BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF046K05

Length=629
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006339396.1|  PREDICTED: basic 7S globulin-like                  153   2e-40   Solanum tuberosum [potatoes]
ref|XP_009611838.1|  PREDICTED: basic 7S globulin-like                  149   8e-39   Nicotiana tomentosiformis
ref|XP_004229435.1|  PREDICTED: basic 7S globulin-like                  146   5e-38   Solanum lycopersicum
ref|XP_011090791.1|  PREDICTED: basic 7S globulin                       128   3e-31   Sesamum indicum [beniseed]
emb|CDO98999.1|  unnamed protein product                                108   4e-24   Coffea canephora [robusta coffee]
ref|XP_010255900.1|  PREDICTED: basic 7S globulin 2-like                104   9e-23   Nelumbo nucifera [Indian lotus]
ref|XP_008390829.1|  PREDICTED: basic 7S globulin-like                  103   1e-22   Malus domestica [apple tree]
gb|KJB46995.1|  hypothetical protein B456_008G005100                    103   2e-22   Gossypium raimondii
ref|XP_011026191.1|  PREDICTED: basic 7S globulin-like                  102   5e-22   Populus euphratica
ref|XP_002520766.1|  conserved hypothetical protein                     100   5e-22   
gb|EYU41534.1|  hypothetical protein MIMGU_mgv1a008121mg                101   6e-22   Erythranthe guttata [common monkey flower]
ref|XP_002302122.1|  hypothetical protein POPTR_0002s05580g             102   6e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011082548.1|  PREDICTED: basic 7S globulin-like                  102   7e-22   Sesamum indicum [beniseed]
ref|XP_009342182.1|  PREDICTED: basic 7S globulin 2-like                100   1e-21   
ref|XP_011020124.1|  PREDICTED: basic 7S globulin-like                99.4    6e-21   Populus euphratica
ref|XP_003518926.1|  PREDICTED: basic 7S globulin                     99.0    8e-21   Glycine max [soybeans]
emb|CAN80378.1|  hypothetical protein VITISV_038701                   99.0    9e-21   Vitis vinifera
ref|XP_002272235.1|  PREDICTED: basic 7S globulin                     99.0    9e-21   Vitis vinifera
ref|XP_002308984.2|  hypothetical protein POPTR_0006s06820g           98.6    1e-20   Populus trichocarpa [western balsam poplar]
gb|KDP25943.1|  hypothetical protein JCGZ_22848                       98.2    1e-20   Jatropha curcas
ref|XP_006419833.1|  hypothetical protein CICLE_v10006689mg           98.2    2e-20   Citrus clementina [clementine]
ref|XP_006489581.1|  PREDICTED: basic 7S globulin-like                97.4    3e-20   
ref|XP_009356759.1|  PREDICTED: basic 7S globulin                     97.1    4e-20   Pyrus x bretschneideri [bai li]
gb|KDO74788.1|  hypothetical protein CISIN_1g036132mg                 96.3    8e-20   Citrus sinensis [apfelsine]
ref|XP_007144622.1|  hypothetical protein PHAVU_007G170900g           96.3    8e-20   Phaseolus vulgaris [French bean]
ref|XP_010278291.1|  PREDICTED: basic 7S globulin-like                96.7    8e-20   Nelumbo nucifera [Indian lotus]
ref|XP_008235257.1|  PREDICTED: basic 7S globulin 2-like              96.7    8e-20   Prunus mume [ume]
gb|EYU38145.1|  hypothetical protein MIMGU_mgv1a006647mg              95.9    1e-19   Erythranthe guttata [common monkey flower]
ref|NP_001234249.1|  xyloglucan-specific fungal endoglucanase inh...  95.1    2e-19   
ref|NP_001234746.1|  xyloglucan-specific fungal endoglucanase inh...  95.1    2e-19   
gb|AAP84703.1|  putative xyloglucanase inhibitor                      94.4    4e-19   Solanum tuberosum [potatoes]
ref|XP_007034629.1|  Eukaryotic aspartyl protease family protein ...  94.4    4e-19   
ref|XP_008355568.1|  PREDICTED: basic 7S globulin-like                94.0    5e-19   Malus domestica [apple tree]
gb|AFK46427.1|  unknown                                               93.6    8e-19   Medicago truncatula
gb|KDP40112.1|  hypothetical protein JCGZ_02110                       93.6    8e-19   Jatropha curcas
emb|CAN61502.1|  hypothetical protein VITISV_011733                   93.2    8e-19   Vitis vinifera
ref|XP_003590665.1|  Xyloglucan-specific endoglucanase inhibitor ...  93.2    9e-19   Medicago truncatula
gb|KJB23117.1|  hypothetical protein B456_004G081800                  93.2    1e-18   Gossypium raimondii
dbj|BAA03413.1|  EDGP precursor                                       92.8    1e-18   Daucus carota [carrots]
ref|XP_002517163.1|  basic 7S globulin 2 precursor small subunit,...  93.2    1e-18   
gb|ACM68431.1|  xyloglucan-specific endoglucanase inhibitor protein   92.4    2e-18   Capsicum annuum
ref|XP_002277699.1|  PREDICTED: basic 7S globulin-like                92.4    2e-18   Vitis vinifera
ref|XP_011462765.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  92.4    2e-18   Fragaria vesca subsp. vesca
ref|XP_008222998.1|  PREDICTED: basic 7S globulin 2                   92.0    2e-18   Prunus mume [ume]
ref|XP_010038107.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  92.0    2e-18   
ref|XP_007222421.1|  hypothetical protein PRUPE_ppa006071mg           91.7    3e-18   
gb|KDO74789.1|  hypothetical protein CISIN_1g014679mg                 90.9    5e-18   Citrus sinensis [apfelsine]
ref|XP_009773897.1|  PREDICTED: basic 7S globulin-like                91.3    5e-18   Nicotiana sylvestris
ref|XP_008222987.1|  PREDICTED: basic 7S globulin-like                90.5    8e-18   Prunus mume [ume]
ref|XP_007201544.1|  hypothetical protein PRUPE_ppa017430mg           90.1    1e-17   
gb|KCW84283.1|  hypothetical protein EUGRSUZ_B01135                   89.4    1e-17   Eucalyptus grandis [rose gum]
ref|XP_010038106.1|  PREDICTED: basic 7S globulin 2-like              90.1    1e-17   Eucalyptus grandis [rose gum]
ref|XP_004290668.1|  PREDICTED: basic 7S globulin 2-like              90.1    2e-17   Fragaria vesca subsp. vesca
gb|KDP21480.1|  hypothetical protein JCGZ_21951                       89.7    2e-17   Jatropha curcas
ref|XP_004495219.1|  PREDICTED: basic 7S globulin-like                89.7    2e-17   Cicer arietinum [garbanzo]
gb|ADD71503.1|  xyloglucanase inhibitor 1                             89.7    2e-17   Humulus lupulus [common hop]
ref|XP_010035593.1|  PREDICTED: basic 7S globulin-like                89.4    2e-17   Eucalyptus grandis [rose gum]
gb|AIL30493.1|  xyloglucan-specific fungal endoglucanase inhibito...  89.4    2e-17   Nicotiana tabacum [American tobacco]
ref|XP_009757289.1|  PREDICTED: basic 7S globulin-like                89.4    2e-17   Nicotiana sylvestris
ref|XP_009595035.1|  PREDICTED: basic 7S globulin-like                89.4    3e-17   Nicotiana tomentosiformis
gb|ADG23123.1|  xyloglucan specific endoglucanase inhibitor           89.4    3e-17   Solanum melongena [aubergine]
ref|XP_006419832.1|  hypothetical protein CICLE_v10005038mg           89.0    3e-17   Citrus clementina [clementine]
ref|XP_006489313.1|  PREDICTED: basic 7S globulin-like                89.0    3e-17   Citrus sinensis [apfelsine]
ref|XP_002280508.1|  PREDICTED: basic 7S globulin                     88.2    4e-17   Vitis vinifera
ref|XP_007224886.1|  hypothetical protein PRUPE_ppa022337mg           88.2    4e-17   
pdb|3VLB|A  Chain A, Crystal Structure Of Xeg-edgp                    88.2    4e-17   Aspergillus aculeatus
pdb|3VLA|A  Chain A, Crystal Structure Of Edgp                        87.8    6e-17   Daucus carota [carrots]
ref|XP_004229433.1|  PREDICTED: basic 7S globulin-like                88.2    6e-17   Solanum lycopersicum
emb|CDO98879.1|  unnamed protein product                              88.2    6e-17   Coffea canephora [robusta coffee]
gb|KCW49914.1|  hypothetical protein EUGRSUZ_K03381                   87.8    8e-17   Eucalyptus grandis [rose gum]
ref|XP_010522713.1|  PREDICTED: basic 7S globulin-like                87.8    8e-17   Tarenaya hassleriana [spider flower]
ref|XP_010256207.1|  PREDICTED: basic 7S globulin 2-like              87.8    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010111673.1|  Basic 7S globulin                                87.0    1e-16   Morus notabilis
ref|XP_002517164.1|  basic 7S globulin 2 precursor small subunit,...  87.0    2e-16   Ricinus communis
ref|XP_006429864.1|  hypothetical protein CICLE_v10013399mg           85.9    2e-16   
ref|XP_004495218.1|  PREDICTED: basic 7S globulin 2-like              87.0    2e-16   Cicer arietinum [garbanzo]
ref|XP_010255899.1|  PREDICTED: basic 7S globulin-like                87.0    2e-16   Nelumbo nucifera [Indian lotus]
dbj|BAK57511.1|  extracellular dermal glycoprotein                    86.7    2e-16   Nicotiana benthamiana
ref|XP_006345120.1|  PREDICTED: basic 7S globulin-like                86.7    2e-16   Solanum tuberosum [potatoes]
ref|XP_002517165.1|  basic 7S globulin 2 precursor small subunit,...  86.7    2e-16   Ricinus communis
gb|AAX81588.1|  nectarin IV                                           86.7    2e-16   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_006419822.1|  hypothetical protein CICLE_v10007187mg           86.3    3e-16   Citrus clementina [clementine]
ref|XP_006489578.1|  PREDICTED: basic 7S globulin-like                85.9    3e-16   Citrus sinensis [apfelsine]
emb|CBI26188.3|  unnamed protein product                              85.5    4e-16   Vitis vinifera
emb|CBI26189.3|  unnamed protein product                              84.0    5e-16   Vitis vinifera
gb|KDO74795.1|  hypothetical protein CISIN_1g037976mg                 85.5    6e-16   Citrus sinensis [apfelsine]
ref|XP_002311834.1|  hypothetical protein POPTR_0008s20730g           85.5    6e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006489309.1|  PREDICTED: basic 7S globulin-like                85.5    6e-16   Citrus sinensis [apfelsine]
gb|ACM68432.1|  xyloglucanase-specific endoglucanase inhibitor pr...  85.5    6e-16   Petunia x hybrida [garden petunia]
gb|KDP40108.1|  hypothetical protein JCGZ_02106                       85.1    7e-16   Jatropha curcas
ref|XP_002517162.1|  basic 7S globulin 2 precursor small subunit,...  84.7    7e-16   Ricinus communis
ref|XP_011090790.1|  PREDICTED: basic 7S globulin-like                85.1    9e-16   Sesamum indicum [beniseed]
ref|XP_004236054.1|  PREDICTED: basic 7S globulin-like                84.3    1e-15   Solanum lycopersicum
ref|XP_010667343.1|  PREDICTED: basic 7S globulin-like                84.3    2e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002517173.1|  pepsin A, putative                               84.0    2e-15   
ref|XP_011014389.1|  PREDICTED: basic 7S globulin-like                83.6    2e-15   Populus euphratica
gb|KDP40110.1|  hypothetical protein JCGZ_02108                       83.6    2e-15   Jatropha curcas
ref|XP_006345119.1|  PREDICTED: basic 7S globulin-like                83.6    3e-15   Solanum tuberosum [potatoes]
ref|XP_006419831.1|  hypothetical protein CICLE_v10006962mg           83.6    3e-15   Citrus clementina [clementine]
gb|KJB70565.1|  hypothetical protein B456_011G080800                  83.2    3e-15   Gossypium raimondii
ref|XP_003591797.1|  Xyloglucan-specific endoglucanase inhibitor ...  82.8    4e-15   Medicago truncatula
ref|XP_007034626.1|  Eukaryotic aspartyl protease family protein,...  82.8    4e-15   
ref|XP_006419826.1|  hypothetical protein CICLE_v10006501mg           82.8    5e-15   
ref|XP_009611839.1|  PREDICTED: basic 7S globulin-like                82.8    5e-15   Nicotiana tomentosiformis
gb|AFK42416.1|  unknown                                               82.8    5e-15   Lotus japonicus
ref|XP_006489307.1|  PREDICTED: basic 7S globulin-like                82.4    6e-15   Citrus sinensis [apfelsine]
ref|XP_006419823.1|  hypothetical protein CICLE_v10005035mg           82.4    6e-15   Citrus clementina [clementine]
gb|ADD71504.1|  xyloglucanase inhibitor 2                             82.4    7e-15   Humulus lupulus [common hop]
ref|XP_007143872.1|  hypothetical protein PHAVU_007G109000g           82.4    7e-15   Phaseolus vulgaris [French bean]
gb|KCW49915.1|  hypothetical protein EUGRSUZ_K03382                   82.0    7e-15   Eucalyptus grandis [rose gum]
emb|CBI32364.3|  unnamed protein product                              81.6    9e-15   Vitis vinifera
gb|ADD71505.1|  xyloglucanase inhibitor 3                             82.0    9e-15   Humulus lupulus [common hop]
ref|XP_011015096.1|  PREDICTED: basic 7S globulin-like isoform X1     81.6    1e-14   Populus euphratica
ref|XP_003590668.1|  Basic 7S globulin                                81.6    1e-14   Medicago truncatula
gb|KDO74796.1|  hypothetical protein CISIN_1g038219mg                 81.6    1e-14   Citrus sinensis [apfelsine]
ref|XP_006489308.1|  PREDICTED: basic 7S globulin-like                81.3    2e-14   Citrus sinensis [apfelsine]
gb|KDO74797.1|  hypothetical protein CISIN_1g044303mg                 81.3    2e-14   Citrus sinensis [apfelsine]
ref|XP_004134152.1|  PREDICTED: basic 7S globulin-like                80.9    2e-14   Cucumis sativus [cucumbers]
ref|XP_006419827.1|  hypothetical protein CICLE_v10005000mg           80.9    2e-14   Citrus clementina [clementine]
gb|KHN30567.1|  Basic 7S globulin                                     80.9    3e-14   Glycine soja [wild soybean]
ref|XP_003556387.1|  PREDICTED: basic 7S globulin                     80.5    3e-14   Glycine max [soybeans]
ref|XP_004298169.1|  PREDICTED: basic 7S globulin-like                80.5    3e-14   Fragaria vesca subsp. vesca
ref|XP_003536212.1|  PREDICTED: basic 7S globulin-like                80.5    3e-14   Glycine max [soybeans]
ref|XP_004229432.1|  PREDICTED: basic 7S globulin-like                80.5    3e-14   Solanum lycopersicum
ref|XP_009591595.1|  PREDICTED: basic 7S globulin-like                80.5    3e-14   
ref|XP_008649625.1|  PREDICTED: basic 7S globulin-like                80.1    4e-14   Zea mays [maize]
gb|KDO74798.1|  hypothetical protein CISIN_1g029782mg                 77.4    4e-14   Citrus sinensis [apfelsine]
ref|XP_011011196.1|  PREDICTED: basic 7S globulin-like isoform X1     80.1    5e-14   Populus euphratica
gb|AES60912.2|  xyloglucanase-specific endoglucanase inhibitor pr...  79.3    7e-14   Medicago truncatula
ref|XP_003568479.1|  PREDICTED: basic 7S globulin-like                79.3    7e-14   Brachypodium distachyon [annual false brome]
ref|XP_010938774.1|  PREDICTED: basic 7S globulin-like                79.3    7e-14   Elaeis guineensis
ref|XP_004229434.1|  PREDICTED: basic 7S globulin-like                79.3    8e-14   Solanum lycopersicum
ref|XP_003590661.1|  Basic 7S globulin                                79.3    1e-13   
ref|XP_006380060.1|  hypothetical protein POPTR_0008s20740g           79.0    1e-13   
ref|XP_002517171.1|  basic 7S globulin 2 precursor small subunit,...  79.0    1e-13   Ricinus communis
ref|XP_006850763.1|  hypothetical protein AMTR_s00025p00079140        79.0    1e-13   Amborella trichopoda
ref|NP_001055496.1|  Os05g0402900                                     79.0    1e-13   
ref|XP_010556788.1|  PREDICTED: basic 7S globulin-like                79.0    1e-13   Tarenaya hassleriana [spider flower]
ref|XP_004495384.1|  PREDICTED: basic 7S globulin-like                79.0    1e-13   Cicer arietinum [garbanzo]
ref|XP_009590387.1|  PREDICTED: basic 7S globulin 2-like              76.6    2e-13   Nicotiana tomentosiformis
gb|EAY97992.1|  hypothetical protein OsI_19909                        77.8    2e-13   Oryza sativa Indica Group [Indian rice]
gb|KFK42683.1|  hypothetical protein AALP_AA1G026300                  79.0    2e-13   Arabis alpina [alpine rockcress]
ref|XP_010522709.1|  PREDICTED: basic 7S globulin-like                77.8    2e-13   
ref|XP_006419811.1|  hypothetical protein CICLE_v10004995mg           77.8    3e-13   
ref|XP_006419809.1|  hypothetical protein CICLE_v10004993mg           77.8    3e-13   Citrus clementina [clementine]
ref|XP_006489297.1|  PREDICTED: basic 7S globulin-like                77.8    3e-13   
ref|XP_006654379.1|  PREDICTED: basic 7S globulin-like                77.4    3e-13   
ref|XP_006654378.1|  PREDICTED: basic 7S globulin-like                77.4    3e-13   Oryza brachyantha
ref|XP_004134153.1|  PREDICTED: basic 7S globulin-like                77.4    3e-13   Cucumis sativus [cucumbers]
ref|XP_006489306.1|  PREDICTED: basic 7S globulin-like                77.0    4e-13   Citrus sinensis [apfelsine]
ref|XP_004170542.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  77.4    4e-13   
gb|EAZ44805.1|  hypothetical protein OsJ_29439                        77.4    4e-13   Oryza sativa Japonica Group [Japonica rice]
emb|CDP10858.1|  unnamed protein product                              77.0    4e-13   Coffea canephora [robusta coffee]
dbj|BAD33624.1|  putative dermal glycoprotein precursor, extracel...  77.0    4e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008810759.1|  PREDICTED: basic 7S globulin-like                77.0    5e-13   
ref|XP_009411762.1|  PREDICTED: basic 7S globulin-like                76.6    5e-13   
ref|XP_006419821.1|  hypothetical protein CICLE_v10005127mg           76.6    6e-13   Citrus clementina [clementine]
ref|XP_008438715.1|  PREDICTED: basic 7S globulin-like                76.3    8e-13   Cucumis melo [Oriental melon]
ref|XP_011015097.1|  PREDICTED: basic 7S globulin-like isoform X2     76.3    9e-13   Populus euphratica
gb|KDO70938.1|  hypothetical protein CISIN_1g041364mg                 74.7    9e-13   Citrus sinensis [apfelsine]
ref|XP_009597883.1|  PREDICTED: basic 7S globulin-like                76.3    9e-13   Nicotiana tomentosiformis
gb|KDP40109.1|  hypothetical protein JCGZ_02107                       75.9    1e-12   Jatropha curcas
ref|NP_001174419.1|  Os05g0403000                                     75.9    1e-12   
gb|KDO74801.1|  hypothetical protein CISIN_1g040581mg                 75.5    1e-12   Citrus sinensis [apfelsine]
ref|XP_009111159.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  75.5    1e-12   Brassica rapa
ref|XP_006387875.1|  hypothetical protein POPTR_0509s00200g           75.5    2e-12   
gb|EAY97993.1|  hypothetical protein OsI_19910                        73.2    2e-12   Oryza sativa Indica Group [Indian rice]
emb|CDX86682.1|  BnaC08g00210D                                        75.1    2e-12   
ref|XP_006349245.1|  PREDICTED: basic 7S globulin-like                75.5    2e-12   Solanum tuberosum [potatoes]
gb|KJB61114.1|  hypothetical protein B456_009G341600                  74.7    2e-12   Gossypium raimondii
gb|EYU20619.1|  hypothetical protein MIMGU_mgv1a026442mg              74.7    3e-12   Erythranthe guttata [common monkey flower]
emb|CAN68737.1|  hypothetical protein VITISV_030194                   74.3    3e-12   Vitis vinifera
ref|XP_006489295.1|  PREDICTED: basic 7S globulin-like                74.3    4e-12   Citrus sinensis [apfelsine]
ref|XP_010659830.1|  PREDICTED: basic 7S globulin-like                74.3    4e-12   
ref|XP_011011197.1|  PREDICTED: basic 7S globulin-like isoform X2     74.3    4e-12   Populus euphratica
ref|XP_006419808.1|  hypothetical protein CICLE_v10006987mg           74.3    4e-12   Citrus clementina [clementine]
ref|XP_008340919.1|  PREDICTED: basic 7S globulin                     73.9    5e-12   
ref|XP_006489296.1|  PREDICTED: basic 7S globulin-like                73.9    5e-12   Citrus sinensis [apfelsine]
emb|CDY15456.1|  BnaA08g27400D                                        73.2    1e-11   Brassica napus [oilseed rape]
gb|EEC84612.1|  hypothetical protein OsI_31447                        73.6    1e-11   Oryza sativa Indica Group [Indian rice]
dbj|BAJ94733.1|  predicted protein                                    72.8    1e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001274964.1|  xyloglucan-specific endoglucanase inhibitor ...  73.2    1e-11   Solanum tuberosum [potatoes]
ref|XP_002284868.1|  PREDICTED: basic 7S globulin-like                73.2    1e-11   Vitis vinifera
ref|XP_006349243.1|  PREDICTED: basic 7S globulin-like                72.8    1e-11   
emb|CAN68736.1|  hypothetical protein VITISV_030193                   72.8    1e-11   Vitis vinifera
ref|XP_006349244.1|  PREDICTED: basic 7S globulin-like                72.8    1e-11   Solanum tuberosum [potatoes]
ref|XP_009364261.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  72.4    1e-11   Pyrus x bretschneideri [bai li]
ref|XP_010039912.1|  PREDICTED: basic 7S globulin-like                72.8    1e-11   Eucalyptus grandis [rose gum]
ref|XP_006844967.1|  hypothetical protein AMTR_s00058p00179910        72.4    2e-11   Amborella trichopoda
gb|AAM61574.1|  EDGP precursor                                        72.0    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KDO74790.1|  hypothetical protein CISIN_1g035972mg                 71.2    2e-11   Citrus sinensis [apfelsine]
ref|NP_171821.1|  aspartyl protease-like protein                      72.0    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EYU41536.1|  hypothetical protein MIMGU_mgv1a024772mg              71.6    3e-11   Erythranthe guttata [common monkey flower]
ref|NP_001055497.1|  Os05g0403300                                     71.6    4e-11   
ref|XP_010035585.1|  PREDICTED: basic 7S globulin                     71.2    4e-11   Eucalyptus grandis [rose gum]
gb|EPS72958.1|  hypothetical protein M569_01796                       70.9    5e-11   Genlisea aurea
ref|XP_009625013.1|  PREDICTED: basic 7S globulin-like                70.9    5e-11   
ref|XP_006304586.1|  hypothetical protein CARUB_v10011636mg           70.5    6e-11   Capsella rubella
ref|XP_004962140.1|  PREDICTED: basic 7S globulin-like                70.1    1e-10   Setaria italica
ref|XP_010475063.1|  PREDICTED: basic 7S globulin-like                70.1    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_008438716.1|  PREDICTED: basic 7S globulin-like isoform X1     70.1    1e-10   
ref|XP_010457449.1|  PREDICTED: basic 7S globulin-like                70.1    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_003626314.1|  Basic 7S globulin                                70.1    1e-10   Medicago truncatula
ref|XP_010483190.1|  PREDICTED: basic 7S globulin-like                69.7    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_009118711.1|  PREDICTED: basic 7S globulin-like                69.7    1e-10   Brassica rapa
emb|CDY37436.1|  BnaC08g45740D                                        68.6    1e-10   Brassica napus [oilseed rape]
ref|XP_002439768.1|  hypothetical protein SORBIDRAFT_09g019770        69.7    2e-10   
ref|XP_008246503.1|  PREDICTED: basic 7S globulin-like                69.3    2e-10   Prunus mume [ume]
gb|KFK26154.1|  hypothetical protein AALP_AA8G210500                  68.9    2e-10   Arabis alpina [alpine rockcress]
ref|XP_006654380.1|  PREDICTED: basic 7S globulin-like                69.3    2e-10   Oryza brachyantha
ref|XP_009342158.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  68.9    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_007034627.1|  Eukaryotic aspartyl protease family protein,...  69.3    2e-10   
ref|XP_002517174.1|  conserved hypothetical protein                   68.9    2e-10   Ricinus communis
ref|XP_007205231.1|  hypothetical protein PRUPE_ppa006032mg           68.9    2e-10   Prunus persica
ref|XP_006419825.1|  hypothetical protein CICLE_v10007108mg           68.9    2e-10   
ref|XP_002889446.1|  EDGP precursor                                   68.9    2e-10   
ref|XP_004246189.2|  PREDICTED: basic 7S globulin-like                68.9    2e-10   Solanum lycopersicum
ref|XP_002517167.1|  basic 7S globulin 2 precursor small subunit,...  68.9    3e-10   Ricinus communis
emb|CDY32500.1|  BnaA09g50960D                                        68.9    3e-10   Brassica napus [oilseed rape]
emb|CDP03611.1|  unnamed protein product                              66.2    3e-10   Coffea canephora [robusta coffee]
gb|KCW84282.1|  hypothetical protein EUGRSUZ_B01133                   68.6    4e-10   Eucalyptus grandis [rose gum]
ref|XP_010045852.1|  PREDICTED: basic 7S globulin-like                68.6    4e-10   Eucalyptus grandis [rose gum]
gb|EYU20615.1|  hypothetical protein MIMGU_mgv1a006692mg              68.2    4e-10   Erythranthe guttata [common monkey flower]
ref|XP_011091050.1|  PREDICTED: basic 7S globulin 2-like              67.8    5e-10   Sesamum indicum [beniseed]
ref|XP_006296506.1|  hypothetical protein CARUB_v10025694mg           67.8    5e-10   Capsella rubella
gb|KDP40115.1|  hypothetical protein JCGZ_02113                       67.8    6e-10   Jatropha curcas
gb|KEH36784.1|  xyloglucanase-specific endoglucanase inhibitor pr...  67.4    7e-10   Medicago truncatula
ref|XP_009342159.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  67.4    7e-10   Pyrus x bretschneideri [bai li]
dbj|BAE99306.1|  conglutin gamma - like protein                       67.4    7e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197413.1|  aspartyl protease family protein                    67.4    8e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004494958.1|  PREDICTED: basic 7S globulin 2-like              66.6    1e-09   Cicer arietinum [garbanzo]
emb|CDX88901.1|  BnaA03g07480D                                        66.6    1e-09   
ref|XP_008222995.1|  PREDICTED: basic 7S globulin-like                66.6    1e-09   Prunus mume [ume]
ref|XP_004229564.1|  PREDICTED: basic 7S globulin-like                66.6    2e-09   Solanum lycopersicum
ref|XP_006400469.1|  hypothetical protein EUTSA_v10013774mg           66.2    2e-09   Eutrema salsugineum [saltwater cress]
ref|XP_010546839.1|  PREDICTED: basic 7S globulin                     66.2    2e-09   Tarenaya hassleriana [spider flower]
gb|KCW45639.1|  hypothetical protein EUGRSUZ_L005901                  63.5    2e-09   Eucalyptus grandis [rose gum]
ref|XP_008458562.1|  PREDICTED: basic 7S globulin-like                65.9    2e-09   Cucumis melo [Oriental melon]
gb|AGT17598.1|  xyloglucan-specific endoglucanase inhibitor 11        65.9    2e-09   Solanum tuberosum [potatoes]
ref|XP_004233956.1|  PREDICTED: basic 7S globulin-like                65.9    2e-09   Solanum lycopersicum
ref|XP_006418255.1|  hypothetical protein EUTSA_v10007672mg           65.9    3e-09   Eutrema salsugineum [saltwater cress]
ref|XP_010693887.1|  PREDICTED: basic 7S globulin-like                65.1    4e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003550008.2|  PREDICTED: basic 7S globulin 2-like              64.7    5e-09   
gb|KHN03449.1|  Basic 7S globulin                                     64.7    6e-09   Glycine soja [wild soybean]
ref|XP_008438718.1|  PREDICTED: basic 7S globulin-like                64.7    6e-09   Cucumis melo [Oriental melon]
ref|XP_010481702.1|  PREDICTED: basic 7S globulin-like                64.7    6e-09   Camelina sativa [gold-of-pleasure]
gb|EYU20618.1|  hypothetical protein MIMGU_mgv1a018279mg              64.7    6e-09   Erythranthe guttata [common monkey flower]
gb|AAB03390.1|  7S seed globulin precursor                            64.7    7e-09   Glycine max [soybeans]
ref|XP_011099700.1|  PREDICTED: basic 7S globulin-like                64.3    9e-09   
ref|XP_011091047.1|  PREDICTED: basic 7S globulin 2-like              64.3    9e-09   Sesamum indicum [beniseed]
ref|XP_010457326.1|  PREDICTED: basic 7S globulin-like                63.9    1e-08   
ref|XP_010278299.1|  PREDICTED: basic 7S globulin-like                63.9    1e-08   Nelumbo nucifera [Indian lotus]
ref|XP_003521716.1|  PREDICTED: basic 7S globulin                     63.9    1e-08   
gb|KFK42681.1|  hypothetical protein AALP_AA1G026100                  63.9    1e-08   Arabis alpina [alpine rockcress]
pdb|3AUP|A  Chain A, Crystal Structure Of Basic 7s Globulin From ...  63.9    1e-08   Glycine max [soybeans]
ref|XP_002871863.1|  pepsin A                                         63.9    1e-08   
emb|CAA34489.1|  unnamed protein product                              63.9    1e-08   Glycine max [soybeans]
ref|XP_010420702.1|  PREDICTED: basic 7S globulin 2-like              63.5    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_004486304.1|  PREDICTED: basic 7S globulin 2-like              63.5    2e-08   Cicer arietinum [garbanzo]
gb|EYU41535.1|  hypothetical protein MIMGU_mgv1a007318mg              63.2    2e-08   Erythranthe guttata [common monkey flower]
ref|XP_010454178.1|  PREDICTED: basic 7S globulin 2-like              63.2    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_007224945.1|  hypothetical protein PRUPE_ppa021451mg           63.2    2e-08   Prunus persica
ref|XP_008366845.1|  PREDICTED: basic 7S globulin-like                63.2    2e-08   
ref|XP_004134154.1|  PREDICTED: basic 7S globulin-like                63.2    2e-08   Cucumis sativus [cucumbers]
ref|XP_009349976.1|  PREDICTED: basic 7S globulin-like                63.2    2e-08   Pyrus x bretschneideri [bai li]
ref|XP_009373976.1|  PREDICTED: basic 7S globulin-like                63.2    2e-08   Pyrus x bretschneideri [bai li]
gb|KHN03053.1|  Basic 7S globulin                                     62.8    3e-08   Glycine soja [wild soybean]
ref|XP_004151001.1|  PREDICTED: basic 7S globulin-like                62.8    3e-08   Cucumis sativus [cucumbers]
ref|XP_004170412.1|  PREDICTED: basic 7S globulin-like                62.8    3e-08   
ref|NP_001239980.1|  uncharacterized protein LOC100806719 precursor   62.8    3e-08   Glycine max [soybeans]
ref|NP_001237167.1|  basic 7S globulin 2 precursor                    62.8    3e-08   Glycine max [soybeans]
ref|XP_004246190.2|  PREDICTED: basic 7S globulin-like                62.8    3e-08   
emb|CDX70865.1|  BnaC03g09490D                                        62.4    4e-08   
ref|XP_010255898.1|  PREDICTED: basic 7S globulin-like                62.4    4e-08   
gb|EYU20620.1|  hypothetical protein MIMGU_mgv1a006733mg              62.4    4e-08   Erythranthe guttata [common monkey flower]
gb|KJB26454.1|  hypothetical protein B456_004G242400                  62.0    4e-08   Gossypium raimondii
gb|KJB45207.1|  hypothetical protein B456_007G295400                  62.0    5e-08   Gossypium raimondii
gb|KJB26455.1|  hypothetical protein B456_004G242500                  61.2    7e-08   Gossypium raimondii
ref|NP_563679.1|  aspartyl protease-like protein                      61.2    8e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KCW84284.1|  hypothetical protein EUGRSUZ_B01136                   61.2    8e-08   
ref|XP_006289450.1|  hypothetical protein CARUB_v10002965mg           60.8    9e-08   
gb|EYU20616.1|  hypothetical protein MIMGU_mgv1a026206mg              61.2    1e-07   
ref|XP_002877156.1|  hypothetical protein ARALYDRAFT_484681           60.8    1e-07   
ref|XP_010086743.1|  Basic 7S globulin                                60.8    1e-07   
gb|AAT85211.1|  hypothetical protein                                  60.8    1e-07   
ref|XP_011091048.1|  PREDICTED: basic 7S globulin-like                60.5    1e-07   
ref|XP_010045855.1|  PREDICTED: basic 7S globulin-like                60.5    2e-07   
ref|XP_009120915.1|  PREDICTED: basic 7S globulin 2                   60.5    2e-07   
ref|XP_009615960.1|  PREDICTED: basic 7S globulin-like                60.5    2e-07   
emb|CDY59021.1|  BnaCnng34100D                                        60.1    2e-07   
emb|CDP19874.1|  unnamed protein product                              60.1    2e-07   
emb|CDX92553.1|  BnaA10g15920D                                        59.7    3e-07   
ref|XP_007030900.1|  Eukaryotic aspartyl protease family protein,...  59.7    3e-07   
ref|XP_010474940.1|  PREDICTED: basic 7S globulin-like                59.7    3e-07   
gb|AAB53771.1|  conglutin gamma                                       59.3    3e-07   
pdb|4PPH|A  Chain A, Crystal Structure Of Conglutin Gamma, A Uniq...  59.3    3e-07   
ref|XP_010677554.1|  PREDICTED: basic 7S globulin-like                58.9    5e-07   
ref|XP_006850764.1|  hypothetical protein AMTR_s00025p00079520        58.5    6e-07   
gb|EEE63673.1|  hypothetical protein OsJ_18491                        58.5    6e-07   
ref|XP_010242827.1|  PREDICTED: basic 7S globulin-like                58.5    7e-07   
emb|CAC16394.1|  conglutin gamma                                      58.2    8e-07   
emb|CBI37209.3|  unnamed protein product                              57.0    8e-07   
ref|XP_009760543.1|  PREDICTED: basic 7S globulin-like                58.2    9e-07   
gb|ACU20443.1|  unknown                                               57.4    9e-07   
ref|XP_006349246.1|  PREDICTED: basic 7S globulin-like                58.2    1e-06   
ref|XP_002517175.1|  pepsin A, putative                               57.8    1e-06   
ref|XP_007147069.1|  hypothetical protein PHAVU_006G093600g           57.8    1e-06   
ref|XP_009786807.1|  PREDICTED: basic 7S globulin-like                57.4    1e-06   
ref|XP_010492960.1|  PREDICTED: basic 7S globulin 2-like              57.4    2e-06   
emb|CDY13979.1|  BnaC09g38470D                                        57.4    2e-06   
ref|XP_011091049.1|  PREDICTED: basic 7S globulin 2-like              57.4    2e-06   
gb|AEB33720.1|  conglutin gamma 2                                     57.0    2e-06   
ref|XP_009111160.1|  PREDICTED: basic 7S globulin-like                57.0    3e-06   
ref|XP_007154121.1|  hypothetical protein PHAVU_003G092100g           56.6    3e-06   
ref|XP_003546133.1|  PREDICTED: basic 7S globulin                     56.6    3e-06   
ref|XP_009613161.1|  PREDICTED: basic 7S globulin-like                56.2    4e-06   
gb|EEE63670.1|  hypothetical protein OsJ_18488                        56.2    4e-06   
ref|XP_004305011.1|  PREDICTED: basic 7S globulin-like                55.8    5e-06   
ref|XP_008363982.1|  PREDICTED: basic 7S globulin-like                55.8    5e-06   
ref|XP_006352950.1|  PREDICTED: basic 7S globulin-like                55.8    6e-06   
gb|KDO59528.1|  hypothetical protein CISIN_1g0364391mg                55.1    7e-06   
ref|XP_010676965.1|  PREDICTED: basic 7S globulin 2-like              55.5    7e-06   
gb|AHG54973.1|  xyloglucan-specific endoglucanase inhibitor 10        55.1    1e-05   
gb|EYU22657.1|  hypothetical protein MIMGU_mgv1a022346mg              54.7    1e-05   
ref|XP_010325564.1|  PREDICTED: basic 7S globulin-like                54.7    2e-05   
gb|KHN43271.1|  Basic 7S globulin 2                                   54.3    2e-05   
gb|KDP21481.1|  hypothetical protein JCGZ_21952                       54.3    2e-05   
emb|CDY15455.1|  BnaA08g27390D                                        54.3    2e-05   
ref|XP_009596039.1|  PREDICTED: basic 7S globulin-like                54.3    2e-05   
emb|CDY72428.1|  BnaUnng05140D                                        51.6    3e-05   
gb|KCW60850.1|  hypothetical protein EUGRSUZ_H03588                   53.9    3e-05   
ref|NP_001241217.1|  uncharacterized protein LOC100818868 precursor   53.9    3e-05   
ref|XP_006346986.1|  PREDICTED: basic 7S globulin-like                53.9    3e-05   
ref|XP_003542884.1|  PREDICTED: basic 7S globulin                     53.5    4e-05   
gb|ACU24232.1|  unknown                                               53.1    4e-05   
ref|XP_006349239.1|  PREDICTED: basic 7S globulin-like                53.1    4e-05   
ref|XP_003637703.1|  Basic 7S globulin                                53.1    4e-05   
gb|AFK34779.1|  unknown                                               53.1    5e-05   
emb|CAC17729.2|  conglutin gamma                                      53.1    5e-05   
ref|XP_007154122.1|  hypothetical protein PHAVU_003G092200g           52.8    5e-05   
ref|XP_009769391.1|  PREDICTED: basic 7S globulin-like                52.0    1e-04   
ref|XP_010024400.1|  PREDICTED: basic 7S globulin 2-like              51.6    1e-04   
ref|XP_007147764.1|  hypothetical protein PHAVU_006G153200g           51.6    1e-04   
gb|KFK42682.1|  hypothetical protein AALP_AA1G026200                  51.2    2e-04   
gb|AER26945.1|  xyloglucan-specific endoglucanase inhibitor 9         51.2    2e-04   
ref|XP_010322603.1|  PREDICTED: basic 7S globulin-like isoform X2     50.8    2e-04   
gb|KCW60844.1|  hypothetical protein EUGRSUZ_H03581                   50.8    2e-04   
ref|XP_010322595.1|  PREDICTED: basic 7S globulin-like isoform X1     50.8    2e-04   
ref|XP_002272199.2|  PREDICTED: basic 7S globulin 2-like              50.8    3e-04   
ref|XP_011078750.1|  PREDICTED: LOW QUALITY PROTEIN: basic 7S glo...  50.8    3e-04   
gb|KCW60840.1|  hypothetical protein EUGRSUZ_H03578                   50.4    3e-04   
ref|XP_010026985.1|  PREDICTED: basic 7S globulin-like                50.4    4e-04   
gb|KDP40113.1|  hypothetical protein JCGZ_02111                       49.7    6e-04   
ref|XP_006371346.1|  hypothetical protein POPTR_0019s09300g           49.7    6e-04   
ref|XP_006371344.1|  hypothetical protein POPTR_0019s09280g           49.7    7e-04   
ref|XP_010694712.1|  PREDICTED: basic 7S globulin-like                49.7    7e-04   
gb|EYU22654.1|  hypothetical protein MIMGU_mgv1a026561mg              49.7    7e-04   
gb|KJB25917.1|  hypothetical protein B456_004G215700                  49.3    8e-04   



