbjct  61   YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTS  120

Query  534  QNELSEQWALACGEILRILTHYNRP  608
            + E SEQWALACGEILR+LTHYNRP
Sbjct  121  EKEYSEQWALACGEILRVLTHYNRP  145



>gb|AGW52153.1| GI [Populus tomentosa]
Length=1241

 Score =   216 bits (550),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 128/201 (64%), Gaps = 59/201 (29%)
 Frame = +3

Query  183  AASCERWIDRLQFSSLF------------------------------------------W  236
            ++S ERWID LQFSSLF                                          +
Sbjct  3    SSSSERWIDGLQFSSLFCPPPQDAQQRKIEEILNLFMRKEKLGFRQHSSDLDIFSISWHF  62

Query  237  PPPQDAQQRTD-----------------QITAYVEYFGQFTSEHFPEDIAELIRNRYPSK  365
            P  QD  Q+                   QITAYV+YFGQ TSEHFP+DI+ELIRNRYPSK
Sbjct  63   PLRQDIDQKLQNQHLLAVIKTSTFEFEAQITAYVDYFGQCTSEHFPDDISELIRNRYPSK  122

Query  366  ENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNEL  545
            + RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFASFISLVCP S+NE 
Sbjct  123  DKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFASFISLVCPGSENEY  182

Query  546  SEQWALACGEILRILTHYNRP  608
            SEQWALACGEILRILTHYNRP
Sbjct  183  SEQWALACGEILRILTHYNRP  203



>gb|ADR51711.1| GI [Secale cereale]
Length=1142

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 115/137 (84%), Gaps = 2/137 (1%)
 Frame = +3

Query  204  IDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRL  377
            ID LQFSSLFWPPP DAQQ+  QI AYVEYFGQFTS  E FPED+A+LI++ YPSKE RL
Sbjct  1    IDGLQFSSLFWPPPHDAQQKQAQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPSKEKRL  60

Query  378  FDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQW  557
             D+VLATF+LHHPEHGHAV+HPI+S IIDGTL YD +  PF SFISL   +S+ E SEQW
Sbjct  61   VDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDSHGSPFNSFISLFTQSSEKEYSEQW  120

Query  558  ALACGEILRILTHYNRP  608
            ALACGEILR+LTHYNRP
Sbjct  121  ALACGEILRVLTHYNRP  137



>gb|ABR18021.1| unknown [Picea sitchensis]
Length=1179

 Score =   214 bits (546),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+ S ++WI  LQ SSL  PPPQDAQQR  +I AYVE F QFTSE FP+DIAEL+ + YP
Sbjct  1    MSISEQKWIHGLQSSSLVRPPPQDAQQRQAEILAYVELFAQFTSEEFPDDIAELVHSHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            + E  L DDVLA F+LHHPEHGHA+IHP++SCIIDGTL YDK  PPF+SF SL  P+S+N
Sbjct  61   NGEASLLDDVLAIFVLHHPEHGHAIIHPLLSCIIDGTLIYDKKMPPFSSFNSLFSPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILR+LTHYNRP
Sbjct  121  DYSEQWALACGEILRVLTHYNRP  143



>gb|AGH20049.1| GI [Picea abies]
Length=1179

 Score =   211 bits (538),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+ S ++WI  LQ SSLF PPPQDAQQR  +I AYVE F QFTSE FP+DIAEL+ + YP
Sbjct  1    MSISEQKWIHGLQSSSLFRPPPQDAQQRQAEILAYVELFAQFTSEEFPDDIAELVHSHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            + E  L DDVLA F+LH+PEHGHA+IHP++SCIIDGTL YDK   PF+SF SL  P+S+N
Sbjct  61   NGEASLLDDVLAIFVLHYPEHGHAIIHPLLSCIIDGTLIYDKKMSPFSSFNSLFSPSSEN  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            + SEQWALACGEILR+LTHYNRP
Sbjct  121  DYSEQWALACGEILRVLTHYNRP  143