>ref|XP_006339396.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=416

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 117/169 (69%), Gaps = 7/169 (4%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYN-LAPLKLVVDVGGPFLWADWA----S  301
            S++  PF P+AI++ V+KD  T QYV QL MG N LAP+KLVV++GG FLWAD      S
Sbjct  20   SVSHGPFLPKAIILPVNKDPSTFQYVTQLYMGANHLAPIKLVVNLGGSFLWADCGLTSDS  79

Query  302  SSQGSIPCGSLKSSMANPKGCTS-NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
            SSQ  +PC SLK SMA P GCT+ N+IC L+ ENP +++A +G L ED  AVE IDE   
Sbjct  80   SSQKLVPCNSLKCSMAKPNGCTNDNKICGLKSENPFTRLAATGELAEDMFAVEFIDELKT  139

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
            GS  S +  FLFS   S L QGL  G  G+L LGNSRI+LPSQL++TFG
Sbjct  140  GSVAS-IHQFLFSCTSSTLLQGLARGAKGMLGLGNSRIALPSQLSDTFG  187



>ref|XP_009611838.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=420

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 112/167 (67%), Gaps = 6/167 (4%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWA----SS  304
            S++  PF P+AI++ V+KD  T QYV Q+ MG +L P  LVVD+GG FLW +      SS
Sbjct  21   SVSHGPFLPKAIILPVNKDLSTFQYVTQVYMGAHLVPTNLVVDLGGSFLWTNCGLTSVSS  80

Query  305  SQGSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGS  484
            SQ  +PC SLK SMA P GCT N+IC +Q ENP +K+A +G L ED  AVE IDE   GS
Sbjct  81   SQKLVPCNSLKCSMAKPNGCT-NKICGVQSENPFTKVAATGELAEDMFAVEFIDELKTGS  139

Query  485  FLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
              S +  FLFS   + L QGL  G  G+L LGNSRI+LPS+L++TFG
Sbjct  140  IAS-IHEFLFSCASTTLLQGLARGAKGMLGLGNSRIALPSKLSDTFG  185



>ref|XP_004229435.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=417

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 114/168 (68%), Gaps = 7/168 (4%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMG-YNLAPLKLVVDVGGPFLWADWA----SS  304
            ++  PF P+AI++ V+KD  T QYV QL MG  + AP+KLVVD+ G FLWAD      SS
Sbjct  21   VSHGPFLPKAIILPVNKDPSTFQYVTQLYMGATHRAPIKLVVDLEGSFLWADCGLTSDSS  80

Query  305  SQGSIPCGSLKSSMANPKGCTS-NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAG  481
            SQ  +PC SLK SMA P GCT+ N+IC L+ ENP +++A +G L ED  AVE IDE   G
Sbjct  81   SQKLVPCNSLKCSMAKPNGCTNDNKICGLKSENPFTRLAATGELAEDMFAVEFIDELKTG  140

Query  482  SFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
            S  S +  FLFS   S L QGL  G  G+L LGNSRI+LPSQL++TFG
Sbjct  141  SVAS-IHQFLFSCTSSTLLQGLARGAKGMLGLGNSRIALPSQLSDTFG  187



>ref|XP_011090791.1| PREDICTED: basic 7S globulin [Sesamum indicum]
Length=417

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 113/176 (64%), Gaps = 14/176 (8%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADW----ASS  304
            S++Q P  P+A +I V+KDF T QYVA + +G NLAP+KLVVD+ GPF+W D      S+
Sbjct  20   SVSQNPILPKAGIIPVTKDFSTLQYVADVLVGENLAPVKLVVDLNGPFVWVDCEVHSVSA  79

Query  305  SQGSIPCGSLKSSMANP-KGCT--------SNEICELQFENPVSKMAGSGVLKEDTIAVE  457
            SQ  +   SLK SMA P  GC+         ++IC LQ EN +++M+ S  LKED +A+E
Sbjct  80   SQQPVESCSLKCSMAKPISGCSRPGGGAVHDSKICTLQAENTIARMSTSVELKEDRMAIE  139

Query  458  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
              D   +GSF +    FLFS  P+ L +GL NG  G+L LGNSRIS PSQ ++TFG
Sbjct  140  FWDGTGSGSF-ARSEKFLFSCAPNLLLKGLANGAKGMLGLGNSRISFPSQFSSTFG  194



>emb|CDO98999.1| unnamed protein product [Coffea canephora]
Length=440

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 108/176 (61%), Gaps = 14/176 (8%)
 Frame = +2