>gb|ACY30446.1| gigantea-like protein [Liriodendron tulipifera]
Length=1209

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +3

Query  270  QITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPII  449
            QI AYVEYFGQFTSE FPED+AELIR  YPSKE RL D+VLA F+LHHPEHGHAV+HPI+
Sbjct  51   QIMAYVEYFGQFTSERFPEDVAELIRTCYPSKEKRLLDEVLAIFVLHHPEHGHAVVHPIL  110

Query  450  SCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            SCIIDGTL YDKN PPF+SFISLVCP+S+ E SEQWALACGEILRILTHYNRP
Sbjct  111  SCIIDGTLVYDKNDPPFSSFISLVCPSSEKEYSEQWALACGEILRILTHYNRP  163



>ref|XP_004496436.1| PREDICTED: protein GIGANTEA-like isoform X2 [Cicer arietinum]
Length=1152

 Score =   206 bits (524),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  258  QRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVI  437
            ++ DQI AYVEY  QFTSE F +DIAE+IRNRYPSKE  LFDDVLATF+LHHPEHGHAV+
Sbjct  4    KKKDQIAAYVEYLIQFTSEQFADDIAEMIRNRYPSKEILLFDDVLATFVLHHPEHGHAVV  63

Query  438  HPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
             PIISCIIDGTL YDK SPPFAS ISLVCP ++NE SEQWALACGEILRILTHYNRP
Sbjct  64   LPIISCIIDGTLVYDKTSPPFASLISLVCPKNENEYSEQWALACGEILRILTHYNRP  120



>gb|KHN46389.1| Protein GIGANTEA, partial [Glycine soja]
Length=1157

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = +3

Query  267  DQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPI  446
            DQI AYVEYF QFTSE F +DIAELIRNRYPSK+  LFDDVLATF+LHHPEHGHAV+ PI
Sbjct  1    DQIAAYVEYFIQFTSEQFADDIAELIRNRYPSKDILLFDDVLATFVLHHPEHGHAVVLPI  60

Query  447  ISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            ISCIIDGTL YDK SPPFASFIS VCP  +NE SEQWALACGEILRILTHYNRP
Sbjct  61   ISCIIDGTLVYDKASPPFASFISSVCPKIENEYSEQWALACGEILRILTHYNRP  114



>ref|XP_002961231.1| hypothetical protein SELMODRAFT_140066 [Selaginella moellendorffii]
 gb|EFJ38770.1| hypothetical protein SELMODRAFT_140066 [Selaginella moellendorffii]
Length=1063

 Score =   201 bits (512),  Expect = 8e-56, Method: Composition-based stats.
 Identities = 86/143 (60%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M++  ++W+  L+ +SLF  PP D  +R  +  AYVE FGQF S+ FPEDIAEL+R+ YP
Sbjct  1    MSSPQQKWLTGLKSTSLFRAPPLDLHERQTKTVAYVELFGQFASDSFPEDIAELVRDHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
             KE  L DDVLATF+LHHPEHGH ++HP++SC+IDGTL Y K +PPF SF+S+   +S+ 
Sbjct  61   HKEPCLLDDVLATFVLHHPEHGHTILHPLLSCVIDGTLAYSKTTPPFGSFVSVFGVSSER  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            +L+EQWALACGEILR+LTHYNRP
Sbjct  121  DLTEQWALACGEILRLLTHYNRP  143



>ref|XP_002969462.1| hypothetical protein SELMODRAFT_170553 [Selaginella moellendorffii]
 gb|EFJ29550.1| hypothetical protein SELMODRAFT_170553 [Selaginella moellendorffii]
Length=1056

 Score =   201 bits (512),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 86/143 (60%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M++  ++W+  L+ +SLF  PP D  +R  +  AYVE FGQF S+ FPEDIAEL+R+ YP
Sbjct  1    MSSPQQKWLTGLKSTSLFRAPPLDLHERQTKTVAYVELFGQFASDSFPEDIAELVRDHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
             KE  L DDVLATF+LHHPEHGH ++HP++SC+IDGTL Y K +PPF SF+S+   +S+ 
Sbjct  61   HKEPCLLDDVLATFVLHHPEHGHTILHPLLSCVIDGTLAYSKTTPPFGSFVSVFGVSSER  120

Query  540  ELSEQWALACGEILRILTHYNRP  608
            +L+EQWALACGEILR+LTHYNRP
Sbjct  121  DLTEQWALACGEILRLLTHYNRP  143



>gb|AIR93790.1| gigantea [Kalanchoe fedtschenkoi]
Length=1149

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  270  QITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPII  449
            Q TAYVEYFGQFTSE FP+D+AELI+N YPS + RLFDDVLA F+LHHPEHGHAV+ PII
Sbjct  19   QTTAYVEYFGQFTSEQFPDDVAELIQNNYPSHDKRLFDDVLAMFVLHHPEHGHAVMLPII  78

Query  450  SCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            S +IDGTL YD+  PPFASFISLVCP+S+N  SEQWALACGEILRILTHYNRP
Sbjct  79   SLVIDGTLFYDRCCPPFASFISLVCPSSENYYSEQWALACGEILRILTHYNRP  131



>gb|AEK05858.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05863.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05868.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05873.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   179 bits (454),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +3

Query  324  EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  503
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFA
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFA  60

Query  504  SFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            SFISLVCP S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   SFISLVCPGSENEYSEQWALACGEILRILTHYNRP  95



>gb|AEK05878.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05883.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05893.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05898.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05903.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05913.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05918.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   179 bits (454),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +3

Query  324  EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  503
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFA
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFA  60

Query  504  SFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            SFISLVCP S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   SFISLVCPGSENEYSEQWALACGEILRILTHYNRP  95



>gb|AEK05888.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05908.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   179 bits (453),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +3

Query  324  EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  503
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFA
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFA  60

Query  504  SFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            SFISLVCP S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   SFISLVCPGSENEYSEQWALACGEILRILTHYNRP  95



>gb|AEK26574.1| gigantea 5 [Populus tremula]
Length=138

 Score =   179 bits (453),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +3

Query  324  EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  503
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFA
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFA  60

Query  504  SFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            SFISLVCP S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   SFISLVCPGSENEYSEQWALACGEILRILTHYNRP  95



>gb|AEK05813.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05818.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05823.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05828.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05833.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05838.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05843.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05853.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   178 bits (451),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +3

Query  324  EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  503
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFA
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFA  60

Query  504  SFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            SFISLVCP S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   SFISLVCPGSENEYSEQWALACGEILRILTHYNRP  95



>gb|AEK05848.1| gigantea-5, partial [Populus balsamifera]
Length=137

 Score =   177 bits (450),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +3

Query  324  EDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFA  503
            +DI+ELIRNRYPSK+ RLFDDVLATF+LHHPEHGHAV+ PIISCIIDGTL YD++SPPFA
Sbjct  1    DDISELIRNRYPSKDKRLFDDVLATFVLHHPEHGHAVVLPIISCIIDGTLVYDRSSPPFA  60

Query  504  SFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            SFISLVCP S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   SFISLVCPGSENEYSEQWALACGEILRILTHYNRP  95



>ref|XP_006842209.1| hypothetical protein AMTR_s00078p00173230 [Amborella trichopoda]
 gb|ERN03884.1| hypothetical protein AMTR_s00078p00173230 [Amborella trichopoda]
Length=1143

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = +3

Query  270  QITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPII  449
            QI AYVE F QFTSEHFP+DI+ELI++RYPSKE  L DDVLA F+LHHPEHGHAVIHPI+
Sbjct  4    QIMAYVELFAQFTSEHFPDDISELIQSRYPSKEVCLLDDVLAIFVLHHPEHGHAVIHPIL  63