Query  131  TISLAQR-PFFPRAIVIAVSKDFPTSQYVAQLQMGYN-LAPLKLVVDVGGPFLWADWA--  298
            T+++A+  PF P ++++ V+KD  T QYV Q  +G   LAP KLV+D+ G   W D A  
Sbjct  34   TVTIAKEGPFLPNSVILPVTKDIATHQYVTQTYVGDQPLAPTKLVIDISGSSSWIDSAHL  93

Query  299  -SSSQGSIP--CGSLKSSMANPKGCT-----SNEICELQFENPVSKMAGSGVLKEDTIAV  454
             SSS    P  C SL+ S A    CT     S   C L+ ENP++ M   G L E+ IAV
Sbjct  94   LSSSGHPRPFGCFSLQCSWAEANSCTRPSGTSRNTCTLEAENPITNMVTRGELTEEIIAV  153

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++ D    G  L+ VP+FLFS VP+ L +GLG+GV GVL LGN+RISLPSQ+A+ F
Sbjct  154  QVTDGIKTG--LASVPHFLFSCVPALLLRGLGDGVKGVLGLGNTRISLPSQVADAF  207



>ref|XP_010255900.1| PREDICTED: basic 7S globulin 2-like [Nelumbo nucifera]
Length=434

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 98/174 (56%), Gaps = 15/174 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            AQ+ F P+A+V+ V+KD  T QY+ QL     L  + LVVDVGG FLW D    + SSS 
Sbjct  20   AQQSFRPKALVLPVTKDASTLQYLTQLNQRTPLVAINLVVDVGGQFLWVDCDQGYVSSSY  79

Query  311  GSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  460
                CGS + S+A    C           +N  C L  +N V+  A SG L +D ++++ 
Sbjct  80   LPARCGSAQCSLAKSTSCGDCNSAPRPGCNNNTCGLLPDNTVTNTATSGELTQDVVSIQS  139

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             D  N G  ++ VP FLF+  P+FL +GL +GV G+  LG +RI+LPSQ A  F
Sbjct  140  TDGKNPGRVVT-VPRFLFTCAPTFLLEGLASGVVGMAGLGRTRIALPSQFAAAF  192



>ref|XP_008390829.1| PREDICTED: basic 7S globulin-like [Malus domestica]
Length=438

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 98/170 (58%), Gaps = 15/170 (9%)
 Frame = +2

Query  155  FFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA---DWASSSQGSIPC  325
            F P+A+V+ V+KD  T QY+  L     L P+KL V +GGPFLW    D+ SS+     C
Sbjct  30   FRPKALVLPVTKDSSTLQYLTTLSQRTPLVPIKLTVHLGGPFLWVECEDYISSTYKPARC  89

Query  326  GSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  472
             S + S+AN K CT+           N  C L  +NP+++ AG G L +D ++++  D  
Sbjct  90   NSAQCSLANSKSCTTECYSPPSPGCNNNTCGLLPDNPINRTAGGGDLGQDMVSIQSTDGS  149

Query  473  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            N G  +S VPN LF+   +FL +GL +GV G+  LG ++I LPSQ A+ F
Sbjct  150  NPGRLVS-VPNLLFTCGSAFLLEGLASGVKGMAGLGRAKIGLPSQFASAF  198



>gb|KJB46995.1| hypothetical protein B456_008G005100 [Gossypium raimondii]
Length=436

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 98/176 (56%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASS  304
            SLAQ+ F P+A+VI V+KD  T QY+  +     L P+ LVVD+GG  +W     D+ SS
Sbjct  20   SLAQQSFRPKALVIPVAKDASTLQYLTTISQRTPLMPIDLVVDLGGRHMWVDCDRDYVSS  79

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            +     C S + S+A   GC           +N  C +  +N V+ +A SG + +D +++
Sbjct  80   TYRPARCRSAQCSLAGADGCGDCFSAPRPGCNNNTCGVTPDNSVTHIATSGEVAQDVVSI  139

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  D  N G  +S VP FLF+  PSFL QGL  GV G+  LG +RI LPSQ A  F
Sbjct  140  QSTDGKNPGRVVS-VPRFLFACAPSFLLQGLATGVVGMAGLGRTRIGLPSQFAAAF  194



>ref|XP_011026191.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=438

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 99/176 (56%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S+AQ+ F P+A+V+ V++D  T QYV Q++      P+ LVVD+GG FLW D    + SS
Sbjct  21   SIAQQSFRPKALVVPVTRDSATLQYVTQIKQRTPQVPINLVVDLGGQFLWVDCDQSYVSS  80

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            +     CGS   S+A   GC           +N  C +  +N V++ A  G L  D ++V
Sbjct  81   TYRPARCGSALCSLARAGGCGDCFSGPRPGCNNNTCGVIPDNTVTRTATGGELATDVVSV  140

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
               +  N G  +S VP FLFS  P+FL QGL +GV G+  LG +RI+ PSQ A+ F
Sbjct  141  NSTNGSNPGREVS-VPRFLFSCAPTFLLQGLASGVVGMAGLGRTRIAFPSQFASAF  195



>ref|XP_002520766.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41728.1| conserved hypothetical protein [Ricinus communis]
Length=273

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 95/178 (53%), Gaps = 15/178 (8%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S+AQ+ F PRA+V+ VSKD  T QYV Q++    L P+ LVV +GG FLW D    + SS
Sbjct  21   SIAQQSFRPRALVVPVSKDASTLQYVTQVEQRTPLVPINLVVHLGGKFLWIDCEQNYVSS  80

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            +     CGS   S+    GC           +N  C +  +NP +  A  G L  D ++V
Sbjct  81   TYRPARCGSALCSLGGSDGCGDCFSGPRPGCNNNTCGVSPDNPFTNTATGGELATDVVSV  140

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
               +  N G  ++ VP FLF+  P+FL QGL  G  G+  LG +R + PSQ A+ F +
Sbjct  141  NSTNGSNPGRAVT-VPRFLFACAPTFLLQGLATGAVGIAGLGRNRAAFPSQFASAFSL  197



>gb|EYU41534.1| hypothetical protein MIMGU_mgv1a008121mg [Erythranthe guttata]
Length=384

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 99/165 (60%), Gaps = 7/165 (4%)
 Frame = +2

Query  152  PFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASS----SQGSI  319
            P  P+A ++ + KD  T QY+A + MG  LA ++LVVD+ G F+W D  S+    S   I
Sbjct  29   PILPKAAILPLKKDPTTLQYIATVFMGGTLAAVELVVDINGGFVWVDCESNPTLRSHEPI  88

Query  320  PCGSLKSSMA-NP-KGCTS-NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFL  490
               SLK SMA NP  GC S ++ C L  EN VS+M+ SG L ED +A+E  +       L
Sbjct  89   KSCSLKCSMAKNPVNGCHSASKNCLLHPENTVSRMSVSGDLNEDRVAMEFWERNIGSRSL  148

Query  491  SHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
            + + NFLFS  P+ L +GL +G  G+L LGNSRIS PSQ +  FG
Sbjct  149  AKIENFLFSCAPNLLMKGLASGAKGMLGLGNSRISFPSQFSTEFG  193



>ref|XP_002302122.1| hypothetical protein POPTR_0002s05580g [Populus trichocarpa]
 gb|EEE81395.1| hypothetical protein POPTR_0002s05580g [Populus trichocarpa]
Length=438

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 98/176 (56%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S+AQ+ F P+A+V+ V+KD  T QYV Q++      P+ LVVD+GG FLW D    + SS
Sbjct  21   SIAQQSFRPKALVVPVTKDSATLQYVTQIKQRTPQVPINLVVDLGGQFLWVDCDKNYVSS  80

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            +     CGS   S+A   GC           +N  C +  +N V++ A  G L  D ++V
Sbjct  81   TYRPARCGSALCSLARAGGCGDCFSGPRPGCNNNTCGVIPDNTVTRTATGGELATDVVSV  140

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
               +  N G   S VP FLFS  P+FL QGL +GV G+  LG +RI+ PSQ A+ F
Sbjct  141  NSTNGSNPGREAS-VPRFLFSCAPTFLLQGLASGVVGMAGLGRTRIAFPSQFASAF  195



>ref|XP_011082548.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=432

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 94/178 (53%), Gaps = 15/178 (8%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            +IS AQR F P A+V+ V KD  T QYV  +     L P+ LVV +GG FLW D    + 
Sbjct  17   SISHAQRSFRPDALVLRVRKDVSTLQYVTMINQRTPLVPVNLVVHLGGQFLWVDCDNNYV  76

Query  299  SSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  448
            SSS   + C S + S A    C           +N  C +  +NP ++ A  G L ED +
Sbjct  77   SSSYRPVRCRSAQCSRAGSTSCGDCFNGPRPGCNNNTCGVIPDNPFTRTATGGELAEDVV  136

Query  449  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +V+  D  N G  ++ VP F+FS  P+FL QGL +G  G+  LG +RI  PSQ A  F
Sbjct  137  SVQSTDGSNPGPLVT-VPRFIFSCAPTFLLQGLASGTTGLAGLGRARIGFPSQFAAAF  193



>ref|XP_009342182.1| PREDICTED: basic 7S globulin 2-like, partial [Pyrus x bretschneideri]
Length=371

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 98/171 (57%), Gaps = 15/171 (9%)
 Frame = +2

Query  155  FFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA---DWASSSQGSIPC  325
            F P+A+++ V+KD  T QY+  L     L P+KL V +GG FLW    D+ SS+     C
Sbjct  30   FRPKALLLPVTKDSSTLQYLTTLSQRSPLVPIKLTVHLGGQFLWVECEDYISSTYKPARC  89

Query  326  GSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  472
             S + S+AN K CT+           N  C L  +NP+++ AG G L +D ++++  D  
Sbjct  90   NSAQCSLANSKSCTTECYSPPSPGCNNNTCGLLPDNPINRTAGGGDLGQDMVSIQSTDGS  149

Query  473  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
            N G  +S VPN LF+   +FL +GL +GV G+  LG ++I LPSQ A+ FG
Sbjct  150  NPGRLVS-VPNLLFTCGYAFLLEGLASGVKGMAGLGRAKIGLPSQFASAFG  199



>ref|XP_011020124.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=431

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 102/169 (60%), Gaps = 8/169 (5%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S+AQ  F P+A+V+ VSKD  + QY+AQ+     L P+++ +D+GG +LW D    + SS
Sbjct  22   SIAQTTFRPKALVLPVSKDPSSLQYLAQINQRTPLVPVEVTLDLGGQYLWVDCQQGYVSS  81

Query  305  SQGSIPCGSLKSSMA--NPKGCT-SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            S+ +  C + + S+A    K CT   ++C L  +N  ++   S  L +D ++++  D  N
Sbjct  82   SKKNPSCNTAQCSLAVYRLKTCTVDKKLCVLSPDNTATRTGTSDYLTQDVVSIQSTDGSN  141

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             G  +S VPNFLFS  P+F+ QGL  GV G+  LG ++ISLPSQ +  F
Sbjct  142  PGRVVS-VPNFLFSCAPTFILQGLAKGVKGMAGLGRTKISLPSQFSAAF  189



>ref|XP_003518926.1| PREDICTED: basic 7S globulin [Glycine max]
Length=435

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 99/176 (56%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            SLAQ+ F PRA+V+ V KD  T QY+ Q++    L P  LV+D+GG FLW D    + SS
Sbjct  21   SLAQQSFRPRALVVPVKKDASTLQYITQIKQRTPLVPENLVLDIGGQFLWVDCDNNYVSS  80

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            +     CGS + S+A    C           +N  C +  +N V+  A SG L +D +++
Sbjct  81   TYRPARCGSAQCSLARSDSCGNCFSAPKPGCNNNTCGVTPDNTVTGTATSGELAQDVVSL  140

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  +  N     + V  FLFS  P+FL QGL  GV+G+  LG +RI+LPSQLA+ F
Sbjct  141  QSTNGFNPIQN-ATVSRFLFSCAPTFLLQGLATGVSGMAGLGRTRIALPSQLASAF  195



>emb|CAN80378.1| hypothetical protein VITISV_038701 [Vitis vinifera]
Length=436

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 94/176 (53%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S  +  F P A+VI VSKD  T QY+  +     L P+KLVVD+G  FLW D    + SS
Sbjct  20   SYGKTSFRPDALVIPVSKDASTLQYLTTINQRTPLVPVKLVVDLGAQFLWVDCEQNYVSS  79

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            S     C S + S+A   GC           +N  C +  +N V++ A SG L ED ++V
Sbjct  80   SYRPARCRSAQCSLARANGCGDCFSAPRPGCNNNTCGVLPDNTVTRTATSGELAEDFVSV  139

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  D  N G  +S V  FLFS  P+FL +GL +   G+  LG +RI+ PSQ A+ F
Sbjct  140  QSTDGSNPGRVVS-VSKFLFSCAPTFLLEGLASSAMGMAGLGRTRIAFPSQFASAF  194



>ref|XP_002272235.1| PREDICTED: basic 7S globulin [Vitis vinifera]
Length=436

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 94/176 (53%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S  +  F P A+VI VSKD  T QY+  +     L P+KLVVD+G  FLW D    + SS
Sbjct  20   SYGKTSFRPDALVIPVSKDASTLQYLTTINQRTPLVPVKLVVDLGAQFLWVDCEQNYVSS  79

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            S     C S + S+A   GC           +N  C +  +N V++ A SG L ED ++V
Sbjct  80   SYRPARCRSAQCSLARANGCGDCFSAPRPGCNNNTCGVLPDNTVTRTATSGELAEDFVSV  139

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  D  N G  +S V  FLFS  P+FL +GL +   G+  LG +RI+ PSQ A+ F
Sbjct  140  QSTDGSNPGRVVS-VSKFLFSCAPTFLLEGLASSAMGMAGLGRTRIAFPSQFASAF  194



>ref|XP_002308984.2| hypothetical protein POPTR_0006s06820g [Populus trichocarpa]
 gb|EEE92507.2| hypothetical protein POPTR_0006s06820g [Populus trichocarpa]
Length=431

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 101/169 (60%), Gaps = 8/169 (5%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S+AQ  F P+A+V+ VSKD  + QY+AQ+     L P+++ +D+GG +LW D    + SS
Sbjct  22   SIAQTTFRPKALVLPVSKDPSSLQYLAQINQRTPLVPVEVTLDLGGQYLWVDCQQGYVSS  81

Query  305  SQGSIPCGSLKSSMA--NPKGCT-SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            S+ +  C + + S+A    K CT   + C L  +N  ++   S  L +D ++++  D  N
Sbjct  82   SKKNPSCNTAQCSLAVYRLKTCTVDKKFCVLSPDNTATRTGTSDYLTQDVVSIQSTDGSN  141

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             G  +S VPNFLFS  P+F+ QGL  GV G+  LG ++ISLPSQ +  F
Sbjct  142  PGRVVS-VPNFLFSCAPTFILQGLAKGVKGMAGLGRTKISLPSQFSAAF  189



>gb|KDP25943.1| hypothetical protein JCGZ_22848 [Jatropha curcas]
Length=434

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 98/176 (56%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA---DWASSS  307
            SLA+ PF P+ +++ V+KD  TSQY+  ++      PLK+ VD+GG FLW    D+ SSS
Sbjct  21   SLAKTPFRPKGLLLRVTKDSSTSQYLTHIKQRTPFVPLKVTVDLGGKFLWVDCEDYISSS  80

Query  308  QGSIPCGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAV  454
               + C S   ++AN   CTS           N  C+  F NPVS+++ SG + +D +++
Sbjct  81   YKPVSCDSKLCTLANSHSCTSECYSAPKPGCHNNTCDQLFYNPVSRVSSSGQIGQDILSL  140

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            E  D  N G  +S VPN  F+   +   + L NGV G+   G + ISLP QL++ F
Sbjct  141  ESTDGRNPGKLVS-VPNLAFTCGYTSSLESLANGVKGIAGFGINNISLPFQLSSAF  195



>ref|XP_006419833.1| hypothetical protein CICLE_v10006689mg [Citrus clementina]
 gb|ESR33073.1| hypothetical protein CICLE_v10006689mg [Citrus clementina]
Length=437

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 99/179 (55%), Gaps = 16/179 (9%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            T SLAQ  F P+A+++ V+KD  T QYV Q+     L P+KL +D+GG FLW D    + 
Sbjct  19   TPSLAQTSFRPKALLLPVTKDASTLQYVTQINQRTPLVPVKLTLDLGGQFLWVDCDQGYV  78

Query  299  SSSQGSIPCGSLKSSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDT  445
            SSS   + C S + ++A  K C            +N+ C    +N ++    SG L  D 
Sbjct  79   SSSYKPVRCRSAQCNLARSKSCVQSCFSPPRPGCNNDTCAHLPDNTITNTGTSGELATDI  138

Query  446  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++++  D  N G  +S VPN  F+   +FL +GL +GV G+  LG +RISLPSQ++  F
Sbjct  139  VSIQSTDGKNLGRVVS-VPNLAFACAATFLLEGLASGVKGMAGLGRTRISLPSQISAAF  196



>ref|XP_006489581.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 98/179 (55%), Gaps = 16/179 (9%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            T SLAQ  F P+A+++ V+KD  T QYV Q+     L P+KL +D+GG FLW D    + 
Sbjct  19   TPSLAQTSFRPKALLLPVTKDASTLQYVTQINQRTPLVPVKLTLDLGGQFLWVDCDQGYV  78

Query  299  SSSQGSIPCGSLKSSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDT  445
            SSS   + C S + ++A  K C            +N+ C    +N ++    SG L  D 
Sbjct  79   SSSYKPVRCRSAQCNLARSKSCVQSCFSPPRPGCNNDTCAHLPDNTITNTGTSGELATDI  138

Query  446  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++++  D  N G  +S VPN  F+   +FL +GL +GV G+  LG +RISLPSQ +  F
Sbjct  139  VSIQSTDGKNLGRVVS-VPNLAFACAATFLLEGLASGVKGMAGLGRTRISLPSQFSAAF  196



>ref|XP_009356759.1| PREDICTED: basic 7S globulin [Pyrus x bretschneideri]
Length=439

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 97/176 (55%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            + AQ+ F P+A+V+ VSKD  T QY A++     L P+ LV+D+GG FLW D    + SS
Sbjct  20   TFAQQSFRPKALVVPVSKDASTLQYTARISQRTPLVPINLVLDLGGQFLWVDCEQNFVSS  79

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            +     C S + S+A   GC           +N  C L  +N V+  A  G L  D ++V
Sbjct  80   TYRPARCRSAQCSLAKATGCGDCFSSPKPGCNNNTCGLTPDNTVTHTATGGELASDVVSV  139

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +     N G  ++ V  FLF+  P+FL QGL  GV+G+  LG +RISLPSQ A+ F
Sbjct  140  QSTTGSNPGPNVT-VSRFLFACAPTFLLQGLAAGVSGMAGLGRTRISLPSQFASAF  194



>gb|KDO74788.1| hypothetical protein CISIN_1g036132mg [Citrus sinensis]
Length=437

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 98/179 (55%), Gaps = 16/179 (9%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            T SLAQ  F P+A+++ V+KD  T QYV Q+     L P+K+ +D+GG FLW D    + 
Sbjct  19   TPSLAQTSFRPKALLLPVTKDASTLQYVTQINQRTPLVPVKVTLDLGGQFLWVDCDQGYV  78

Query  299  SSSQGSIPCGSLKSSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDT  445
            SSS   + C S + ++A  K C            +N+ C    +N ++    SG L  D 
Sbjct  79   SSSYKPVRCRSAQCNLARSKSCVQSCFSPPRPGCNNDTCAHLPDNTITNTGTSGELSTDI  138

Query  446  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++++  D  N G  +S VPN  F+   +FL +GL +GV G+  LG +RISLPSQ +  F
Sbjct  139  VSIQSTDGKNLGRVVS-VPNLAFACAATFLLEGLASGVKGMAGLGRTRISLPSQFSAAF  196



>ref|XP_007144622.1| hypothetical protein PHAVU_007G170900g [Phaseolus vulgaris]
 gb|ESW16616.1| hypothetical protein PHAVU_007G170900g [Phaseolus vulgaris]
Length=435

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 98/176 (56%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW----ADWASS  304
            S AQ+ F P+A+V+ V+K   T QYV Q+     L PL LV+D+GG FLW     ++ SS
Sbjct  22   SFAQQSFRPKALVVPVTKHASTLQYVTQINQRTPLVPLNLVLDIGGQFLWVGCQTNYVSS  81

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            +     C S + S+A    C           +N  C L  +N ++  A  G L EDT++V
Sbjct  82   TYRPARCRSAQCSLAGATSCGDCFSAPRPGCNNNTCGLTPDNTITHTATVGELAEDTVSV  141

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  +  N G  ++ V  FLFS  P+FL QGL  GV+G+  LG ++I+LPSQ A+ F
Sbjct  142  QSTNGFNPGRNVT-VSRFLFSCAPTFLLQGLATGVSGMAGLGRTKIALPSQFASAF  196



>ref|XP_010278291.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=470

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 88/173 (51%), Gaps = 14/173 (8%)
 Frame = +2

Query  146  QRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  313
            Q+PF P + ++ ++KD PT QYV Q++       + LVVD+GG FLW D    + SSS  
Sbjct  56   QKPFRPHSFILPITKDAPTLQYVTQIRQRTPFVTVDLVVDLGGQFLWVDCESAYFSSSYH  115

Query  314  SIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELI  463
             +PC S + S     GC           SN  C L   N V+K   SG L ED IAV   
Sbjct  116  PVPCNSSQCSATGANGCGQCLLPASPGCSNNTCVLFPGNTVTKTTTSGELTEDMIAVRST  175

Query  464  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            D  +  + +  VP FLF+    FL + L  GV G+  LG   I +PSQLA  F
Sbjct  176  DGSSPATRIVSVPRFLFTCSARFLLERLAGGVKGMAGLGRGPIGMPSQLAAAF  228



>ref|XP_008235257.1| PREDICTED: basic 7S globulin 2-like [Prunus mume]
Length=473

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 96/175 (55%), Gaps = 15/175 (9%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSS  307
            LAQ+ F P+A+VI VSKD  T QY   +     L P+ LV+D+GG FLW D    + SS+
Sbjct  58   LAQQSFRPKALVIPVSKDASTLQYTTHITQRTPLVPVNLVLDLGGQFLWVDCEQNYVSST  117