Query  450  SCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            SCIIDGTL YDK +PPF+SFISL  P+S+ + SEQWALACGEILR+LTHYNRP
Sbjct  64   SCIIDGTLIYDKGNPPFSSFISLFSPSSEKDYSEQWALACGEILRVLTHYNRP  116



>dbj|BAO66507.1| GIGANTEA [Marchantia polymorpha]
Length=1187

 Score =   191 bits (486),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            M+   ++W+  LQ SSLF PPP+ A ++  +I A VE FG F SE F +DI EL+R  YP
Sbjct  1    MSFPGQKWLRGLQSSSLFRPPPESAIRKQAEILASVELFGHFASESFVDDIGELVRAHYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQN  539
            + E+ L DDVLATF+LHHPEHGHAV+H ++SC+IDGTL Y+K +PPF SF+SL  P+++ 
Sbjct  61   TNEHCLLDDVLATFVLHHPEHGHAVLHALLSCVIDGTLIYNKKTPPFGSFVSLFSPSTER  120

Query  540  ELSEQWALACGEILRILTHYNRPGLXS  620
            + SEQWALACGE LR+LTHYNRP   S
Sbjct  121  DFSEQWALACGETLRVLTHYNRPTFRS  147



>dbj|BAP76055.1| putative GI [Cryptomeria japonica]
Length=1197

 Score =   185 bits (469),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 108/146 (74%), Gaps = 6/146 (4%)
 Frame = +3

Query  195  ERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENR  374
            ++WI+ LQ SSLF PPPQDAQQR  +I AYVE FGQ+TSE FP DIAE+I   YP++E  
Sbjct  6    QKWIEGLQSSSLFRPPPQDAQQRQIEILAYVELFGQYTSEEFPHDIAEIIHCHYPNEEVC  65

Query  375  LFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNS------Q  536
            L DDVLATF+LHHPEHGH  IHP++S IID  + YDK  PPF+SFISL  P+S      Q
Sbjct  66   LLDDVLATFVLHHPEHGHTFIHPLLSLIIDRIVIYDKKIPPFSSFISLFSPSSKLHFPWQ  125

Query  537  NELSEQWALACGEILRILTHYNRPGL  614
             +  EQW +AC  ILR+LTHYNRP L
Sbjct  126  KDYPEQWGVACLGILRVLTHYNRPLL  151



>gb|AEK05795.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05800.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  500
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  501  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRP  96



>gb|AEK05801.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  500
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  501  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRP  96



>gb|AEK05793.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05794.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05796.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05797.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05798.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05804.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05805.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05806.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05809.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  500
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  501  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRP  96



>gb|AEK05803.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  500
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  501  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRP  96



>gb|AEK05799.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  500
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  501  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRP  96



>gb|AEK05807.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05810.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05811.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  500
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  501  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRP  96



>gb|AEK05791.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05792.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  500
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  501  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRP  96



>gb|AEK05790.1| gigantea 2, partial [Populus balsamifera]
 gb|AEK05808.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   177 bits (450),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  500
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  501  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRP  96



>gb|AEK05802.1| gigantea 2, partial [Populus balsamifera]
Length=1113

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  321  PEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPF  500
            P+DIA+LIRNRYPSK   LFDDVLA F+LHHPEHGHAV+ PIISCIIDGTL YD +SPPF
Sbjct  1    PDDIAKLIRNRYPSKNKHLFDDVLAMFVLHHPEHGHAVVLPIISCIIDGTLVYDGSSPPF  60

Query  501  ASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            ASFISLVCP+S+NE SEQWALACGEILRILTHYNRP
Sbjct  61   ASFISLVCPSSENEYSEQWALACGEILRILTHYNRP  96



>gb|ADX35837.1| gigantea, partial [Brachypodium rupestre]
 gb|ADX35838.1| gigantea, partial [Brachypodium retusum]
 gb|ADX35840.1| gigantea, partial [Brachypodium retusum]
 gb|ADX35841.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35842.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35843.1| gigantea, partial [Brachypodium pinnatum]
 gb|ADX35850.1| gigantea, partial [Brachypodium sylvaticum subsp. glaucovirens]
 gb|ADX35851.1| gigantea, partial [Brachypodium phoenicoides]
 gb|ADX35852.1| gigantea, partial [Brachypodium phoenicoides]
 gb|ADX35853.1| gigantea, partial [Brachypodium sylvaticum]
 gb|ADX35854.1| gigantea, partial [Brachypodium sylvaticum]
 gb|AFB78140.1| gigantea, partial [Brachypodium arbuscula]
 gb|AFB78141.1| gigantea, partial [Brachypodium arbuscula]
Length=110

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = +3

Query  231  FWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRLFDDVLATFL  404
            FWPPP DAQQ+  QI AYVEYFGQFTS  E FPED+A+LI++ YP+KE RL D+VLATF+
Sbjct  1    FWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPAKEKRLVDEVLATFV  60

Query  405  LHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LHHPEHGHAV+HPI+S IIDGTL YD++  PF SFISL    S+ E SEQ
Sbjct  61   LHHPEHGHAVVHPILSRIIDGTLSYDRHGSPFNSFISLFTQTSEKEYSEQ  110



>gb|ADX35845.1| gigantea, partial [Brachypodium mexicanum]
Length=110

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = +3

Query  231  FWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRLFDDVLATFL  404
            FWPPP DAQQ+  QI AYVEYFGQFTS  E FPED+A+LI++ YP+KE RL D+VLA F+
Sbjct  1    FWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPAKEKRLVDEVLANFV  60

Query  405  LHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LHHPEHGHAV+HPI+SCIIDGTL YD++  PF SFISL    S+   SEQ
Sbjct  61   LHHPEHGHAVVHPILSCIIDGTLSYDRHGSPFNSFISLFTQTSEKMYSEQ  110



>gb|ADX35839.1| gigantea, partial [Brachypodium retusum]
 gb|AFB78143.1| gigantea, partial [Brachypodium boissieri]
 gb|AFB78144.1| gigantea, partial [Brachypodium boissieri]
Length=110

 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = +3

Query  231  FWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRLFDDVLATFL  404
            FWPPP DAQQ+  QI AYVEYFGQFTS  E FPED+A+LI++ YP+KE RL D+VLATF+
Sbjct  1    FWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPAKEKRLVDEVLATFV  60

Query  405  LHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LHHPEHGHAV+HPI+S IIDGTL YD++  PF+SFISL    S+ E SEQ
Sbjct  61   LHHPEHGHAVVHPILSRIIDGTLCYDRHGSPFSSFISLFTQTSEKEYSEQ  110



>gb|ADX35848.1| gigantea, partial [Brachypodium distachyon]
 gb|ADX35849.1| gigantea, partial [Brachypodium distachyon]
Length=110

 Score =   157 bits (397),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = +3

Query  231  FWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRLFDDVLATFL  404
            FWPPP DAQQ+  QI AYVEYFGQFTS  E FPED+A+LI++ YP+KE RL D+VLATF+
Sbjct  1    FWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPAKEKRLVDEVLATFV  60

Query  405  LHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LHHPEHGHAV+HPI+S IIDGTL YD++  PF SFISL    S+ E SEQ
Sbjct  61   LHHPEHGHAVVHPILSRIIDGTLSYDRHGFPFNSFISLFTQTSEKEYSEQ  110



>gb|ADX35844.1| gigantea, partial [Brachypodium mexicanum]
Length=110

 Score =   157 bits (396),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = +3

Query  231  FWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRLFDDVLATFL  404
            FWPPP DAQQ+  QI AYVEYFGQFTS  E FPED+A+LI++ YP+KE RL D+VLATF+
Sbjct  1    FWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPAKEKRLVDEVLATFV  60

Query  405  LHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LHHPEHGHAV+HPI+S IIDGTL YD++  PF SFISL    S+ E SEQ
Sbjct  61   LHHPEHGHAVVHPILSRIIDGTLCYDRHGSPFNSFISLFTQTSEKEYSEQ  110



>gb|ADX35846.1| gigantea, partial [Brachypodium distachyon]
 gb|ADX35847.1| gigantea, partial [Brachypodium distachyon]
Length=110

 Score =   156 bits (395),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 88/110 (80%), Gaps = 2/110 (2%)
 Frame = +3

Query  231  FWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRLFDDVLATFL  404
            FWPPP DAQQ+  QI AYVEYFGQFTS  E FPED+A+LI++ YP+KE RL D+VLA F+
Sbjct  1    FWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPAKEKRLVDEVLANFV  60

Query  405  LHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LHHPEHGHAV+HPI+S IIDGTL YD++  PF SFISL    S+ E SEQ
Sbjct  61   LHHPEHGHAVVHPILSRIIDGTLSYDRHGSPFNSFISLFTQTSEKEYSEQ  110



>gb|AFB78142.1| gigantea, partial [Brachypodium boissieri]
Length=110

 Score =   155 bits (393),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = +3

Query  231  FWPPPQDAQQRTDQITAYVEYFGQFTS--EHFPEDIAELIRNRYPSKENRLFDDVLATFL  404
            FWPPP DAQQ+  QI AYVEYFGQFTS  E FPED+A+LI++ YP+KE RL D+VLATF+
Sbjct  1    FWPPPHDAQQKQVQILAYVEYFGQFTSDSEQFPEDVAQLIQSCYPAKEKRLVDEVLATFV  60

Query  405  LHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQ  554
            LHHPEHGHAV+HPI+S IIDGTL YD++  PF+SFISL    S+ E  EQ
Sbjct  61   LHHPEHGHAVVHPILSRIIDGTLCYDRHGSPFSSFISLFTQTSEKEYLEQ  110



>gb|KDO83806.1| hypothetical protein CISIN_1g001216mg [Citrus sinensis]
Length=1122

 Score =   166 bits (419),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  330  IAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASF  509
            + +LIR+ YP KE RLFDDVLA F+LHHPEHGHAV  PIISCIIDGTL YDK+SPPFASF
Sbjct  8    LVQLIRSHYPHKERRLFDDVLAMFVLHHPEHGHAVALPIISCIIDGTLVYDKSSPPFASF  67

Query  510  ISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            +SLVCPNS+NE SEQWALAC EILRILTHYNRP
Sbjct  68   VSLVCPNSENEYSEQWALACTEILRILTHYNRP  100



>emb|CAN81809.1| hypothetical protein VITISV_032939 [Vitis vinifera]
Length=1172

 Score =   156 bits (395),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 93/150 (62%), Gaps = 12/150 (8%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFTSEHFPEDIAELIRNRYP  359
            MA+SCERWID LQFSSLFWPPPQD QQR  QITAYV+YFGQFTSE FPEDIAELIR+RYP
Sbjct  1    MASSCERWIDGLQFSSLFWPPPQDVQQRKAQITAYVDYFGQFTSEQFPEDIAELIRSRYP  60

Query  360  SKENRLFDDVLATFLLHHPEHGHAVIHPIIS-------CIIDGTLEYDKNSPPFASFISL  518
            SKE RL               G      +         C+I   L    + P  A     
Sbjct  61   SKEQRLLMMSWQRLFFIIRNMGMLSFFQLFRVSLMVHWCMIGVLLLLPLSFPWSAQAARY  120

Query  519  VCPNSQNELSEQWALACGEILRILTHYNRP  608
            V     NE SEQWALACGEILRILTHYNRP
Sbjct  121  V-----NEYSEQWALACGEILRILTHYNRP  145