Query  308  QGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVE  457
                 C S + S+A   GC           +N  C L  +N V++ A  G L  D ++V 
Sbjct  118  YRPARCRSAQCSLARASGCGDCFSSPKPGCNNNTCGLSPDNTVTRTATGGELAYDVVSVP  177

Query  458  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
              +  N G  +S V  FLF+  P+FL +GL  GV+G+  LG +RISLPSQ A+ F
Sbjct  178  STNGFNPGRNVS-VSQFLFTCAPTFLLEGLAAGVSGMAGLGRTRISLPSQFASAF  231



>gb|EYU38145.1| hypothetical protein MIMGU_mgv1a006647mg [Erythranthe guttata]
Length=436

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 91/178 (51%), Gaps = 15/178 (8%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            +I   Q  F P A+V+ V KD  T QYV  +     L P+ LVV +GG FLW D    + 
Sbjct  18   SIIHGQPSFRPSALVLPVRKDISTQQYVTAINQRTPLVPVNLVVHLGGQFLWVDCDNNYI  77

Query  299  SSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  448
            SS+   + C S + S+A    C           +N  C +  +NP  + A  G L +D +
Sbjct  78   SSTYRPVRCRSAQCSLARSNSCGDCFDGPRPGCNNNTCGVSPDNPFIRTATGGELAQDAV  137

Query  449  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +V   D  N G F S VP F+F+  P+FL QGL +G  G+  LG +RI LPSQ A  F
Sbjct  138  SVRSTDGSNPGRFTS-VPQFIFACAPTFLLQGLASGATGLAGLGRARIGLPSQFAAAF  194



>ref|NP_001234249.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
 gb|AAN87262.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
Length=438

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 96/179 (54%), Gaps = 15/179 (8%)
 Frame = +2

Query  128  ATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            +TI+  Q  F P+ ++I V+KD  T QY+ Q+Q    L P+ L +D+GG FLW D    +
Sbjct  20   STIAQNQTSFRPKGLIIPVTKDASTLQYLTQIQQRTPLVPISLTLDLGGQFLWVDCDQGY  79

Query  296  ASSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  445
             SSS     CGS + S+    GC           +N  C L  +N V+  A SG L  D 
Sbjct  80   VSSSYKPARCGSAQCSLGGASGCGECFSPPRPGCNNNTCGLLPDNTVTGTATSGELASDV  139

Query  446  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++VE  +  N G  +S   NFLF    +FL QGL +GV G+  LG ++ISLPSQ +  F
Sbjct  140  VSVESSNGKNPGRSVSD-KNFLFVCGATFLLQGLASGVKGMAGLGRTKISLPSQFSAEF  197



>ref|NP_001234746.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
 gb|AAY97864.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Solanum lycopersicum]
Length=438

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 95/179 (53%), Gaps = 15/179 (8%)
 Frame = +2

Query  128  ATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            +TI+  Q  F P+ ++I V+KD  T QY+ Q+Q    L P+ L +D+GG FLW D    +
Sbjct  20   STIAQNQTSFRPKGLIIPVTKDASTLQYLTQIQQRTPLVPISLTLDLGGQFLWVDCDQGY  79

Query  296  ASSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  445
             SSS     CGS + S+    GC            N  C L  +N V+  A SG L  D 
Sbjct  80   VSSSYKPARCGSAQCSLGGASGCGECFSPPRPGCDNNTCGLLPDNTVTGTATSGELASDV  139

Query  446  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++VE  +  N G  +S   NFLF    +FL QGL +GV G+  LG ++ISLPSQ +  F
Sbjct  140  VSVESSNGKNPGRSVSD-KNFLFVCGATFLLQGLASGVKGMAGLGRTKISLPSQFSAEF  197



>gb|AAP84703.1| putative xyloglucanase inhibitor [Solanum tuberosum]
Length=437

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 96/179 (54%), Gaps = 15/179 (8%)
 Frame = +2

Query  128  ATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            +TI+  Q  F P+ ++I V+KD  T QY+ Q+Q    L P+ L +D+GG FLW D    +
Sbjct  20   STIAQNQTSFRPKGLIIPVTKDASTLQYLTQIQQRTPLVPISLTLDLGGQFLWVDCDQGY  79

Query  296  ASSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  445
             SSS     C S + S+    GC           +N  C L  +N V++ A SG L  D 
Sbjct  80   VSSSYKPARCRSAQCSLGGASGCGECFSPPRPGCNNNTCGLLPDNTVTRTATSGELASDI  139

Query  446  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++V+  +  N G  +S   NFLF    +FL QGL +GV G+  LG +RISLPSQ +  F
Sbjct  140  VSVQSTNGKNPGRSVSD-KNFLFVCGATFLLQGLASGVKGMAGLGRTRISLPSQFSAEF  197



>ref|XP_007034629.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY05555.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=436

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 96/173 (55%), Gaps = 15/173 (9%)
 Frame = +2

Query  146  QRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  313
            Q  F P+A+V+ VSKD  T+QYV Q++    L P+KL +D+GG FLW D    + SSS  
Sbjct  24   QASFRPKALVLPVSKDASTNQYVTQIKQRTPLVPVKLTLDLGGEFLWVDCDQGYVSSSYM  83

Query  314  SIPCGSLKSSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELI  463
               C S + S+A  K C S          N  C L   N V++ A  G + +D ++V+  
Sbjct  84   PARCNSAQCSLARSKSCGSCFDGPKPGCNNNTCGLPPANTVTRTATGGEVAQDVVSVQST  143

Query  464  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  N G  +S VP FLF+   +FL +GL +GV G+  LG ++IS+ SQ A  F
Sbjct  144  NGKNPGQVVS-VPKFLFTCGSTFLLEGLASGVKGMAGLGRTKISMSSQFAAAF  195



>ref|XP_008355568.1| PREDICTED: basic 7S globulin-like [Malus domestica]
Length=439

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 95/176 (54%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            + AQ+ F P+A+V+ VSKD  T QY  ++     L P+ LV+D+GG +LW D    + SS
Sbjct  20   TFAQQSFRPKALVVPVSKDASTLQYTTRISQRTPLVPINLVLDLGGQYLWVDCEQNYVSS  79

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            +     C S + S+A   GC           +N  C L   N V+  A  G L  D ++V
Sbjct  80   TYRPARCHSAQCSLAKATGCGDCFSSPKPGCNNNTCGLTPGNTVTHTATGGELASDVVSV  139

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +     N G  ++ V  FLF+  P+FL QGL  GV+G+  LG +RISLPSQ A+ F
Sbjct  140  QSTTGSNPGPNVT-VSQFLFACAPTFLLQGLAAGVSGMAGLGRTRISLPSQFASAF  194



>gb|AFK46427.1| unknown [Medicago truncatula]
Length=435

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 101/177 (57%), Gaps = 16/177 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTS-QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  301
            + +Q+ F P+A+V+ ++KD  T+ QY AQ+     L PL ++VD+GG FLW D    + S
Sbjct  22   TFSQQSFRPKALVLPITKDGATTNQYKAQINQRTPLVPLNVIVDLGGQFLWVDCENKYIS  81

Query  302  SSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  451
            S+     C S + S+AN  GC           +N  C +  +N ++  A SG L ED ++
Sbjct  82   STYRPARCRSAQCSLANSDGCGDCFSSPKPGCNNNTCGVTPDNSITHTATSGELAEDVLS  141

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  +  N G  +  V  FLFS  P+FL +GL  G +G+  LG ++I+LPSQLA+ F
Sbjct  142  IQSSNGFNPGQNVV-VSRFLFSCAPTFLLKGLATGASGMAGLGRTKIALPSQLASAF  197



>gb|KDP40112.1| hypothetical protein JCGZ_02110 [Jatropha curcas]
Length=434

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 98/177 (55%), Gaps = 16/177 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S+AQ  F P+A+V+ VSKD  T QY+ QL+    L P+KL +D+GG ++W D    + SS
Sbjct  20   SIAQTSFRPKALVLPVSKDASTLQYLTQLKQRTPLVPVKLTLDLGGQYMWVDCDQGYKSS  79

Query  305  SQGSIPCGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIA  451
            S     C S + S+A  K C +           N+ C L  +N V+    SG + +D ++
Sbjct  80   SYKPARCRSAQCSLAKSKSCITECFSSPRPGCNNDTCALLPDNTVTHTGTSGEVGQDLVS  139

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  D  N G  +S VP  +F+   +FL  GL +GV G+  LG ++ISLPSQ +  F
Sbjct  140  IQSTDGSNPGRVVS-VPKLIFTCGTTFLLGGLASGVKGMAGLGRTKISLPSQFSAAF  195



>emb|CAN61502.1| hypothetical protein VITISV_011733 [Vitis vinifera]
Length=415

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 90/160 (56%), Gaps = 7/160 (4%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGSIP  322
            AQ  F P A+VI VSKD  T QYV  +     L PL+LVVD+GG FLW D   +   S  
Sbjct  22   AQSSFRPHALVIPVSKDSSTLQYVTSINQRTPLVPLQLVVDLGGQFLWVDCEQNYVSS--  79

Query  323  CGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVP  502
              S +     P GC +N  C +  +N V++ A S  L ED ++V+  D  N G  +S V 
Sbjct  80   --SYRPGAVQP-GC-NNNTCSVLPDNTVTRTASSDELAEDAVSVQSTDGSNPGRSVS-VS  134

Query  503  NFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             FLFS  P+ L +GL +G  G+  LG +RI+LPSQ A+ F
Sbjct  135  KFLFSCAPTSLLEGLASGAKGMAGLGRTRIALPSQFASAF  174



>ref|XP_003590665.1| Xyloglucan-specific endoglucanase inhibitor protein [Medicago 
truncatula]
 gb|AES60916.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=435

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 101/177 (57%), Gaps = 16/177 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTS-QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  301
            + +Q+ F P+A+V+ ++KD  T+ QY AQ+     L PL ++VD+GG FLW D    + S
Sbjct  22   TFSQQSFRPKALVLPITKDGATTNQYKAQINQRTPLVPLNVIVDLGGQFLWVDCENKYIS  81

Query  302  SSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  451
            S+     C S + S+AN  GC           +N  C +  +N ++  A SG L ED ++
Sbjct  82   STYRPARCRSAQCSLANSDGCGDCFSSPKPGCNNNTCGVTPDNSITHTATSGELAEDVLS  141

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  +  N G  +  V  FLFS  P+FL +GL  G +G+  LG ++I+LPSQLA+ F
Sbjct  142  IQSSNGFNPGQNVV-VSRFLFSCAPTFLLKGLATGASGMAGLGRTKIALPSQLASAF  197



>gb|KJB23117.1| hypothetical protein B456_004G081800 [Gossypium raimondii]
Length=433

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 94/175 (54%), Gaps = 15/175 (9%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSS  307
            LAQ+ F P+A+V+ VSKD  T QY+  +       P+++VVD+GG +LW     D+ SS+
Sbjct  21   LAQQSFRPKALVVPVSKDASTLQYLTTINQRTPFVPIRVVVDLGGRYLWVDCERDYVSST  80

Query  308  QGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVE  457
                 C S + S+A   GC           +N  C +   N V+  AG G + +D ++++
Sbjct  81   YRPARCSSAQCSLAGANGCGDCFDGPRPGCNNNTCAVGPGNTVTNTAGPGEVAQDVVSLQ  140

Query  458  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
              D  N G  ++ VP FLF+  P+ L QGL NGV G+   G  RI LPSQ +  F
Sbjct  141  STDGRNPGRVVT-VPRFLFACAPTSLLQGLANGVVGMAGFGRYRIGLPSQFSAAF  194



>dbj|BAA03413.1| EDGP precursor [Daucus carota]
Length=433

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 95/178 (53%), Gaps = 15/178 (8%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            TI+ AQ  F P A+V+ V KD  T QYV  +     L    LVVD+GG FLW D    + 
Sbjct  16   TITQAQPSFRPSALVVPVKKDASTLQYVTTINQRTPLVSENLVVDLGGRFLWVDCDQNYV  75

Query  299  SSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  448
            SS+   + C + + S++    C           +N  C +  ENPV   A  G + ED +
Sbjct  76   SSTYRPVRCRTSQCSLSGSIACGDCFNGPRPGCNNNTCGVFPENPVINTATGGEVAEDVV  135

Query  449  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +VE  D  ++G  ++ VP F+FS  P+ L Q L +GV G+  LG +RI+LPSQ A+ F
Sbjct  136  SVESTDGSSSGRVVT-VPRFIFSCAPTSLLQNLASGVVGMAGLGRTRIALPSQFASAF  192



>ref|XP_002517163.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45326.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=469

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 96/173 (55%), Gaps = 16/173 (9%)
 Frame = +2

Query  152  PFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSI  319
            PF P+A+V+ V KD  T+QY+ Q++    L P+KL+VD+G  F+W D    + SSS   +
Sbjct  61   PFRPKALVLPVFKDKCTNQYITQIKQRTPLVPVKLIVDLGARFMWVDCEEGYVSSSYTPV  120

Query  320  PCGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELID  466
             C SL   +AN   C +           N  C    ENPV ++  SG + +D ++++  +
Sbjct  121  SCDSLLCKLANSLACATECNSTPKPGCHNNTCAHSPENPVIRLGTSGQIGQDVVSLQSFN  180

Query  467  EPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
                   +S VPNF F   P+FL + L +GV G+  LGNS ISLP+Q ++ FG
Sbjct  181  GKTPDRIVS-VPNFPFVCGPTFLLENLADGVTGLAGLGNSNISLPAQFSSAFG  232



>gb|ACM68431.1| xyloglucan-specific endoglucanase inhibitor protein [Capsicum 
annuum]
Length=437

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 96/179 (54%), Gaps = 15/179 (8%)
 Frame = +2

Query  128  ATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            +TI+  Q  F P+ ++I V KD  T QY+ Q+Q    L P+ L +D+GG FLW D    +
Sbjct  20   STIAQNQTSFRPKGLIIPVMKDGSTLQYLTQIQQRTPLVPVSLTLDLGGQFLWVDCDQGY  79

Query  296  ASSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  445
             SSS     C S + S+A   GC           +N  C L  +N V++ A SG L  D 
Sbjct  80   VSSSYKPARCRSAQCSLAGATGCGECFSPPRPGCNNNTCGLFPDNTVTRTATSGELASDV  139

Query  446  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++V+  +  N G  +S   NFLF    +FL QGL +GV G+  LG +RISLPSQ +  F
Sbjct  140  VSVQSSNGKNPGRNVSD-KNFLFVCGATFLLQGLASGVKGMAGLGRTRISLPSQFSAEF  197



>ref|XP_002277699.1| PREDICTED: basic 7S globulin-like [Vitis vinifera]
Length=435

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 95/176 (54%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            SLAQ  F P+A+V+ VSKD  + QY+  +    +L  + L +D+GG FLW D    + SS
Sbjct  21   SLAQTSFRPKALVLPVSKDAASLQYITHINQRTHLVSIPLTLDLGGQFLWVDCDQGYVSS  80

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            S   + CGS + S+   K C           +   C L  +N V+  A SG + ED +++
Sbjct  81   SYRPVRCGSAQCSLTRSKACGECFSGPVKGCNYSTCVLSPDNTVTGTATSGEVGEDAVSI  140

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  D  N G  +S V   LF+   +FL +GL + V G+  LG SR++LPSQ ++ F
Sbjct  141  QSTDGSNPGRVVS-VRRLLFTCGSTFLLEGLASRVKGMAGLGRSRVALPSQFSSAF  195



>ref|XP_011462765.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin [Fragaria vesca 
subsp. vesca]
Length=446

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 99/181 (55%), Gaps = 17/181 (9%)
 Frame = +2

Query  128  ATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DW  295
            AT SLA+  F P+A+V+ V+K  PT QY+  ++    L P++L +D+GG FLW     D+
Sbjct  21   ATPSLAKTSFRPKALVLPVAKHSPTHQYLTSIKQRTPLVPVRLTLDLGGQFLWVDCQQDY  80

Query  296  ASSSQGSIPCGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGS-GVLKE  439
             SS+     C S + S+AN K CT+           N  C +  +N V   AG+ G + +
Sbjct  81   VSSTYKPARCNSAQCSLANSKACTTECNSSPRPGCNNNTCSVLPDNSVIPTAGNGGEVGQ  140

Query  440  DTIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANT  619
            D +++   D  N  + +S VPNFLF+   +FL   L +GV G+  LG + I LPS  A+ 
Sbjct  141  DVVSLHSTDGSNPTTLVS-VPNFLFACAETFLLDRLASGVKGMAGLGRANIGLPSLFASA  199

Query  620  F  622
            F
Sbjct  200  F  200



>ref|XP_008222998.1| PREDICTED: basic 7S globulin 2 [Prunus mume]
Length=411

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 91/161 (57%), Gaps = 11/161 (7%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASS-------SQGSI  319
            P  ++   +KD  T QY+  +  G  L P KLVVD+GGPFLW +  SS       SQGSI
Sbjct  32   PNVLIFLATKDVSTLQYMTTIHHGTPLVPTKLVVDLGGPFLWLNCGSSSSSSRVISQGSI  91

Query  320  PCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELID---EPNAGSFL  490
             C + K    N +G   N  C +  EN +++MA  G L +D +AV++ID   +  +GS  
Sbjct  92   QCLAAKPKTHN-QGSNDNNKCHVFPENSITQMATQGDLVQDIMAVQVIDGSSKTESGSIT  150

Query  491  SHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLA  613
            +   NFLFS  P FL  GL +   G+L LG ++IS+ SQ++
Sbjct  151  TFDSNFLFSCAPIFLLNGLASSARGLLGLGRTQISMASQIS  191



>ref|XP_010038107.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Eucalyptus 
grandis]
Length=437

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 93/173 (54%), Gaps = 15/173 (9%)
 Frame = +2

Query  146  QRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  313
            Q+ F P+A+V+ VSKD  T QYV ++     L P+ LVVD+GG FLW D    + SS+  
Sbjct  24   QQSFRPKALVLPVSKDASTLQYVTRISQRTPLVPVALVVDLGGQFLWVDCEQNYVSSTYL  83

Query  314  SIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELI  463
               CGS   S+A   GC           +N  C +  +N V+     G +  D ++V   
Sbjct  84   PARCGSAVCSLARASGCGDCFSAARPGCNNNTCGVTPDNTVTGXRTGGEVATDLVSVNST  143

Query  464  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            D  N G  + +V  F+F+  PSFL  GL +GV G+  LG +RI+LPSQ A+ F
Sbjct  144  DGSNPGQAV-NVTRFVFACAPSFLLDGLASGVQGMAGLGRTRIALPSQFASAF  195



>ref|XP_007222421.1| hypothetical protein PRUPE_ppa006071mg [Prunus persica]
 gb|EMJ23620.1| hypothetical protein PRUPE_ppa006071mg [Prunus persica]
Length=429

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 94/171 (55%), Gaps = 16/171 (9%)
 Frame = +2

Query  155  FFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  322
            F P+A+V+ V+KD  T QY+  L     L P+KL VD+GG +LW D    + SS+     
Sbjct  30   FRPKALVLPVTKDPSTLQYLTTLSQRTPLVPIKLTVDLGGQYLWVDCEEGYVSSTYKPAR  89

Query  323  CGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDE  469
            C S + S++N K CT+           N  C L  +N V++   SG L +D ++++  D 
Sbjct  90   CNSAQCSLSNSKACTTECYSSPKPGCNNNTCSLSPDNTVTRTGTSGDLGQDIVSLQSTDG  149

Query  470  PNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
               G  +S VPN LF+   +FL  GL NGV G+  LG ++I LPSQ A+ F
Sbjct  150  FTPGRVVS-VPNLLFTCGSTFLLDGLANGVKGMAGLGRAKIGLPSQFASAF  199



>gb|KDO74789.1| hypothetical protein CISIN_1g014679mg [Citrus sinensis]
Length=420

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 95/166 (57%), Gaps = 6/166 (4%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            AQ  F P+A+V+ V+KD  T QYV Q++    L P+KL V +GG  LW D    + SS+ 
Sbjct  23   AQTSFRPKALVLRVAKDTATLQYVTQIKQRTPLVPVKLTVHLGGNILWVDCEKGYVSSTN  82

Query  311  GSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFL  490
             +  CGS + ++AN K C          +NP+S     G ++ D ++++  D  N G  +
Sbjct  83   KTARCGSAQCNLANAKACGGGICGAGP-DNPISNTGTHGDIRIDVLSIQSTDGRNPGRAV  141

Query  491  SHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
            + VPNF+F     F+ QGL +GV G+  LG S+++LPSQLA  F +
Sbjct  142  T-VPNFIFLCGSEFVLQGLASGVVGIAGLGRSKVALPSQLAAAFSL  186



>ref|XP_009773897.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=433

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 95/175 (54%), Gaps = 16/175 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
             Q  F P+A+++ V+KD  T QY+ Q+     L P+KL + +GG  LW D    + SS+ 
Sbjct  23   GQTSFQPKALLLPVTKDSTTLQYITQIGQRTPLVPIKLTIHLGGQTLWVDCEDGYVSSTY  82

Query  311  GSIPCGSLKSSMANPKGC----------TSNEICELQFENP-VSKMAGSGVLKEDTIAVE  457
                CGS + ++A    C           SN  C    ENP +  +   G + ED ++++
Sbjct  83   RPARCGSAQCTLAKVNTCGDCITTPRIGCSNNACYNTPENPFIKTLYDGGEITEDVLSIQ  142

Query  458  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
              D  N G F+  +P+F+F+ VP+FL  GL +GV G + LG +RI+LPSQLA  F
Sbjct  143  STDGSNPGKFV-KIPSFIFTCVPTFLTDGLASGVKGTVGLGRNRIALPSQLAEIF  196



>ref|XP_008222987.1| PREDICTED: basic 7S globulin-like [Prunus mume]
Length=438

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 94/171 (55%), Gaps = 16/171 (9%)
 Frame = +2

Query  155  FFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  322
            F P+A+V+ V+KD  T QY+        L P+KL VD+GG +LW D    + SS+     
Sbjct  30   FRPKALVLPVTKDPSTLQYLTTFSQRTPLVPIKLTVDLGGQYLWVDCEQGYVSSTYKPAR  89

Query  323  CGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDE  469
            C S + S++N K CT+           N  C L  +N V++   SG L +D ++++  D 
Sbjct  90   CNSAQCSLSNSKACTTECYSSPKPGCNNNTCSLSPDNTVTRTGTSGDLGQDIVSLQSTDG  149

Query  470  PNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
               G  +S VPNFLF+   +FL  GL NGV G+  LG ++I LPSQ ++ F
Sbjct  150  FTPGKVVS-VPNFLFTCGSTFLLDGLANGVKGMAGLGRAKIGLPSQFSSAF  199



>ref|XP_007201544.1| hypothetical protein PRUPE_ppa017430mg, partial [Prunus persica]
 gb|EMJ02743.1| hypothetical protein PRUPE_ppa017430mg, partial [Prunus persica]
Length=412

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 91/170 (54%), Gaps = 15/170 (9%)
 Frame = +2

Query  155  FFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  322
            F P+A+VI VSKD  T QY   +     L P+ LV+D+GG FLW D    + SS+     
Sbjct  2    FRPKALVIPVSKDASTLQYTTHITQRTPLVPINLVLDLGGQFLWVDCEQNYVSSTYRPAR  61

Query  323  CGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  472
            C S + S+A   GC           +N  C L  +N V+  A  G L  D ++V   +  
Sbjct  62   CRSAQCSLARASGCGDCFSSPKPGCNNNTCGLTPDNTVTGTATGGELAYDVVSVPSTNGF  121

Query  473  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            N G  +S V  FLF+  P+FL +GL  GV+G+  LG +RISLPSQ A+ F
Sbjct  122  NPGRNVS-VSQFLFTCAPTFLLEGLAAGVSGMAGLGRTRISLPSQFASAF  170



>gb|KCW84283.1| hypothetical protein EUGRSUZ_B01135, partial [Eucalyptus grandis]
Length=375

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 94/174 (54%), Gaps = 15/174 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            +Q  F P+A+V+ V+KD  T QY+  L     L P+KL +D+GG FLW D    ++SSS 
Sbjct  24   SQASFRPKAVVLPVTKDSSTLQYLTTLYQRTPLVPVKLTLDLGGKFLWVDCNRGYSSSSY  83

Query  311  GSIPCGSLKSSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVEL  460
                C S + S+A  K C S          N  C L  +N V++ +  G +  D + V  
Sbjct  84   SPARCRSTQCSLAGSKICISCFTGPLPGCNNNTCGLSPDNTVTRTSTDGEVARDVVVVGS  143

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             D    G  +S VP FLF+   +FL QGL +GV G+  LG +RISLPSQ + +F
Sbjct  144  TDGSIPGPVVS-VPKFLFTCGATFLLQGLPSGVQGMAGLGRTRISLPSQFSASF  196



>ref|XP_010038106.1| PREDICTED: basic 7S globulin 2-like [Eucalyptus grandis]
Length=438

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 92/173 (53%), Gaps = 15/173 (9%)
 Frame = +2

Query  146  QRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  313
            Q+ F P+A+V+ VSKD  T QY+ ++     L P+ LVVD+GG FLW D    + SS+  
Sbjct  25   QQSFRPKALVLPVSKDASTLQYLTRISQRTPLVPVDLVVDLGGQFLWVDCEQNYVSSTYR  84

Query  314  SIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELI  463
               CGS   S+A   GC           +N  C +  +N V+  A  G +  D ++V   
Sbjct  85   PARCGSAVCSLARASGCGDCSSAAGPGCNNNTCGVIPDNTVTHTATGGEVATDLVSVNST  144

Query  464  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            D  N G  + +V  F+F+  PS L  GL  GV G+  LG +RI+LPSQ A+ F
Sbjct  145  DGSNPGRAV-NVTRFVFACAPSSLLGGLAKGVEGMAGLGRTRIALPSQFASAF  196



>ref|XP_004290668.1| PREDICTED: basic 7S globulin 2-like [Fragaria vesca subsp. vesca]
Length=439

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 98/176 (56%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            + AQ+ F P+A+VI V+KD  T QY  ++     L P+ LV+D+GG +LW D    + SS
Sbjct  21   AFAQQSFRPKALVIPVTKDASTLQYTTRISQRTPLVPISLVLDLGGQYLWVDCEQNYVSS  80

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            +     C S + S+A   GC           +N  C +  +N V++ A  G + +D ++V
Sbjct  81   TYRPARCRSAQCSLAGADGCGDCFSSPKPGCNNNTCGVSPDNTVTRTATGGEIAQDVVSV  140

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +     N G  ++ V NF+F+  P+FL  GL +GV+G+  LG ++I+L SQ A+ F
Sbjct  141  QSTTGSNPGQNVT-VSNFIFACAPTFLLDGLASGVSGMAGLGRTKIALSSQFASAF  195



>gb|KDP21480.1| hypothetical protein JCGZ_21951 [Jatropha curcas]
Length=434

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 93/174 (53%), Gaps = 15/174 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            AQ+ F P+A+V+ VSKD  T QYV Q++    L  + LV+ +GG  LW D    + SS+ 
Sbjct  24   AQQSFRPKALVLPVSKDAATLQYVTQIKQRTPLISINLVLHLGGKILWVDCDQNYISSTY  83

Query  311  GSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  460
                CGS   S+    GC           +N  C +  +NP++  A  G L  D ++V  
Sbjct  84   RPARCGSALCSLGEANGCGNCFSGPRPGCNNNTCGVSPDNPITNTATGGELATDIVSVNS  143

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             +  N G  ++ VP FLFS  P+FL  GL NGV G+  LG +R +LPSQ + +F
Sbjct  144  TNGSNPGRAVT-VPKFLFSCAPTFLLLGLANGVVGIAGLGRTRAALPSQFSASF  196



>ref|XP_004495219.1| PREDICTED: basic 7S globulin-like [Cicer arietinum]
Length=440

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 99/177 (56%), Gaps = 16/177 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKD-FPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  301
            + +Q+ F P+A+V+ V+KD   T+QY+AQ+     L PL LVVD+GG FLW D    + S
Sbjct  18   TFSQQSFRPKALVLPVTKDTLTTNQYIAQINQRTPLVPLNLVVDLGGQFLWLDCEQHYTS  77

Query  302  SSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  451
            S+     C S + S+A    C           +N  C L  +N V+  A SG L ED ++
Sbjct  78   STYRPARCRSAQCSLAKSTACGDCFSSPKPGCNNNTCGLFPDNTVTHTATSGELAEDVLS  137

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            V+  +  N    ++ V  FLFS  P+ L QGL +G +G+  LG ++I+ PSQLA+ F
Sbjct  138  VQSTNGFNPTQNVA-VSRFLFSCAPTSLLQGLASGASGMAGLGRTKIAFPSQLASAF  193



>gb|ADD71503.1| xyloglucanase inhibitor 1 [Humulus lupulus]
Length=443

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 100/173 (58%), Gaps = 11/173 (6%)
 Frame = +2

Query  134  ISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  301
            ++ A+   FP+A+V+ V+KD  T QY+ Q+        LK+V+DVGG FLW D    + S
Sbjct  23   LATAKTAAFPKALVLPVTKDTTTRQYITQITQRTPPVQLKVVLDVGGEFLWIDCEKGYKS  82

Query  302  SSQGSIPCGSLKSSMANPKGCTSNE------ICELQFENPVSKMAGSGVLKEDTIAVELI  463
            S++  +PCGS +  ++    CT+++      +C +   NP S +  SG L ED + ++  
Sbjct  83   STKRPVPCGSPQCVLSGSGACTTSDNPSDVGVCGVMPNNPFSSVGTSGDLFEDILYIQST  142

Query  464  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  N G  +S VPN LFS  P+ L +GL +G+ G+   G ++++LPS  ++ F
Sbjct  143  NGFNPGKQVS-VPNLLFSCAPNSLLEGLASGIIGMAGFGRNKVALPSLFSSAF  194



>ref|XP_010035593.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=436

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 94/174 (54%), Gaps = 15/174 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            +Q  F P+A+V+ V+KD  T QY+  L     L P+KL +D+GG FLW D    ++SSS 
Sbjct  24   SQASFRPKAVVLPVTKDSSTLQYLTTLYQRTPLVPVKLTLDLGGKFLWVDCNRGYSSSSY  83

Query  311  GSIPCGSLKSSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVEL  460
                C S + S+A  K C S          N  C L  +N V++ +  G +  D + V  
Sbjct  84   SPARCRSTQCSLAGSKICISCFTGPLPGCNNNTCGLSPDNTVTRTSTDGEVARDVVVVGS  143

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             D    G  +S VP FLF+   +FL QGL +GV G+  LG +RISLPSQ + +F
Sbjct  144  TDGSIPGPVVS-VPKFLFTCGATFLLQGLPSGVQGMAGLGRTRISLPSQFSASF  196



>gb|AIL30493.1| xyloglucan-specific fungal endoglucanase inhibitor protein precursor 
[Nicotiana tabacum]
Length=437

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 93/173 (54%), Gaps = 15/173 (9%)
 Frame = +2

Query  146  QRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  313
            Q  F P+ +++ ++KD  T QY+ Q+Q    L P+ L +D+GG FLW D    + SSS  
Sbjct  25   QTSFRPKGLILPITKDASTLQYLTQIQQRTPLVPVSLTLDLGGQFLWVDCDQGYVSSSYK  84

Query  314  SIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELI  463
               C S + S+A   GC           +N+ C L  +N V++ A SG L  DT+ V+  
Sbjct  85   PARCRSAQCSLAGAGGCGQCFSPPKPGCNNDTCGLLPDNTVTRTATSGELASDTVQVQSS  144

Query  464  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  N G  +S   +FLF    +FL +GL  GV G+  LG +RISLPSQ +  F
Sbjct  145  NGKNPGRNVSD-KDFLFVCGSTFLLEGLATGVKGMAGLGRTRISLPSQFSAEF  196



>ref|XP_009757289.1| PREDICTED: basic 7S globulin-like [Nicotiana sylvestris]
Length=437

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 93/173 (54%), Gaps = 15/173 (9%)
 Frame = +2

Query  146  QRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  313
            Q  F P+ +++ ++KD  T QY+ Q+Q    L P+ L +D+GG FLW D    + SSS  
Sbjct  25   QTSFRPKGLILPITKDASTLQYLTQIQQRTPLVPVSLTLDLGGQFLWVDCDQGYVSSSYK  84

Query  314  SIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELI  463
               C S + S+A   GC           +N+ C L  +N V++ A SG L  DT+ V+  
Sbjct  85   PARCRSAQCSLAGAGGCGQCFSPPKPGCNNDTCGLLPDNTVTRTATSGELASDTVQVQSS  144

Query  464  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  N G  +S   +FLF    +FL +GL  GV G+  LG +RISLPSQ +  F
Sbjct  145  NGKNPGRNVSD-KDFLFVCGSTFLLEGLATGVKGMAGLGRTRISLPSQFSAEF  196



>ref|XP_009595035.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=436

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 96/176 (55%), Gaps = 16/176 (9%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSS  307
            + Q  F P+A+++ V+KD  T QY  Q+     L P+KL + +GG  LW D    + SS+
Sbjct  22   IGQTAFQPKALLLPVTKDSSTLQYTTQIGQRTPLVPIKLTIHLGGQTLWVDCEDGYVSST  81

Query  308  QGSIPCGSLKSSMANPKGC----------TSNEICELQFENP-VSKMAGSGVLKEDTIAV  454
                 CGS++ ++A    C           SN  C    ENP +  +   G + ED +++
Sbjct  82   YRPARCGSVQCTLAKVNTCGDCNTTPRIGCSNNACYNTPENPFIKTLYDGGEITEDVLSI  141

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  D  N G F+  +P+F+F+ VP+FL +GL +GV G + LG + I+LPSQLA  F
Sbjct  142  QSTDGSNPGKFV-KIPSFIFTCVPTFLTEGLASGVKGTVGLGRNGIALPSQLAQVF  196



>gb|ADG23123.1| xyloglucan specific endoglucanase inhibitor [Solanum melongena]
Length=437

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 94/179 (53%), Gaps = 15/179 (8%)
 Frame = +2

Query  128  ATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            +TI+  Q  F P+ ++I V+KD  T QY+ Q+Q    L P+ L +D+GG FLW D    +
Sbjct  20   STIAQNQTSFRPKGLIIPVTKDASTLQYLTQIQQRTPLVPISLTLDLGGQFLWVDCDQGY  79

Query  296  ASSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  445
             SSS     C S + S+A    C           +N  C L  +N V+  A  G L  D 
Sbjct  80   VSSSYKPARCRSAQCSLAGASACGECFSPPRPGCNNNTCSLFPDNTVTGTATGGELASDI  139

Query  446  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++V+  +  N G  +S   NFLF    +FL QGL +GV G+  LG +RISLPSQ +  F
Sbjct  140  VSVQSSNGKNPGRNVSD-KNFLFVCGATFLLQGLASGVKGMAGLGRTRISLPSQFSAEF  197



>ref|XP_006419832.1| hypothetical protein CICLE_v10005038mg [Citrus clementina]
 gb|ESR33072.1| hypothetical protein CICLE_v10005038mg [Citrus clementina]
Length=420

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 94/166 (57%), Gaps = 6/166 (4%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            AQ    P+A+V+ V+KD  T QYV Q++    L P+KL V +GG  LW D    + SS+ 
Sbjct  23   AQTSLRPKALVLRVAKDTATLQYVTQIKQRTPLVPVKLTVHLGGNILWVDCEKGYVSSTN  82

Query  311  GSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFL  490
             +  CGS + ++AN K C          +NP+S     G ++ D ++++  D  N G  +
Sbjct  83   KTARCGSAQCNLANAKACGGGICGAGP-DNPISNTGTHGDIRIDVLSIQSTDGRNPGRAV  141

Query  491  SHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
            + VPNF+F     F+ QGL +GV G+  LG S+++LPSQLA  F +
Sbjct  142  T-VPNFIFLCGSEFVLQGLASGVVGIAGLGRSKVALPSQLAAAFSL  186



>ref|XP_006489313.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=420

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 94/166 (57%), Gaps = 6/166 (4%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            AQ    P+A+V+ V+KD  T QYV Q++    L P+KL V +GG  LW D    + SS+ 
Sbjct  23   AQTSLRPKALVLRVAKDTATLQYVTQIKQRTPLVPVKLTVHLGGNILWVDCEKGYVSSTN  82

Query  311  GSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFL  490
             +  CGS + ++AN K C          +NP+S     G ++ D ++++  D  N G  +
Sbjct  83   KTARCGSAQCNLANAKACGGGICGAGP-DNPISNTGTHGDIRIDVLSIQSTDGRNPGRAV  141

Query  491  SHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
            + VPNF+F     F+ QGL +GV G+  LG S+++LPSQLA  F +
Sbjct  142  T-VPNFIFLCGSEFVLQGLASGVVGIAGLGRSKVALPSQLAAAFSL  186



>ref|XP_002280508.1| PREDICTED: basic 7S globulin [Vitis vinifera]
Length=388

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 93/163 (57%), Gaps = 20/163 (12%)
 Frame = +2

Query  167  AIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQ---------GSI  319
            ++++ V+KD  T QYV Q+  G  L P+KLV+D+G PFLW D +S            GSI
Sbjct  22   SLLLPVTKDAATLQYVTQIHHGTPLVPIKLVLDLGAPFLWLDCSSGHVSSSNTPILCGSI  81

Query  320  PCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHV  499
             C + K+S +   G TS   C L  +N ++ +A +G L ED +AVE       GS +   
Sbjct  82   QCLTAKTSDSGHGGGTST--CRLSPKNTITGLAEAGELAEDMVAVE-------GSEMGS-  131

Query  500  PNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
              FLFS  P  L +GL +G  G+L LG +RI+LPSQLA + G+
Sbjct  132  -RFLFSCAPKPLLKGLASGTVGMLGLGRTRIALPSQLAASVGL  173



>ref|XP_007224886.1| hypothetical protein PRUPE_ppa022337mg [Prunus persica]
 gb|EMJ26085.1| hypothetical protein PRUPE_ppa022337mg [Prunus persica]
Length=400

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 97/174 (56%), Gaps = 16/174 (9%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASS-----  304
            LA+    P+ ++  V+KD  T QY+  +  G  L P KLVVD+GGPFLW +  SS     
Sbjct  5    LAKPSHPPKGLIFHVTKDVSTLQYMTTIHHGTPLVPTKLVVDLGGPFLWLNCGSSSSSSR  64

Query  305  --SQGSIPCGSLKSSMANP------KGCTSNEICELQFENPVSKMAGSGVLKEDTIAVEL  460
              +QGSI C + K    N           +N+ C +  EN +++MA  G L +D +A+++
Sbjct  65   LIAQGSIQCLAAKPKTHNQGSKNYLSSNDNNKKCHVFPENSITQMATQGELVQDIMAIQV  124

Query  461  ID---EPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLA  613
            ID   +  +GS  +   NFLFS  P FL  GL +G  G+L LG ++IS+ SQ++
Sbjct  125  IDGSSKTESGSITTLDSNFLFSCAPMFLLNGLASGARGMLGLGRTQISMASQIS  178



>pdb|3VLB|A Chain A, Crystal Structure Of Xeg-edgp
 pdb|3VLB|C Chain C, Crystal Structure Of Xeg-edgp
Length=413

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 91/173 (53%), Gaps = 15/173 (9%)
 Frame = +2

Query  146  QRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  313
            Q  F P A+V+ V KD  T QYV  +     L    LVVD+GG FLW D    + SS+  
Sbjct  1    QPSFRPSALVVPVKKDASTLQYVTTINQRTPLVSENLVVDLGGRFLWVDCDQNYVSSTYR  60

Query  314  SIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELI  463
             + C + + S++    C           +N  C +  ENPV   A  G + ED ++VE  
Sbjct  61   PVRCRTSQCSLSGSIACGDCFNGPRPGCNNNTCGVFPENPVINTATGGEVAEDVVSVEST  120

Query  464  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            D  ++G  ++ VP F+FS  P+ L Q L +GV G+  LG +RI+LPSQ A+ F
Sbjct  121  DGSSSGRVVT-VPRFIFSCAPTSLLQNLASGVVGMAGLGRTRIALPSQFASAF  172



>pdb|3VLA|A Chain A, Crystal Structure Of Edgp
Length=413

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 90/170 (53%), Gaps = 15/170 (9%)
 Frame = +2

Query  155  FFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  322
            F P A+V+ V KD  T QYV  +     L    LVVD+GG FLW D    + SS+   + 
Sbjct  4    FRPSALVVPVKKDASTLQYVTTINQRTPLVSENLVVDLGGRFLWVDCDQNYVSSTYRPVR  63

Query  323  CGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  472
            C + + S++    C           +N  C +  ENPV   A  G + ED ++VE  D  
Sbjct  64   CRTSQCSLSGSIACGDCFNGPRPGCNNNTCGVFPENPVINTATGGEVAEDVVSVESTDGS  123

Query  473  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++G  ++ VP F+FS  P+ L Q L +GV G+  LG +RI+LPSQ A+ F
Sbjct  124  SSGRVVT-VPRFIFSCAPTSLLQNLASGVVGMAGLGRTRIALPSQFASAF  172



>ref|XP_004229433.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=444

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 95/182 (52%), Gaps = 17/182 (9%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            ++SLA+ P  PRA ++ V+KD  T QYV  +     L P+KL +D+G  FLW D    + 
Sbjct  19   SLSLAKTPTRPRAFLLPVTKDASTKQYVTTIDQRTPLVPIKLTIDLGQRFLWVDCEKGYV  78

Query  299  SSSQGSIPCGSL-----------KSSMANPK-GCTSNEICELQFENPVSKMAGSGVLKED  442
            SSS   +PCGS+           +S +  P  GC +N    + + NP  + +  G L +D
Sbjct  79   SSSYKPVPCGSIPCKRSFSGACVESCIGPPSPGCNNNTCSHIPY-NPFIRTSTGGELAQD  137

Query  443  TIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             ++++  D  N   +LS     +F   P  L QGL  GV G+L LGN  +  P+QLAN F
Sbjct  138  VVSLQSTDGSNPRKYLSTTNGVVFDCAPHSLLQGLAKGVKGILGLGNGYVGFPTQLANAF  197

Query  623  GI  628
             I
Sbjct  198  SI  199



>emb|CDO98879.1| unnamed protein product [Coffea canephora]
Length=431

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 93/177 (53%), Gaps = 16/177 (9%)
 Frame = +2

Query  137  SLAQRP-FFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  301
            S+AQ   F PRA+V+ ++KD  T QY+ QL     L  ++L VD+GG FLW D    + S
Sbjct  19   SIAQTTSFRPRALVLPLTKDSATGQYITQLSQRTPLVAIRLTVDLGGQFLWVDCDRNYIS  78

Query  302  SSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  451
            SS     C S   ++AN K C           +N  C L   NP  + + SG L +D ++
Sbjct  79   SSYRPARCRSAVCNLANSKACGQCNGSPRPGCNNNTCGLSPYNPFIRTSTSGELAQDVVS  138

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  D  N G  +S  P   F+  P+FL +GL  GV G+  LG   I LPSQLA+ F
Sbjct  139  LQSTDGSNPGRIVS-APRVAFTCGPTFLLEGLAKGVVGMAGLGRGPIGLPSQLASAF  194



>gb|KCW49914.1| hypothetical protein EUGRSUZ_K03381, partial [Eucalyptus grandis]
Length=413

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 91/172 (53%), Gaps = 15/172 (9%)
 Frame = +2

Query  149  RPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGS  316
            + F P+A+V+ VSKD  T QY+ ++     L P+ LVVD+GG FLW D    + SS+   
Sbjct  1    QSFRPKALVLPVSKDASTLQYLTRISQRTPLVPVDLVVDLGGQFLWVDCEQNYVSSTYRP  60

Query  317  IPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELID  466
              CGS   S+A   GC           +N  C +  +N V+  A  G +  D ++V   D
Sbjct  61   ARCGSAVCSLARASGCGDCSSAAGPGCNNNTCGVIPDNTVTHTATGGEVATDLVSVNSTD  120

Query  467  EPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
              N G  + +V  F+F+  PS L  GL  GV G+  LG +RI+LPSQ A+ F
Sbjct  121  GSNPGRAV-NVTRFVFACAPSSLLGGLAKGVEGMAGLGRTRIALPSQFASAF  171



>ref|XP_010522713.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=429

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 94/176 (53%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            + AQ+ F P+A+V+ V+KD  T QY+A +     L P+KLVVD+GG F W D    + SS
Sbjct  20   TFAQQSFRPKALVLPVTKDASTLQYLATINQRTPLVPVKLVVDLGGQFQWVDCDKGYISS  79