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +1

Query  364  KKTDFLMMFWQHFSSIIQSMGMLLFIQLSHVSLMVHWSMIKIVHLLPLSFHWSVQTVR  537
            K+   LMM WQ    II++MGML F QL  VSLMVHW MI ++ LLPLSF WS Q  R
Sbjct  62   KEQRLLMMSWQRLFFIIRNMGMLSFFQLFRVSLMVHWCMIGVLLLLPLSFPWSAQAAR  119



>ref|XP_004173872.1| PREDICTED: protein GIGANTEA-like, partial [Cucumis sativus]
Length=92

 Score =   142 bits (357),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  270  QITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPII  449
            Q +AYVEY GQFTSE F EDIAELIR R+ SKE RLFDDVLA F+LHHPE+GHA+I PII
Sbjct  4    QCSAYVEYLGQFTSERFSEDIAELIRIRFQSKEKRLFDDVLALFVLHHPENGHAIILPII  63

Query  450  SCIIDGTLEYDKNSPPFASFISLVCPN  530
            SCI DG LEY++N PPFASFISL CP 
Sbjct  64   SCIFDGALEYNRNDPPFASFISLFCPG  90



>gb|AGM20686.1| GI1-2 [Populus tomentosa]
Length=1170

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 83/113 (73%), Gaps = 23/113 (20%)
 Frame = +3

Query  270  QITAYVEYFGQFTSEHFPEDIAELIRNRYPSKENRLFDDVLATFLLHHPEHGHAVIHPII  449
            QITAYVEYFGQ TSE FP+DIAELIRNRYPSK+  LFDDVL                   
Sbjct  44   QITAYVEYFGQCTSEQFPDDIAELIRNRYPSKDKHLFDDVL-------------------  84

Query  450  SCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
                DGTL YD +SPPFASFISLVCP+S+NE SEQWALACGEILRILTHYNRP
Sbjct  85   ----DGTLVYDGSSPPFASFISLVCPSSENEYSEQWALACGEILRILTHYNRP  133



>ref|XP_007199688.1| hypothetical protein PRUPE_ppa000556mg [Prunus persica]
 gb|EMJ00887.1| hypothetical protein PRUPE_ppa000556mg [Prunus persica]
Length=1098

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +3

Query  399  FLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEI  578
            F+LHHPEHGHAVI PIISCIIDGTL Y++ SPPFASFISLVCP+S+NE SEQWALACGEI
Sbjct  2    FVLHHPEHGHAVILPIISCIIDGTLAYERTSPPFASFISLVCPSSENEYSEQWALACGEI  61

Query  579  LRILTHYNRP  608
            LRILTHYNRP
Sbjct  62   LRILTHYNRP  71



>ref|XP_006434519.1| hypothetical protein CICLE_v10004044mg [Citrus clementina]
 gb|ESR47759.1| hypothetical protein CICLE_v10004044mg [Citrus clementina]
Length=1082

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +3

Query  399  FLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEI  578
            F+LHHPEHGHAV  PIISCIIDGTL YDK+SPPFASF+SLVCPNS+NE SEQWALAC EI
Sbjct  2    FVLHHPEHGHAVALPIISCIIDGTLVYDKSSPPFASFVSLVCPNSENEYSEQWALACTEI  61

Query  579  LRILTHYNRP  608
            LRILTHYNRP
Sbjct  62   LRILTHYNRP  71



>ref|XP_010261025.1| PREDICTED: protein GIGANTEA-like isoform X2 [Nelumbo nucifera]
Length=1102

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +3

Query  399  FLLHHPEHGHAVIHPIISCIIDGTLEYDKNSPPFASFISLVCPNSQNELSEQWALACGEI  578
            F+LHHPEHGHAV+ P+ISCIID TL Y+KNSPPF+SFISLVCP+++NE SEQWA+ACGEI
Sbjct  2    FVLHHPEHGHAVLLPLISCIIDDTLAYNKNSPPFSSFISLVCPSNENEYSEQWAMACGEI  61