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            +     C S   S+A    C           +N  C +  +N V++ A SG L +D +++
Sbjct  80   TYRPARCRSAVCSLARSTSCGDCFSAPRPGCNNNTCGVFPDNTVTRTATSGELAQDVVSI  139

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            E  D  N G  ++ VP F+ +   +FL  GL NG  G+  LG + I+LPSQ A  F
Sbjct  140  ESTDGSNPGRVVT-VPRFVLACGSTFLLDGLANGAMGMAGLGRTNIALPSQFAAAF  194



>ref|XP_010256207.1| PREDICTED: basic 7S globulin 2-like [Nelumbo nucifera]
Length=439

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 98/184 (53%), Gaps = 19/184 (10%)
 Frame = +2

Query  128  ATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            +T + A++P  P A+VI V KD  T QYVA ++M   LAP+ + VD+ GPFLW D    +
Sbjct  21   STTATARQPR-PNALVIPVKKDAKTLQYVATIKMRTPLAPVNVFVDLSGPFLWVDCEDGY  79

Query  296  ASSSQGSIPCGSLKSSMANPKGC-----------TSNEICELQFENPVSK--MAGSGVLK  436
             SSS    PCGS K  +A   GC            +N  C++  +NP  K  + G G L 
Sbjct  80   VSSSYRPTPCGSPKCEVAKSSGCIVECHSAPRPGCTNNTCDVVLDNPFIKDFLYGGG-LA  138

Query  437  EDTIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLAN  616
            ED IA++       G  L+ V  F F+   +   QGL  GV G+L L  + +SLPSQLA+
Sbjct  139  EDVIALQSSGGRKPGGGLAVVRQFPFACADTRNLQGLAVGVKGMLGLARTPVSLPSQLAS  198

Query  617  TFGI  628
              G+
Sbjct  199  KSGL  202



>ref|XP_010111673.1| Basic 7S globulin [Morus notabilis]
 gb|EXC31441.1| Basic 7S globulin [Morus notabilis]
Length=421

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 93/163 (57%), Gaps = 18/163 (11%)
 Frame = +2

Query  173  VIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASS---------SQGSIPC  325
            ++ ++KD  T QY+  +  G +L P KLV+D+GGPFLW D  S          S+GSI C
Sbjct  35   ILPITKDASTLQYLTSVDHGNSLLPTKLVLDLGGPFLWMDCGSRDLFSPGRLISRGSIRC  94

Query  326  GSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA------GSF  487
             + KSS +       +++C +  EN + K+ G G + ED +AV+L+D   A      G +
Sbjct  95   LAAKSS-SRRNSDDKSDVCAIFSENRIGKVRGRGDVAEDILAVDLVDPSKAEEIRTVGKY  153

Query  488  LSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLAN  616
            L +  NFLF+     L  GL +G  G+L LG +RISLPSQ+++
Sbjct  154  LHN--NFLFACAEKSLLSGLASGAKGILGLGRARISLPSQISS  194



>ref|XP_002517164.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45327.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=433

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 92/176 (52%), Gaps = 16/176 (9%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSS  307
            ++Q  F P+A+++ V+KD  T  Y  Q      L P+  ++D+GG +LW D    + SS+
Sbjct  21   ISQTSFRPKALLLPVTKDPSTLLYFTQFNQRTPLVPVHTILDLGGLYLWVDCDRGYVSST  80

Query  308  QGSIPCGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAV  454
                 C S + ++AN  GC +           N  C L  +N V+ +   G L +D +++
Sbjct  81   YRPARCNSAQCNLANANGCITACFDAPRPGCNNNTCALLVDNTVTNIGTDGELGQDVVSL  140

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  D  N G  +S V NFLF   PSF+  GL +G  G+  LG +++SLPSQ A  F
Sbjct  141  QSTDGSNPGRVVS-VSNFLFVCAPSFILNGLPSGTEGMAGLGRTKVSLPSQFAAAF  195



>ref|XP_006429864.1| hypothetical protein CICLE_v10013399mg [Citrus clementina]
 gb|ESR43104.1| hypothetical protein CICLE_v10013399mg [Citrus clementina]
Length=347

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 93/163 (57%), Gaps = 8/163 (5%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGSI  319
            +AQ  F P+A+VI V KD  T QYVA+++    L P+KL V +GG      + SS+    
Sbjct  23   IAQTSFRPKALVIPVVKDAATLQYVAEIKQTTPLVPVKLTVHLGG------YVSSTNKIA  76

Query  320  PCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHV  499
             CGS + ++AN K C    IC    ENP+S     G ++ D ++++  +  N G  ++ V
Sbjct  77   RCGSAQCNLANVKAC-GGGICGADPENPISNTGTFGDIRIDVLSIQSTNSRNPGRAVT-V  134

Query  500  PNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
             NF+F     F+ QGL NGV G+  LG S+++LPSQLA  F +
Sbjct  135  LNFIFLCGSEFVLQGLANGVVGIAGLGTSKVALPSQLAAAFSL  177



>ref|XP_004495218.1| PREDICTED: basic 7S globulin 2-like [Cicer arietinum]
Length=436

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 99/177 (56%), Gaps = 16/177 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTS-QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  301
            + +Q+ F P+A+V+ V+KD  T+ QY+AQ+     L PL LVVD+GG FLW D    + S
Sbjct  23   TFSQQSFRPKALVLPVTKDTSTTNQYIAQINQRTPLVPLNLVVDLGGQFLWLDCEQHYTS  82

Query  302  SSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  451
            S+     C S + S+A    C           +N  C +  +N V+  A SG L ED ++
Sbjct  83   STYRPARCRSAQCSLAKSTACGDCFSSPKPGCNNNTCSIFPDNTVTHTATSGELAEDVLS  142

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  +  N    ++ V  FLFS  P+ L +GL +G +G+  LG ++I+ PSQLA+ F
Sbjct  143  IQSTNGFNPTQNVA-VSRFLFSCAPTSLLEGLASGASGMAGLGRTKIAFPSQLASAF  198



>ref|XP_010255899.1| PREDICTED: basic 7S globulin-like [Nelumbo nucifera]
Length=448

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 89/177 (50%), Gaps = 15/177 (8%)
 Frame = +2

Query  134  ISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  301
            I ++     P  +VI V KD  TSQYVA ++M   L P+K+VVD+ G  LW D    + S
Sbjct  28   IPISNAALRPSEVVIPVQKDVETSQYVATIKMRTPLVPVKVVVDLAGTLLWVDCDDGYIS  87

Query  302  SSQGSIPCGSLKSSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIA  451
            SS    PCGS K  +A   GC S          N+ C +   NP+     +G L ED IA
Sbjct  88   SSYRPTPCGSAKCQLAKGIGCLSCNLEPRPGCTNDTCSVFPYNPIKNSLMTGGLSEDVIA  147

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  D  N G+     P F FS   +   +GL  G  G+L L  S  +LP+QLA+ F
Sbjct  148  IQSTDGKNPGAVAVIHP-FPFSCATTSHLEGLARGAKGMLGLSRSSTALPTQLASQF  203



>dbj|BAK57511.1| extracellular dermal glycoprotein [Nicotiana benthamiana]
Length=440

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 95/179 (53%), Gaps = 15/179 (8%)
 Frame = +2

Query  128  ATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            +T +  Q  F P+ +++ ++KD  T QY+ Q+Q    L P+ L +D+GG FLW D    +
Sbjct  22   STTAQNQTSFRPKGLILPITKDASTFQYLTQIQQRTPLVPVSLTLDLGGQFLWVDCDQGY  81

Query  296  ASSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  445
             SSS     C S + S+A   GC           +N+ C L  +N V++ A SG L  DT
Sbjct  82   VSSSYKPARCRSAQCSLARAGGCGQCFSPPKPGCNNDTCGLIPDNTVTQTATSGELASDT  141

Query  446  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            + V+  +  N G  +    +FLF    +FL + L +GV G+  LG +RISLPSQ +  F
Sbjct  142  VQVQSSNGKNPGRNVVD-KDFLFVCGSTFLLKRLASGVKGMAGLGRTRISLPSQFSAEF  199



>ref|XP_006345120.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=437

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 93/170 (55%), Gaps = 19/170 (11%)
 Frame = +2

Query  164  RAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGS  331
            +A ++ V+KD  T QY+ Q+     L P+KL + +GG  LW D    + SS+   + CGS
Sbjct  32   KAFILPVTKDSSTLQYITQIGQRTPLVPIKLTIHLGGQTLWVDCENGYVSSTYQPLLCGS  91

Query  332  LKSSMAN-----------PK-GCTSNEICELQFENP-VSKMAGSGVLKEDTIAVELIDEP  472
             + ++A            PK GC  N  C    ENP +  +   G L ED ++++  D  
Sbjct  92   TQCTIAKVDTCANCSTSAPKIGCNDNA-CYNTPENPFIKTLYSGGQLNEDVLSIQSTDGS  150

Query  473  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            N G F+  +PNF+F+  P+FL +GL + V G + LG +RI+LPSQLA  F
Sbjct  151  NPGKFV-KIPNFIFTCAPTFLTEGLASEVKGTVGLGRNRIALPSQLAEIF  199



>ref|XP_002517165.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45328.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=434

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 94/174 (54%), Gaps = 16/174 (9%)
 Frame = +2

Query  146  QRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  313
            Q  F P+A+V+ VS+D  T QY+  +     L P+KL +D+GG +LW D    + SSS  
Sbjct  23   QTSFRPKALVLPVSRDPSTLQYLTSINQRTPLVPVKLTLDLGGQYLWVDCDQGYVSSSYK  82

Query  314  SIPCGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVEL  460
             + C S + S+A  K C S           N+ C L  +N V+    SG + +D + V+ 
Sbjct  83   PVRCRSAQCSLAKSKSCISECFSSPRPGCNNDTCALLPDNTVTHSGTSGEVGQDVVTVQS  142

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             D  + G  +S VP  +F+   +FL +GL +GV G+  LG ++ISLPSQ +  F
Sbjct  143  TDGFSPGRVVS-VPKLIFTCATTFLLEGLASGVKGMAGLGRTKISLPSQFSAAF  195



>gb|AAX81588.1| nectarin IV [Nicotiana langsdorffii x Nicotiana sanderae]
Length=437

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 95/179 (53%), Gaps = 15/179 (8%)
 Frame = +2

Query  128  ATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            +T +  Q  F P+ +++ ++KD  T QY+ Q+    +L P+ L +D+GG FLW D    +
Sbjct  19   STTAQNQTSFRPKGLILPITKDASTLQYLTQIHQRTHLVPVSLTLDLGGQFLWVDCDQGY  78

Query  296  ASSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  445
             SSS     C S + S+A   GC           +N  C L  +N +++ A SG L  D 
Sbjct  79   VSSSYKPARCRSAQCSLAGAGGCGQCFSPPKPGCNNNTCSLLPDNTITRTATSGELASDI  138

Query  446  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            + V+  +  N G  ++   +FLF    +FL +GL +GV G+  LG +RISLPSQ +  F
Sbjct  139  VQVQSSNGKNPGRNVTD-KDFLFVCGSTFLLEGLASGVKGMAGLGRTRISLPSQFSAEF  196



>ref|XP_006419822.1| hypothetical protein CICLE_v10007187mg [Citrus clementina]
 gb|ESR33062.1| hypothetical protein CICLE_v10007187mg [Citrus clementina]
Length=422

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 94/165 (57%), Gaps = 6/165 (4%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSS  307
            +AQ  F P+A+V+ V KD  T QY+ Q++    L P+KL V +GG  LW D    + SS+
Sbjct  21   VAQTSFRPKALVLPVQKDAATLQYITQIKQRTPLVPVKLAVHLGGNILWVDCEKGYVSST  80

Query  308  QGSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSF  487
              +  CGS + ++AN K      IC     NP+S    SG ++ D ++++  +  N G  
Sbjct  81   NKTARCGSAQCNLANAK-ACGGGICGAGVNNPISNTGTSGDIRIDVLSIQSTNGRNPGRA  139

Query  488  LSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++ VPNF+F     F+ QGL NGV G+  LG S+++LP QLA  F
Sbjct  140  VT-VPNFIFLCGSEFVLQGLANGVVGIAGLGRSKVALPLQLAAAF  183



>ref|XP_006489578.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=422

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 94/165 (57%), Gaps = 6/165 (4%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSS  307
            +AQ  F P+A+V+ V KD  T QYV Q++    L P+KL V +GG  LW D    + SS+
Sbjct  21   VAQTSFRPKALVLPVQKDAATLQYVTQIKQRTPLVPVKLAVHLGGNILWVDCEKGYLSST  80

Query  308  QGSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSF  487
              +  CGS + ++AN K      IC     NP+S    SG ++ D ++++  +  N G  
Sbjct  81   NKTARCGSAQCNLANAK-ACGGGICGAGVNNPISNTGTSGDIRIDVLSIQSTNGGNPGRA  139

Query  488  LSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++ VPNF+F     F+ QGL NGV G+  LG S+++LP QLA  F
Sbjct  140  VT-VPNFIFLCGSEFVLQGLANGVVGIAGLGRSKVALPLQLAAAF  183



>emb|CBI26188.3| unnamed protein product [Vitis vinifera]
Length=400

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 90/158 (57%), Gaps = 20/158 (13%)
 Frame = +2

Query  167  AIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQ---------GSI  319
            ++++ V+KD  T QYV Q+  G  L P+KLV+D+G PFLW D +S            GSI
Sbjct  102  SLLLPVTKDAATLQYVTQIHHGTPLVPIKLVLDLGAPFLWLDCSSGHVSSSNTPILCGSI  161

Query  320  PCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHV  499
             C + K+S +   G TS   C L  +N ++ +A +G L ED +AVE       GS +   
Sbjct  162  QCLTAKTSDSGHGGGTST--CRLSPKNTITGLAEAGELAEDMVAVE-------GSEMG--  210

Query  500  PNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLA  613
              FLFS  P  L +GL +G  G+L LG +RI+LPSQLA
Sbjct  211  SRFLFSCAPKPLLKGLASGTVGMLGLGRTRIALPSQLA  248



>emb|CBI26189.3| unnamed protein product [Vitis vinifera]
Length=283

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 91/164 (55%), Gaps = 13/164 (8%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGS  316
            SLAQ  F P+A+V+ VSKD  + QY+  +    +L  + L +D+GG FLW D     QG 
Sbjct  21   SLAQTSFRPKALVLPVSKDAASLQYITHINQRTHLVSIPLTLDLGGQFLWVDC---DQGY  77

Query  317  IPCGSLKSSMANP--KGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFL  490
            +      SS   P  KGC +   C L  +N V+  A SG + ED ++++  D  N G  +
Sbjct  78   V------SSSYRPVLKGC-NYSTCVLSPDNTVTGTATSGEVGEDAVSIQSTDGSNPGRVV  130

Query  491  SHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            S V   LF+   +FL +GL + V G+  LG SR++LPSQ ++ F
Sbjct  131  S-VRRLLFTCGSTFLLEGLASRVKGMAGLGRSRVALPSQFSSAF  173



>gb|KDO74795.1| hypothetical protein CISIN_1g037976mg [Citrus sinensis]
Length=435

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 93/177 (53%), Gaps = 16/177 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S+A+  F P+A+V+ V+KD  T QY+ Q++    L P+KL +D+GG FLW D    + SS
Sbjct  20   SIAKTSFRPKALVLPVTKDGSTLQYLTQIKQRTPLVPVKLTLDLGGQFLWVDCEKEYVSS  79

Query  305  SQGSIPCGSLKSSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIA  451
            S    PC S   S+AN           P+    N  C L  EN ++ ++  G +  D  +
Sbjct  80   SYTFAPCHSAPCSLANAPYCFECHGIKPRPGCHNNTCNLLPENTINGISFFGGVSMDVAS  139

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  D  N G  +S VP  LF    SFL   L  GV G+  LG ++ISLPS  ++ F
Sbjct  140  IQSTDGKNPGKVVS-VPKLLFVCSDSFLLTDLAKGVTGMAGLGRTKISLPSLFSSAF  195



>ref|XP_002311834.1| hypothetical protein POPTR_0008s20730g [Populus trichocarpa]
 gb|EEE89201.1| hypothetical protein POPTR_0008s20730g [Populus trichocarpa]
Length=437

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 98/179 (55%), Gaps = 16/179 (9%)
 Frame = +2

Query  137  SLAQRPFFP-RAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADW----AS  301
            S AQ P  P R++V+ V+KD  T Q++  +  G +  P+++V+D+G P LW D      S
Sbjct  23   SCAQIPNSPIRSLVLPVTKDPATFQFLTTIYHGTSREPIRVVLDLGCPSLWLDCSSGRLS  82

Query  302  SSQGSIPCGSLKSSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIA  451
            SS+  IP  S++ + A P   +              C L  EN +++ A  G L ED + 
Sbjct  83   SSRRLIPSCSIQCAAAKPNNMSCAFSAAMPTRKRTACGLSTENSIARSATRGELVEDILT  142

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
            VE +D   AG  ++ V +FLFS  P FL   L  G  G+L LG SRI+LPSQLA+ FG+
Sbjct  143  VESVDGSKAGP-VTTVDHFLFSCAPRFLLNRLARGAQGMLGLGKSRIALPSQLASKFGL  200



>ref|XP_006489309.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=435

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 93/177 (53%), Gaps = 16/177 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S+A+  F P+A+V+ V+KD  T QY+ Q++    L P+KL +D+GG FLW D    + SS
Sbjct  20   SIAKTSFRPKALVLPVTKDGSTLQYLTQIKQRTPLVPVKLTLDLGGQFLWVDCEKEYVSS  79

Query  305  SQGSIPCGSLKSSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIA  451
            S    PC S   S+AN           P+    N  C L  EN ++ ++  G +  D  +
Sbjct  80   SYTFAPCHSAPCSLANAPYCFECHGIKPRPGCHNNTCNLLPENTINGISFFGGVSMDVAS  139

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  D  N G  +S VP  LF    SFL   L  GV G+  LG ++ISLPS  ++ F
Sbjct  140  IQSTDGKNPGKVVS-VPKLLFVCSDSFLLTDLAKGVTGMAGLGRTKISLPSLFSSAF  195



>gb|ACM68432.1| xyloglucanase-specific endoglucanase inhibitor protein [Petunia 
x hybrida]
Length=436

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 94/179 (53%), Gaps = 15/179 (8%)
 Frame = +2

Query  128  ATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            +TI  AQ  F P+ +++ V+KD  T QY+ Q+     L P+ L +D+GG FLW D    +
Sbjct  19   STIVHAQTSFRPKGLILPVTKDASTLQYLTQISQRTPLVPVSLTLDLGGQFLWVDCDQGY  78

Query  296  ASSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  445
             SSS     C S K S+A   GC           +N  C    +N +++ A SG L  D 
Sbjct  79   VSSSYIPARCRSAKCSLAGSSGCGDCFSPPSPGCNNNTCGAFPDNSITRTATSGELASDI  138

Query  446  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++V+  +  N G  +S   +FLF    +FL  GL +GV G+  LG +RISLPSQ +  F
Sbjct  139  VSVQSSNGKNPGRNVSD-KDFLFVCGATFLLNGLASGVKGMAGLGRTRISLPSQFSAEF  196



>gb|KDP40108.1| hypothetical protein JCGZ_02106 [Jatropha curcas]
Length=425

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 91/170 (54%), Gaps = 18/170 (11%)
 Frame = +2

Query  170  IVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWAS---SSQGSIPCGSLKS  340
            +++ VSKD  T QY+ Q+  G +  P KLV+D+GGPFLW D +S   S +  IP  S++ 
Sbjct  32   VLLPVSKDLATLQYMTQIYHGTSGMPTKLVIDLGGPFLWHDCSSGKVSYEHLIPSCSIQC  91

Query  341  SMANP-----KGCTSN---------EICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
            +MA       K C S+           C++   N +++    G L ED IAV  +D   +
Sbjct  92   AMAKKFHTEQKNCFSDTSRSEEQYPSTCDISTRNGITRSRTRGELAEDVIAVRTVDGTKS  151

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
            G  +  + NFLF+   + L  GL  G  G+L LG + I+LPSQLA  F +
Sbjct  152  GKIV-EIDNFLFACASTALLDGLAGGAQGMLGLGRTPIALPSQLAAKFDL  200



>ref|XP_002517162.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45325.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=411

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 92/167 (55%), Gaps = 8/167 (5%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGS--  316
            AQ    P +  + V+KD  T QY+ ++  G    P  LV+D+ G  LW D ASS Q S  
Sbjct  20   AQISSSPDSFHLPVTKDLSTLQYITRINHGALQIPTNLVIDLDGAHLWLDCASSEQVSSS  79

Query  317  ---IPCGSLKSSMANP--KGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAG  481
               IP  S++ SMA P  K C  +  C++  +N + ++  +G L ED +A+  +D  N+G
Sbjct  80   LRLIPSCSIQCSMAKPGHKSCNHHSSCDIFTQNGIIQLVKTGELVEDVLAIPSVDGSNSG  139

Query  482  SFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +    + NF+ +  P+ L  GL +G  G+L LG S+I+L SQLA  F
Sbjct  140  TNF-EIENFILACAPATLLDGLASGAQGMLGLGRSKIALQSQLAARF  185



>ref|XP_011090790.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=443

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 89/175 (51%), Gaps = 16/175 (9%)
 Frame = +2

Query  149  RPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW-----ADWASSSQG  313
            +P  P+A+V+AV+KD  TSQY+  ++    L P+KL VDVGG  LW     +++ SS+  
Sbjct  30   KPSRPQALVLAVTKDPSTSQYLTTIRQRTPLRPVKLTVDVGGKALWVACDRSEYISSTYK  89

Query  314  SIPCGSLKSSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIAVELI  463
               CGS +  +A  K C           +NE C     N V K    G +  D +A++  
Sbjct  90   PALCGSPQCRLAKSKSCDDCWDGPRPGCNNETCSNVVYNTVEKSGQIGEVATDVLALQST  149

Query  464  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
            D  N G  L  VPNFLFS    FL + L NG  G+   G +  SLPS L+   G+
Sbjct  150  DGSNPGR-LVRVPNFLFSCGSLFLGEKLANGAKGIAGFGRTETSLPSLLSRALGV  203



>ref|XP_004236054.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=436

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 90/170 (53%), Gaps = 19/170 (11%)
 Frame = +2

Query  164  RAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGS  331
             A ++ V KD  T QY+ Q+     L P+KL + +GG  LW D    + SS+   + CGS
Sbjct  31   EAFILPVKKDSSTLQYITQIGQRTPLVPIKLTIHLGGQTLWVDCENGYVSSTYQPLLCGS  90

Query  332  LKSSMAN-----------PK-GCTSNEICELQFENP-VSKMAGSGVLKEDTIAVELIDEP  472
             + ++A            PK GC  N  C    ENP +  +   G L ED ++++  D  
Sbjct  91   TQCTIAKVDTCGNCSTSAPKIGCNDNA-CYNTPENPFIKTLYSGGQLNEDVLSIQSTDGS  149

Query  473  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            N G F+  +PNF+F+  P+FL  GL + V G + LG +RI+LPSQLA  F
Sbjct  150  NPGKFV-KIPNFIFTCAPTFLTDGLASEVKGTVGLGRNRIALPSQLAEIF  198



>ref|XP_010667343.1| PREDICTED: basic 7S globulin-like [Beta vulgaris subsp. vulgaris]
Length=432

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 88/170 (52%), Gaps = 15/170 (9%)
 Frame = +2

Query  155  FFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  322
            F P+A+V+ +S+D  T QY   L        + L +D+GGPFLW D    + S++  S  
Sbjct  21   FRPKALVLPISRDPSTLQYRINLTQRTPPINIPLTLDLGGPFLWVDCDKNYISTTYRSAR  80

Query  323  CGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  472
            C S + S+AN K C           +N  C L  ENP    A SG L  D I +   D  
Sbjct  81   CNSAQCSLANSKSCGTCNAPPRPGCNNNTCGLFPENPFINTATSGELASDVIRITSTDGS  140

Query  473  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            N G  +  VPNFLFS  P+ L +GL   V G+  LG+++IS PSQ ++ F
Sbjct  141  NPGPVV-KVPNFLFSCAPTSLLKGLSKSVQGIAGLGSTKISPPSQFSSAF  189



>ref|XP_002517173.1| pepsin A, putative [Ricinus communis]
 gb|EEF45336.1| pepsin A, putative [Ricinus communis]
Length=449

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 95/181 (52%), Gaps = 19/181 (10%)
 Frame = +2

Query  134  ISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQ-  310
            +S+AQ    P+A+++ V+KD  T QYV  L +G  LA    VVD+GG  LW D    S  
Sbjct  20   LSIAQASSKPKALILPVNKDATTLQYVTHLNIGTPLAKKDFVVDLGGAHLWMDCDDGSYV  79

Query  311  ---------GSIPCGSLKSSMA-------NPKGCTSNEICELQFENPVSKMAGSGVLKED  442
                     GS PC   K++         +  GC SNE C +   N +      GV+  D
Sbjct  80   SSTFRQSLCGSAPCSVAKATCTGGCVPGHHKSGC-SNETCYVLSTNTIQGRLEVGVVSRD  138

Query  443  TIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             IA++  D   +GS +S +P+++F+   ++  + L +G  G+L LG  +I+LP QL+++F
Sbjct  139  IIALQSTDGAKSGSLVS-IPDYIFACANAWDLKSLASGAKGMLGLGREQIALPKQLSSSF  197

Query  623  G  625
            G
Sbjct  198  G  198



>ref|XP_011014389.1| PREDICTED: basic 7S globulin-like [Populus euphratica]
Length=435

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 97/179 (54%), Gaps = 16/179 (9%)
 Frame = +2

Query  137  SLAQRPFFP-RAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASS---  304
            S AQ P  P R +V+ V+KD  T QY+  +  G +  P+++V+D+G P LW   +S    
Sbjct  23   SCAQIPNSPIRFLVLPVTKDPATFQYLTTIHHGTSREPVRVVLDLGCPSLWLACSSGRLS  82

Query  305  -SQGSIPCGSLKSSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIA  451
             S+  IP  S++   A P   +           +  C L  EN +++ A  G L ED + 
Sbjct  83   LSRRLIPSCSIQCPAAKPNNMSCAFSAVMPTRKSTACGLSTENCITRSATRGELVEDILT  142

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
            V+ +D   +G  ++ V +FLFS VP FL   L  G  G+L LG SRI+LPSQLA+ FG+
Sbjct  143  VQSVDGSKSGP-VTIVDHFLFSCVPRFLLNRLAGGAQGMLGLGKSRIALPSQLASKFGL  200



>gb|KDP40110.1| hypothetical protein JCGZ_02108 [Jatropha curcas]
Length=437

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 92/178 (52%), Gaps = 18/178 (10%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSS  307
            +AQ  F P+A+V+ V KD  T QYV Q+     L P+ + +D+GG FLW D    + SSS
Sbjct  22   IAQTTFRPKALVLPVQKDSLTLQYVTQINQRTPLVPVNVTLDLGGLFLWVDCEQGYVSSS  81

Query  308  QGSIPCGSLKSSMANPKGCT-------------SNEICELQFENPVSKMAGSGVLKEDTI  448
                 C S + S+ N + C+             +N  C    +N V      G + +D +
Sbjct  82   YRPARCNSAQCSLINARRCSNEICLGSSPRPGCNNNTCSRFLDNRVISFGTEGEVGQDVV  141

Query  449  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +V+  D  N G  L+ V N LF+   +F+ +GL NGV G+  LG +R SLPSQ ++ F
Sbjct  142  SVQSTDGSNPG-ILASVSNLLFTCARTFILEGLPNGVKGMAGLGRNRASLPSQFSSAF  198



>ref|XP_006345119.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=436

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 92/169 (54%), Gaps = 17/169 (10%)
 Frame = +2

Query  164  RAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGS  331
            +A ++ V+KD  T QYV Q+     L P+KL + +GG   W D    + SS+     CGS
Sbjct  31   KAFILPVTKDSSTLQYVTQIGQRTPLVPIKLTIHLGGQTFWVDCENGYVSSTYRPALCGS  90

Query  332  LKSSMAN-----------PKGCTSNEICELQFENP-VSKMAGSGVLKEDTIAVELIDEPN  475
             + ++A            PK   +N  C    ENP +  +   G + ED ++++  D  N
Sbjct  91   TQCTIAKVNTCGNCSTSAPKIGCNNNACYNTPENPFIKTLYSGGEINEDVLSIQSTDGTN  150

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             G F+  +P+F+F+ VP+FL +GL +GV G + LG +RI+LPSQLA  F
Sbjct  151  PGKFV-KIPSFIFTCVPTFLTEGLASGVKGTVGLGRNRIALPSQLAEIF  198



>ref|XP_006419831.1| hypothetical protein CICLE_v10006962mg [Citrus clementina]
 gb|ESR33071.1| hypothetical protein CICLE_v10006962mg [Citrus clementina]
Length=435

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 93/177 (53%), Gaps = 16/177 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASS  304
            S+A+  F P+A+V+ V+KD  T QY+ Q++    L P+KL +D+GG FLW     ++ SS
Sbjct  20   SIAKTSFRPKALVLPVTKDGSTLQYLTQIKQRTPLVPVKLTLDLGGQFLWVVCEKEYVSS  79

Query  305  SQGSIPCGSLKSSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIA  451
            S    PC S   S+AN           P+    N  C L  EN ++ ++ +G +  D  +
Sbjct  80   SYRFAPCHSAPCSLANAPYCFECFGTKPRPGCHNNTCNLLPENTINGISFNGPVSMDVAS  139

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  D  N G  +S VP  LF    SF    L  GV G+  LG ++ISLPS  ++ F
Sbjct  140  IQSTDGKNPGKVVS-VPKLLFVCADSFHLTDLAKGVTGMAGLGRTKISLPSLFSSAF  195



>gb|KJB70565.1| hypothetical protein B456_011G080800 [Gossypium raimondii]
Length=434

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 90/173 (52%), Gaps = 15/173 (9%)
 Frame = +2

Query  146  QRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  313
            Q  F P+A+++ VSKD  T QY+ Q++    L P+KL +D+GG +LW D    + SSS  
Sbjct  24   QASFRPKALLLPVSKDASTLQYLTQIKQRTPLVPIKLTLDLGGEYLWVDCDQGYVSSSYK  83

Query  314  SIPCGSLKSSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELI  463
               C S + ++A  K C S          N  C L   N V      G + +D ++++  
Sbjct  84   PARCNSAQCNLARSKACGSCFDGPKPGCNNNTCSLLPSNSVKNSGTIGEVAQDVVSIQST  143

Query  464  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  N G  ++ V  FLF+   SFL  GL  GV G+  LG ++IS+PSQ A  F
Sbjct  144  NGKNPGKEVT-VSKFLFTCGSSFLLDGLAGGVKGMAGLGRTKISMPSQFAAAF  195



>ref|XP_003591797.1| Xyloglucan-specific endoglucanase inhibitor protein [Medicago 
truncatula]
 gb|AES62048.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=436

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 96/168 (57%), Gaps = 7/168 (4%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTS--QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            SLAQ  F P+A+V+ +++D   S  QY  Q++    L P+ L +D+GG + W +    + 
Sbjct  21   SLAQTSFRPKALVLPITRDTSASTPQYTTQIKQRTPLVPINLTIDLGGGYFWVNCDKSYV  80

Query  299  SSSQGSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
            SS+   I C S + S+    GC+  +IC     N V+ ++ SG ++ D ++V+  +   +
Sbjct  81   SSTLKPILCSSSQCSLFGSHGCSDKKICGRSPYNIVTGVSTSGDIQSDIVSVQSTNGNYS  140

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            G F+S VPNFLF    + +  GL  GV G+  LG +++SLPSQ ++ F
Sbjct  141  GRFVS-VPNFLFICGSNVVQNGLAKGVKGMAGLGRTKVSLPSQFSSAF  187



>ref|XP_007034626.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05552.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=420

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 84/169 (50%), Gaps = 13/169 (8%)
 Frame = +2

Query  155  FFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASS---------S  307
            F   ++   V KD  T QYVA++  G    P  LV+D+GGPFLW D  S          S
Sbjct  26   FHSNSVFFPVRKDAATLQYVARISHGTPSGPTNLVIDLGGPFLWMDCDSGHVSSSNRLIS  85

Query  308  QGSIPCGSLKSSMANPK---GCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
              S+ C   K      K   GC  N  C +   N ++ +   G L ED IAV+ +     
Sbjct  86   SCSVNCSKAKFHDHGSKSAGGCLCNTDCNVFSYNGITGLTAMGELVEDIIAVDSVGRSEV  145

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
            G  +  V +FLFS  P+FL QGL NG  G L LG + +SLPSQ +++ G
Sbjct  146  GQ-IKTVDHFLFSCAPTFLLQGLANGSKGTLGLGKASLSLPSQFSSSIG  193



>ref|XP_006419826.1| hypothetical protein CICLE_v10006501mg [Citrus clementina]
 gb|ESR33066.1| hypothetical protein CICLE_v10006501mg [Citrus clementina]
Length=419

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 94/173 (54%), Gaps = 15/173 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S A+  F P+A+V+ V+KD  T QY+ Q+Q    L PLKL +D+GG FLW +    + SS
Sbjct  21   SEAKTSFKPKALVVPVTKDSSTLQYLTQIQQRTPLVPLKLTLDLGGGFLWVNCEQGFVSS  80

Query  305  SQGSIPCGSLKSSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIAV  454
            S     CGS +  +A  + C           +N  C     N VS ++  G L  D +++
Sbjct  81   SYKPARCGSAQCKIAGSESCVESCLPKGPGCNNNTCTHFPGNTVSHVSTFGELATDVVSI  140

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLA  613
            +  D    G  +  VPN +F+   +FL +GL +GV G+  LG +++SLPSQL+
Sbjct  141  QSTDGSKPGQVVP-VPNIIFACGATFLLEGLASGVQGMAGLGRNKVSLPSQLS  192



>ref|XP_009611839.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=438

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 95/180 (53%), Gaps = 16/180 (9%)
 Frame = +2

Query  128  ATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            +T +  Q  F P+ +++ ++KD  T QY+ Q+     L P+ L +D+GG FLW D    +
Sbjct  19   STTAQNQTSFRPKGLILPITKDASTLQYLTQIHQRTPLVPVSLTLDLGGQFLWLDCDQGY  78

Query  296  ASSSQGSIPCGSLKSSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKED  442
             SSS     C S + S+A            PK   +N  C L  +N +++ A SG L  D
Sbjct  79   VSSSYKPARCRSAQCSLAGAGSGCGQCFSPPKPGCNNNTCSLLPDNTITRTATSGELASD  138

Query  443  TIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            T+ V+  +  N G  ++   +FLF    +FL +GL +GV G+  LG +RISLPSQ +  F
Sbjct  139  TVQVQSSNGKNPGRNVTD-KDFLFVCGATFLLEGLASGVKGMAGLGRTRISLPSQFSAEF  197



>gb|AFK42416.1| unknown [Lotus japonicus]
Length=440

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 94/171 (55%), Gaps = 8/171 (5%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTS--QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----  292
            T S+AQ  F P+A+ + ++KD  +S  QY+ Q++    L P+KL +D+GG +LW +    
Sbjct  23   TSSIAQTSFRPKALALPITKDVTSSLPQYITQIKQRTPLVPVKLTLDLGGGYLWVNCENR  82

Query  293  -WASSSQGSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDE  469
             + SS+     CGS + S+    GC+ ++IC     N V+ ++  G +  D ++V   D 
Sbjct  83   QYVSSTFKPARCGSSQCSLFGLTGCSGDKICGRSPSNTVTGVSSYGDIHSDVVSVNSTDG  142

Query  470  PNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
                  +S VPNFLF      +  GL  GV G+  LG +R+SLPSQ ++ F
Sbjct  143  TTPTKVVS-VPNFLFICGSKVVQNGLAKGVTGMAGLGRTRVSLPSQFSSAF  192



>ref|XP_006489307.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=422

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 92/168 (55%), Gaps = 6/168 (4%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            ++AQ  F PRA+V+ V K+    QYV Q++    L P+KL V +GG  LW D    + SS
Sbjct  20   AIAQTSFRPRALVLPVQKNAAVFQYVTQIKQRTPLVPVKLAVHLGGNLLWVDCEKGYVSS  79

Query  305  SQGSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGS  484
            +  +  CGS + ++  P  C    IC     NP+S     G ++ D ++V+  +  + G 
Sbjct  80   TNKTARCGSAQCNLIGPVAC-GGGICGEFPSNPISNTGTFGSIRIDVVSVQSTNGRHPGR  138

Query  485  FLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
             ++ VPNF+F     F+ QGL  GV G+ ALG ++ +LP QLA  F +
Sbjct  139  GVT-VPNFIFLCGSEFVLQGLAPGVTGIAALGRTKTALPLQLAAAFSL  185



>ref|XP_006419823.1| hypothetical protein CICLE_v10005035mg [Citrus clementina]
 gb|ESR33063.1| hypothetical protein CICLE_v10005035mg [Citrus clementina]
Length=422

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 91/166 (55%), Gaps = 6/166 (4%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            ++AQ  F PRA+V+ V K+    QYV Q++    L P+KL V +GG  LW D    + SS
Sbjct  20   AIAQTSFRPRALVLPVQKNAAVFQYVTQIKQRTPLVPVKLAVHLGGNLLWVDCEKGYVSS  79

Query  305  SQGSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGS  484
            +  +  CGS + ++  P  C    IC     NP+S     G ++ D ++V+  +  + G 
Sbjct  80   TNKTARCGSAQCNLIGPVAC-GGGICGEFPSNPISNTGTFGSIRIDVVSVQSTNGRHPGR  138

Query  485  FLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             ++ VPNF+F     F+ QGL  GV G+ ALG ++ +LP QLA  F
Sbjct  139  GVT-VPNFIFLCGSEFVLQGLAPGVTGIAALGRTKTALPLQLAAAF  183



>gb|ADD71504.1| xyloglucanase inhibitor 2 [Humulus lupulus]
Length=445

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 97/179 (54%), Gaps = 16/179 (9%)
 Frame = +2

Query  131  TISLAQRP-FFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            T ++A+ P F P+A+++ V+KD  T QY+ Q+     L P+KL V++GG FLW D    +
Sbjct  20   TPTIAETPSFRPKALLLPVTKDASTKQYLTQINQRTPLVPVKLTVNLGGEFLWVDCEKGY  79

Query  296  ASSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDT  445
             SS+     C S + ++A  K C           +N  C L   NP  + + SG L +D 
Sbjct  80   VSSTYKPARCRSAQCNLAGSKSCGECFDGPKPGCNNNTCGLFPYNPFIRTSTSGELAQDI  139

Query  446  IAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            I+++  +  N    +S  PN +F+   +FL +GL +GV G+  LG  +I+LPSQ A  F
Sbjct  140  ISIQSTNGSNPSKVVSF-PNVIFTCGSTFLLEGLASGVTGIAGLGRKKIALPSQFAAAF  197



>ref|XP_007143872.1| hypothetical protein PHAVU_007G109000g [Phaseolus vulgaris]
 gb|ESW15866.1| hypothetical protein PHAVU_007G109000g [Phaseolus vulgaris]
Length=438

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 92/168 (55%), Gaps = 7/168 (4%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTS--QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            S+AQ  F P+A+V+ V+KD   S  QYV +++    L P+KL VD+GG + W +    + 
Sbjct  20   SIAQTSFRPKALVLPVTKDVSASAPQYVTRIKQRTPLVPVKLTVDLGGGYFWVNCEKGYV  79

Query  299  SSSQGSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
            SS+     CGS + S+    GC+  +IC     N V+ ++  G +  D +A    D  N 
Sbjct  80   SSTSKPAHCGSAQCSLFGSNGCSGEKICGRSPSNTVTGVSTYGDIHADVVATNSTDGNNP  139

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
               +S VP FLF    + + +GL +GV G+  LG +++S PSQ A+ F
Sbjct  140  VRVVS-VPKFLFICGSNVVQKGLASGVRGMAGLGRTKVSFPSQFASAF  186



>gb|KCW49915.1| hypothetical protein EUGRSUZ_K03382 [Eucalyptus grandis]
Length=422

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 88/173 (51%), Gaps = 30/173 (17%)
 Frame = +2

Query  146  QRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQG  313
            Q+ F P+A+V+ VSKD  T QYV ++     L P+ LVVD+GG FLW D    + SS+  
Sbjct  24   QQSFRPKALVLPVSKDASTLQYVTRISQRTPLVPVALVVDLGGQFLWVDCEQNYVSSTYL  83

Query  314  SIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELI  463
               CGS   S+A   GC           +N  CE               +  D ++V   
Sbjct  84   PARCGSAVCSLARASGCGDCFSAARPGCNNNTCE---------------VATDLVSVNST  128

Query  464  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            D  N G  + +V  F+F+  PSFL  GL +GV G+  LG +RI+LPSQ A+ F
Sbjct  129  DGSNPGQAV-NVTRFVFACAPSFLLDGLASGVQGMAGLGRTRIALPSQFASAF  180



>emb|CBI32364.3| unnamed protein product [Vitis vinifera]
Length=400

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 85/166 (51%), Gaps = 10/166 (6%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S  +  F P A+VI VSKD  T QY+  +     L P+KLVVD+G  FLW D    + SS
Sbjct  20   SYGKTSFRPDALVIPVSKDASTLQYLTTINQRTPLVPVKLVVDLGAQFLWVDCEQNYVSS  79

Query  305  SQGSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGS  484
            S     C S + S+A   GC     C      P       G L ED ++V+  D  N G 
Sbjct  80   SYRPARCRSAQCSLARANGCGD---C-FSAPRPGCNNNTCG-LAEDFVSVQSTDGSNPGR  134

Query  485  FLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             +S V  FLFS  P+FL +GL +   G+  LG +RI+ PSQ A+ F
Sbjct  135  VVS-VSKFLFSCAPTFLLEGLASSAMGMAGLGRTRIAFPSQFASAF  179



>gb|ADD71505.1| xyloglucanase inhibitor 3 [Humulus lupulus]
Length=441

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 91/165 (55%), Gaps = 10/165 (6%)
 Frame = +2

Query  155  FFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  322
            F P+A+V+ V+KD  T QY   +        +K+ +D+GG FLW D    + SS++  +P
Sbjct  29   FRPKALVLQVTKDSATHQYYTHITQRTPPVQVKVAIDLGGEFLWVDCEKGFNSSTKKPVP  88

Query  323  CGSLKSSMANPKGCTSN-----EICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSF  487
            C S + ++A  K C++N     ++C     NP    + SG L +D I ++  +    G  
Sbjct  89   CRSAQCNLAKSKACSTNGNPSEDVCGEFPHNPFISTSTSGDLSQDIIYIQSTNGSRPGKV  148

Query  488  LSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +S VP F+F+  P+FL +GL +G  GV  LG ++I+LPS  +  F
Sbjct  149  VS-VPKFIFTCAPTFLLKGLTSGAVGVAGLGRNKIALPSLFSAAF  192



>ref|XP_011015096.1| PREDICTED: basic 7S globulin-like isoform X1 [Populus euphratica]
Length=439

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 95/177 (54%), Gaps = 16/177 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            SL++  F P+A+V+ VSKD  + QYV  +     L P+KL +D+GG F W D    + SS
Sbjct  21   SLSKTSFRPKALVLPVSKDASSLQYVTLINQRTPLVPVKLTLDLGGQFQWVDCEEGYVSS  80

Query  305  SQGSIPCGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIA  451
            S   + C S + ++A  K C +           N  C +  +N V+  A SG + +D ++
Sbjct  81   SYKPVRCRSAQCALARSKSCVTECYSGPRPGCNNNTCSVLPDNTVTSTATSGEVGQDVVS  140

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  D  N G  +S V   +F+   +   +GL +GVNG+   G ++ISLPSQL+  F
Sbjct  141  IQSTDGSNPGRVVS-VKKLIFACSGTRFLEGLASGVNGMAGFGRTKISLPSQLSAAF  196



>ref|XP_003590668.1| Basic 7S globulin [Medicago truncatula]
 gb|AES60919.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=434

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 101/177 (57%), Gaps = 16/177 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTS-QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  301
            + +++ F P+A+V+ V+KD  T+ QY AQ+     L PL ++VD+GG FLW D    + S
Sbjct  22   TFSKQSFRPKALVLPVTKDVATTNQYKAQINQRTPLVPLNIIVDLGGLFLWVDCENQYIS  81