Query  579  LRILTHYNRP  608
            LR+LTHYNRP
Sbjct  62   LRVLTHYNRP  71



>gb|EMS55238.1| hypothetical protein TRIUR3_30834 [Triticum urartu]
Length=1126

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAE  338
            M+ S  +WID LQFSSLFWPPP D QQ+  QI AYVEYFGQFT  SE FPED+A+
Sbjct  38   MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFTSDSEQFPEDVAQ  92


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  531  SQNELSEQWALACGEILRILTHYNRP  608
            +Q E SEQWALACGEILR+LTHYNRP
Sbjct  91   AQKEYSEQWALACGEILRVLTHYNRP  116



>gb|EMT06342.1| hypothetical protein F775_28583 [Aegilops tauschii]
Length=1146

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 2/55 (4%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQQRTDQITAYVEYFGQFT--SEHFPEDIAE  338
            M+ S  +WID LQFSSLFWPPP D QQ+  QI AYVEYFGQFT  SE FPED+A+
Sbjct  60   MSVSNGKWIDGLQFSSLFWPPPHDVQQKQAQILAYVEYFGQFTSDSEQFPEDVAQ  114


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  531  SQNELSEQWALACGEILRILTHYNRP  608
            +Q E SEQWALACGEILR+LTHYNRP
Sbjct  113  AQKEYSEQWALACGEILRVLTHYNRP  138



>dbj|BAO74118.1| GIGANTEA, partial [Lotus japonicus]
Length=976

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +3

Query  495  PFASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            PFASFISLVCP ++N+ SEQWALACGEILRILTHYNRP
Sbjct  2    PFASFISLVCPKNENDYSEQWALACGEILRILTHYNRP  39



>dbj|BAO74110.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74111.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74112.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74113.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74114.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74115.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74116.1| GIGANTEA, partial [Lotus japonicus]
 dbj|BAO74117.1| GIGANTEA, partial [Lotus japonicus]
Length=976

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +3

Query  495  PFASFISLVCPNSQNELSEQWALACGEILRILTHYNRP  608
            PFASFISLVCP ++N+ SEQWALACGEILRILTHYNRP
Sbjct  2    PFASFISLVCPKNENDYSEQWALACGEILRILTHYNRP  39



>emb|CDP21210.1| unnamed protein product [Coffea canephora]
Length=26

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  180  MAASCERWIDRLQFSSLFWPPPQDAQ  257
            MAASCERWID LQFSSLFWPPP+DA+
Sbjct  1    MAASCERWIDGLQFSSLFWPPPKDAE  26



>gb|AEK05812.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05817.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05822.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05827.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05832.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05837.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05842.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05847.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05852.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05857.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05862.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05867.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05872.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05877.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05882.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05887.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05892.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05897.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05902.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05907.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05912.1| gigantea-5, partial [Populus balsamifera]
 gb|AEK05917.1| gigantea-5, partial [Populus balsamifera]
Length=26

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  189  SCERWIDRLQFSSLFWPPPQDAQQRT  266
            S ERWID LQFSSLFWPPPQDAQQR 
Sbjct  1    SSERWIDGLQFSSLFWPPPQDAQQRK  26



>gb|KGN44454.1| LATE BLOOMER 1 [Cucumis sativus]
Length=101

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +3

Query  537  NELSEQWALACGEILRILTHYNRP  608
            N+ SEQWALACGEILRILTHYNRP
Sbjct  11   NDYSEQWALACGEILRILTHYNRP  34



>dbj|BAI40156.1| gigantea-like protein [Diospyros kaki]
Length=102

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/21 (100%), Positives = 21/21 (100%), Gaps = 0/21 (0%)
 Frame = +3

Query  546  SEQWALACGEILRILTHYNRP  608
            SEQWALACGEILRILTHYNRP
Sbjct  1    SEQWALACGEILRILTHYNRP  21



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125