Query  302  SSQGSIPCGSLKSSMA----------NPKGCTSNEICELQFENPVSKMAGSGVLKEDTIA  451
            S+     C S + S+A          +PK   +N  C +   N V++ A SG L ED ++
Sbjct  82   STYRPARCRSAQCSLAKFDDCGVCFSSPKPGCNNNTCSVAPGNSVTQSAMSGELAEDILS  141

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  +  N G  +  V  FLFS   +FL +GL +G +G+  LG ++++LPSQLA+ F
Sbjct  142  IQSSNGFNPGQNV-MVSRFLFSCARTFLLEGLASGASGMAGLGRNKLALPSQLASAF  197



>gb|KDO74796.1| hypothetical protein CISIN_1g038219mg [Citrus sinensis]
Length=435

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 95/184 (52%), Gaps = 21/184 (11%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            T S++     P+A+ + VSKD  T QY+ Q++    L P+KL +D+GG FLW D    + 
Sbjct  21   TTSISNTSSKPKALALLVSKDSSTLQYLTQIKQRTPLVPVKLTLDLGGQFLWVDCDQGYV  80

Query  299  SSSQGSIPCGSLKSSMANPKGC-----------TSNEICELQFENPVSKMA-GSGVLKED  442
            S+S     CGS +  +A  K C            +N  C     N +S+ +   G L  D
Sbjct  81   STSYKPARCGSAQCKLARSKSCIDEYSCSPGPGCNNHTCSRFPANSISRESTNRGELATD  140

Query  443  TIAVELIDEPNA----GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQL  610
             ++++ ID        G F+S VPN +FS  P+FL  GL  GV G+  LG +++SLPSQ 
Sbjct  141  VVSIQSIDIDGKANPPGQFVS-VPNLIFSCGPTFLLDGLATGVKGMAGLGRTQVSLPSQF  199

Query  611  ANTF  622
            +  F
Sbjct  200  SAAF  203



>ref|XP_006489308.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=429

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 93/173 (54%), Gaps = 15/173 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S A+  F P+A+V+ V+KD  T QY+ Q+Q    L P+KL +D+GG FLW +    + SS
Sbjct  21   SEAKTSFKPKALVVPVTKDSSTLQYLTQIQQRTPLVPVKLTLDLGGGFLWVNCEQGFVSS  80

Query  305  SQGSIPCGSLKSSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIAV  454
            S     CGS +  +A  + C           +N  C     N VS ++  G L  D +++
Sbjct  81   SYKPARCGSAQCKIAGSESCVESCLPKGPGCNNNTCTHFPGNTVSHVSTFGELATDVVSI  140

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLA  613
            +  D    G  +  VPN +F+   +FL +GL +G  G+  LG +++SLPSQL+
Sbjct  141  QSTDGSKPGQVVP-VPNIIFACGATFLLEGLASGFQGMAGLGRNKVSLPSQLS  192



>gb|KDO74797.1| hypothetical protein CISIN_1g044303mg [Citrus sinensis]
Length=428

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 93/173 (54%), Gaps = 15/173 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S A+  F P+A+V+ V+KD  T QY+ Q+Q    L P+KL +D+GG FLW +    + SS
Sbjct  21   SEAKTSFKPKALVVPVTKDSSTLQYLTQIQQRTPLVPVKLTLDLGGGFLWVNCEQGFVSS  80

Query  305  SQGSIPCGSLKSSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIAV  454
            S     CGS +  +A  + C           +N  C     N VS ++  G L  D +++
Sbjct  81   SYKPARCGSAQCKIAGSESCVESCLPKGPGCNNNTCTHFPGNTVSHVSTFGELATDVVSI  140

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLA  613
            +  D    G  +  VPN +F+   +FL +GL +G  G+  LG +++SLPSQL+
Sbjct  141  QSTDGSKPGQVVP-VPNIIFACGATFLLEGLASGFQGMAGLGRNKVSLPSQLS  192



>ref|XP_004134152.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 ref|XP_004170541.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN57019.1| hypothetical protein Csa_3G149990 [Cucumis sativus]
Length=429

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 92/178 (52%), Gaps = 16/178 (9%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            +IS+A   F PR++V+ V+K  P+ QY+ Q+     L P+ L VD+GG  +W D    + 
Sbjct  19   SISIASTSFTPRSLVLPVTKH-PSLQYIIQIHQRTPLVPVNLTVDLGGWLMWVDCDRGFV  77

Query  299  SSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  448
            SSS     C S + S+A    C           +N  C L   N + +++  G +  D +
Sbjct  78   SSSYKPARCRSAQCSLAKSISCGKCYLPPHPGCNNYTCSLSARNTIIQLSSGGEVTSDLV  137

Query  449  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +V   +  N+   LS VPNFLF    +FL +GL  GV G+   G +RISLPSQ A  F
Sbjct  138  SVSSTNGFNSTRALS-VPNFLFICSSTFLLEGLAGGVTGMAGFGRTRISLPSQFAAAF  194



>ref|XP_006419827.1| hypothetical protein CICLE_v10005000mg [Citrus clementina]
 ref|XP_006489579.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
 gb|ESR33067.1| hypothetical protein CICLE_v10005000mg [Citrus clementina]
Length=435

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 95/184 (52%), Gaps = 21/184 (11%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            T S++     P+A+ + VSKD  T QY+ Q++    L P+KL +D+GG FLW D    + 
Sbjct  21   TTSISNTSSKPKALALLVSKDSSTLQYLTQIKQRTPLVPVKLTLDLGGQFLWVDCDQGYV  80

Query  299  SSSQGSIPCGSLKSSMANPKGC-----------TSNEICELQFENPVSKMA-GSGVLKED  442
            S+S     CGS +  +A  K C            +N  C     N +S+ +   G L  D
Sbjct  81   STSYKPARCGSAQCKLARSKSCIDEYSCSPGPGCNNHTCSRFPANSISRESTNRGELATD  140

Query  443  TIAVELIDEPNA----GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQL  610
             ++++ ID        G F+S VPN +FS  P+FL  GL  GV G+  LG +++SLPSQ 
Sbjct  141  VVSIQSIDIDGKANPPGPFVS-VPNLIFSCGPTFLLDGLATGVKGMAGLGRTQVSLPSQF  199

Query  611  ANTF  622
            +  F
Sbjct  200  SAAF  203



>gb|KHN30567.1| Basic 7S globulin [Glycine soja]
Length=438

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 93/169 (55%), Gaps = 8/169 (5%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTS--QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            S+AQ  F P+A+V+ V+KD   S  QYV Q++    L P+KL VD+GG + W +    + 
Sbjct  20   SIAQPSFRPKALVLPVTKDVSASVPQYVTQIKQRTPLVPVKLTVDLGGGYFWVNCEKGYV  79

Query  299  SSSQGSIPCGSLKSSMANPKGCT-SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            SS+     CGS + S+    GC   ++IC     N V+ ++  G +  D +A+   D  N
Sbjct  80   SSTSKPARCGSAQCSLFGLYGCNVEDKICSRSLSNTVTGVSTFGEIHADVVAINATDGNN  139

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
                +S VP FLF    + +  GL +GV G+  LG +++SLPSQ ++ F
Sbjct  140  PVRVVS-VPKFLFICGANVVQNGLASGVTGMAGLGRTKVSLPSQFSSAF  187



>ref|XP_003556387.1| PREDICTED: basic 7S globulin [Glycine max]
 gb|KHN05060.1| Basic 7S globulin [Glycine soja]
Length=438

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 93/167 (56%), Gaps = 8/167 (5%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTS--QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            AQ  F P+A+V+ V+KD   S  QYV Q++    L  +KL VD+GG +LW +    + SS
Sbjct  22   AQTSFRPKALVLPVTKDVSASVPQYVTQIKQRTPLVAVKLTVDLGGGYLWVNCEKGYVSS  81

Query  305  SQGSIPCGSLKSSMANPKGC-TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAG  481
            +     CGS + S+    GC T ++IC     N V+ ++  G +  D +AV   D  N  
Sbjct  82   TSRPARCGSAQCSLFGLYGCSTEDKICGRSPSNTVTGVSTYGDIHADVVAVNSTDGNNPT  141

Query  482  SFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
              +S VP FLF    + + +GL +GV G+  LG +++SLPSQ A+ F
Sbjct  142  KVVS-VPKFLFICGSNVVQKGLASGVTGMAGLGRTKVSLPSQFASAF  187



>ref|XP_004298169.1| PREDICTED: basic 7S globulin-like [Fragaria vesca subsp. vesca]
Length=414

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 86/161 (53%), Gaps = 9/161 (6%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW-----ADWASSSQGSIPC  325
            P+  +  V+KD  T QYV Q+  G  L P  LV+D+GGP LW        +SSS+  IP 
Sbjct  30   PKGAISHVTKDISTLQYVIQIHHGTPLHPTNLVIDLGGPSLWLGCSSDSGSSSSKTLIPQ  89

Query  326  GSLKSSMANPKGCTSNEI-CELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVP  502
             S+K   ANP    S    CE   +N V+ MA  G L +D IA+ ++D        SH  
Sbjct  90   SSIKCLSANPNTQNSKSTKCETFPQNRVTLMATLGDLAQDIIALPVVDGSETEPITSH--  147

Query  503  NFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
             FLFS  P  L +GL  G  G+L LG +R+S+ SQ+A  FG
Sbjct  148  -FLFSCAPKLLLKGLATGARGMLGLGRTRVSVASQIAAAFG  187



>ref|XP_003536212.1| PREDICTED: basic 7S globulin-like [Glycine max]
Length=444

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 93/169 (55%), Gaps = 8/169 (5%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTS--QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            S+AQ  F P+A+V+ V+KD   S  QYV Q++    L P+KL VD+GG + W +    + 
Sbjct  26   SIAQPSFRPKALVLPVTKDVSASVPQYVTQIKQRTPLVPVKLTVDLGGGYFWVNCEKGYV  85

Query  299  SSSQGSIPCGSLKSSMANPKGCT-SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            SS+     CGS + S+    GC   ++IC     N V+ ++  G +  D +A+   D  N
Sbjct  86   SSTSKPARCGSAQCSLFGLYGCNVEDKICSRSLSNTVTGVSTFGEIHADVVAINATDGNN  145

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
                +S VP FLF    + +  GL +GV G+  LG +++SLPSQ ++ F
Sbjct  146  PVRVVS-VPKFLFICGANVVQNGLASGVTGMAGLGRTKVSLPSQFSSAF  193



>ref|XP_004229432.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=441

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 91/178 (51%), Gaps = 17/178 (10%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            A+ P  PRA ++ V+KD  T Q+V  +     L P+KL +D+G  FLW D    + SSS 
Sbjct  23   AKTPPRPRAFLLPVTKDASTKQFVTTINQRTPLVPVKLTIDLGQRFLWVDCEKGYVSSSY  82

Query  311  GSIPCGSL-----------KSSMANPK-GCTSNEICELQFENPVSKMAGSGVLKEDTIAV  454
              +PCGS+           +S +  P  GC +N    + + NP  + +  G L +D +++
Sbjct  83   KPVPCGSIPCKRSFSGACVESCIGPPSPGCNNNTCSHIPY-NPFIRTSTGGELAQDVVSL  141

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
            +  D  N   +LS     +F   P  L +GL  GV G+L LGN  +  P+QLAN F I
Sbjct  142  QSTDGSNPRKYLSTTNGVVFDCAPHSLLEGLAKGVRGILGLGNGYVGFPTQLANAFSI  199



>ref|XP_009591595.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=440

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 94/178 (53%), Gaps = 18/178 (10%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            A+ P  PRA  + V+KD  T QYV  ++    L P+KL VD+G  F+W D    + SS+ 
Sbjct  23   AKTPPRPRAFFLPVTKDAATKQYVTVIRQRTPLVPIKLTVDLGQRFMWVDCENGYVSSTY  82

Query  311  GSIPCGSL--KSSMANP----------KGCTSNEICELQFENPVSKMAGSGVLKEDTIAV  454
              +PCGS+  K S++             GC +N    + + NP  + +  G L ED +++
Sbjct  83   KPVPCGSIPCKRSLSGACVESCLDPPSPGCNNNTCSHIPY-NPFIRTSTGGELAEDIVSL  141

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
            +  D  N G+F+S  P  +F   P  L +GL  GV G++ LGN  +  P+Q++N F +
Sbjct  142  QSTDGSNPGNFISK-PGVVFDCAPKSLLEGLAKGVKGIIGLGNGFVGFPTQMSNAFRV  198



>ref|XP_008649625.1| PREDICTED: basic 7S globulin-like [Zea mays]
 gb|AFW77950.1| hypothetical protein ZEAMMB73_390094 [Zea mays]
Length=438

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 89/169 (53%), Gaps = 16/169 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P A+++ VSKD  T QYV   +    L P+K V+D+ G  LW D    +AS++   +PCG
Sbjct  34   PSAVLLPVSKDGATQQYVTGFRQRTPLVPVKAVLDLAGATLWVDCEAGYASATYSRVPCG  93

Query  329  SLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            S    ++    C +           N+ C    EN V++++ SG +  D +A+     P 
Sbjct  94   SSLCRLSRSAACATSCSGAPSPSCLNDTCGGFPENTVTQVSTSGNVITDVLALPTTFRPA  153

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             G  L+  P FLF+   +FL QGL  G  G+ +L  SR +LP+QLA+TF
Sbjct  154  PGP-LATAPAFLFTCGATFLTQGLAAGAAGMASLSRSRFALPTQLASTF  201



>gb|KDO74798.1| hypothetical protein CISIN_1g029782mg [Citrus sinensis]
Length=188

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 90/166 (54%), Gaps = 6/166 (4%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            ++AQ  F P+A+V+ V K+    QYV Q++    L P+KLVV +GG  LW D    + SS
Sbjct  20   AIAQTSFRPKALVLPVLKNAAVFQYVTQIKQRTPLVPVKLVVHLGGNLLWVDCEKGYVSS  79

Query  305  SQGSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGS  484
            +  +  CGS +  +     C   +  +    NP+S     G ++ D ++V+  +  N G 
Sbjct  80   TNKTARCGSAQCHLIGLVACGGGKCGDFP-NNPISNTGTIGDIRIDVVSVQSTNGRNPGR  138

Query  485  FLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             ++ VPNF+F     F+ +GL  GV G+ ALG ++ +LP QLA  F
Sbjct  139  GVT-VPNFIFLCGSEFVLRGLAPGVTGIAALGRTKTALPLQLAAAF  183



>ref|XP_011011196.1| PREDICTED: basic 7S globulin-like isoform X1 [Populus euphratica]
Length=439

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 94/177 (53%), Gaps = 16/177 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            SL++  F P+A+V+ VSKD  + QYV  +     L P+KL +D+GG F W D    + SS
Sbjct  21   SLSKTSFRPKALVLPVSKDASSLQYVTLINQRTPLVPVKLTLDLGGQFQWVDSEEGYVSS  80

Query  305  SQGSIPCGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIA  451
            S   + C S + ++A  K C +           N  C +  +N V+  A SG + +D ++
Sbjct  81   SYKPVRCRSAQCALARSKSCVTECYSGPRPGCNNNTCSVLPDNTVTSTATSGEVGQDVVS  140

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  D  N G  +S V   +F+   +   +GL +GVNG+   G ++ISLPSQ +  F
Sbjct  141  IQSTDGSNPGRVVS-VKKLIFACSGTRFLEGLASGVNGMAGFGRTKISLPSQFSAAF  196



>gb|AES60912.2| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=451

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 89/168 (53%), Gaps = 15/168 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTS-QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPC  325
            P+ +   V+KD  T+ QY+AQ+     L PL LVVD+GG FLW D    + SS+   + C
Sbjct  40   PKHLFSPVTKDSATTLQYIAQINQRTPLVPLNLVVDLGGKFLWVDCENHYTSSTYRPVRC  99

Query  326  GSLKSSMANPKGCTS---------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
             S + S+A    C           N  C L  +N ++  A  G L ED ++++     N 
Sbjct  100  PSAQCSLAKSDSCGDCFSSPKPGCNNTCGLIPDNTITHSATRGDLAEDVLSIQSTSGFNT  159

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            G  +  V  FLFS  P+ L +GL  G +G+  LG ++I+LPSQLA+ F
Sbjct  160  GQNVV-VSRFLFSCAPTSLLRGLAGGASGMAGLGRTKIALPSQLASAF  206



>ref|XP_003568479.1| PREDICTED: basic 7S globulin-like [Brachypodium distachyon]
Length=441

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 89/171 (52%), Gaps = 18/171 (11%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQ-LQMGYNLAPLKLVVDVGGPFLWAD-----WASSSQGSIP  322
            P A+V+AV KD  T QYVA   +     AP+  V+D+GG  LW D     +ASSS   +P
Sbjct  33   PSAVVLAVQKDDATGQYVAGGFRQRTPQAPVTAVLDLGGATLWVDCDPGQYASSSYARVP  92

Query  323  CGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDE  469
            C S    +A    C +           N+ C    EN V+++  SG L  D +++     
Sbjct  93   CASKPCRLARTSACATSCVGAPSPGCLNDTCGGFPENTVTRLRTSGNLITDVLSLPTTFR  152

Query  470  PNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            P  G  L+  P FLF+   +FL +GL +G  G+ +L  +R +LP+QLA+TF
Sbjct  153  PAPGP-LATAPAFLFACGATFLTKGLASGAAGMASLSRARFALPTQLADTF  202



>ref|XP_010938774.1| PREDICTED: basic 7S globulin-like [Elaeis guineensis]
Length=431

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 87/168 (52%), Gaps = 15/168 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P A+V+ V+KD  T QYV ++        +KLVVD+GG FLW D    + SSS   + C 
Sbjct  25   PHALVVPVAKDAATLQYVTRVDQRTPPVLVKLVVDLGGRFLWVDCENGYHSSSYRPVRCR  84

Query  329  SLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
            S + S+A    C           +N  C +  ENP  + +  G L ED +++   D  N 
Sbjct  85   SARCSLAMANACGDCFSAPRPGCNNNTCGVFPENPFIRTSTGGELAEDVLSLPSTDGFNP  144

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            G  L+    FLFS  P+ L +GL  G  G+  LG ++I +PSQLA TF
Sbjct  145  GP-LATDRTFLFSCAPTSLLEGLAIGAAGMAGLGRTKIGVPSQLAATF  191



>ref|XP_004229434.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=437

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 89/177 (50%), Gaps = 15/177 (8%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            A+ P  PRA ++ ++KD  T Q++  +     L P KL +D+G  FLW D    + SSS 
Sbjct  23   AKTPSKPRAFLLPITKDEATKQFITTIYQRIPLVPAKLTIDLGQRFLWVDCDIGYVSSSY  82

Query  311  GSIPCGSL-----------KSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVE  457
              +PCGS+           +S + +P    +N  C     NP  + + SG L +D ++++
Sbjct  83   KPVPCGSIPCKRSFSGACVESCVGSPSPGCNNNTCGQSIYNPFIRTSTSGELAQDVVSLQ  142

Query  458  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
              D      +LS     +F    +FL + L  GVNG+L LGN  +  P+QLAN F I
Sbjct  143  STDGSKPRKYLSTTNGVVFGCGSTFLLEKLAKGVNGILGLGNGYVGFPTQLANAFTI  199



>ref|XP_003590661.1| Basic 7S globulin [Medicago truncatula]
Length=500

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 89/168 (53%), Gaps = 15/168 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTS-QYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPC  325
            P+ +   V+KD  T+ QY+AQ+     L PL LVVD+GG FLW D    + SS+   + C
Sbjct  32   PKHLFSPVTKDSATTLQYIAQINQRTPLVPLNLVVDLGGKFLWVDCENHYTSSTYRPVRC  91

Query  326  GSLKSSMANPKGCTS---------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
             S + S+A    C           N  C L  +N ++  A  G L ED ++++     N 
Sbjct  92   PSAQCSLAKSDSCGDCFSSPKPGCNNTCGLIPDNTITHSATRGDLAEDVLSIQSTSGFNT  151

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            G  +  V  FLFS  P+ L +GL  G +G+  LG ++I+LPSQLA+ F
Sbjct  152  GQNVV-VSRFLFSCAPTSLLRGLAGGASGMAGLGRTKIALPSQLASAF  198



>ref|XP_006380060.1| hypothetical protein POPTR_0008s20740g [Populus trichocarpa]
 gb|ERP57857.1| hypothetical protein POPTR_0008s20740g [Populus trichocarpa]
Length=439

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 94/179 (53%), Gaps = 16/179 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            SL++  F P+A+V+ VSKD  + QYV  +     L P+KL +D+GG F W D    + SS
Sbjct  21   SLSKTSFRPKALVLPVSKDASSLQYVTLMNQRTPLVPVKLTLDLGGQFQWVDCEEGYVSS  80

Query  305  SQGSIPCGSLKSSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIA  451
            S   + C S + ++A  K C            +N  C +  +N V+  A SG + +D ++
Sbjct  81   SYKPVRCRSAQCALARSKSCVNECYSSPRPGCNNNTCSVLPDNTVTSTATSGDVGQDAVS  140

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
            ++  D  N G  ++ V   +F+   +   +GL NGV G+   G ++ISLPSQ +  F +
Sbjct  141  IQSTDGSNPGR-VASVNKLIFACSETRFLEGLANGVKGMAGFGRTKISLPSQFSAAFSL  198



>ref|XP_002517171.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45334.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=437

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 89/178 (50%), Gaps = 16/178 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S A+ PF P+A+++ V KD  T QY+ Q+     L P+KL VD+GG  +W +    + SS
Sbjct  21   STARAPFRPKALLLPVFKDKCTRQYITQIDQRTPLVPVKLTVDLGGSLMWINCEEGYVSS  80

Query  305  SQGSIPCGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIA  451
            S   + C S   S++N + C             N  C     N V  +   G L +D +A
Sbjct  81   SYRPLSCDSALCSLSNSQSCNKECYSSPKPGCYNNTCGQSSNNRVVYIGTGGDLGQDVVA  140

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
            ++  D  N G  +S VPNF F    ++L   L +GV G+  LG S ISLP+  ++  G
Sbjct  141  LQSFDGKNLGRIVS-VPNFPFVCGITWLLDDLADGVTGMAGLGRSNISLPAYFSSAIG  197



>ref|XP_006850763.1| hypothetical protein AMTR_s00025p00079140 [Amborella trichopoda]
 gb|ERN12344.1| hypothetical protein AMTR_s00025p00079140 [Amborella trichopoda]
Length=433

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 83/169 (49%), Gaps = 14/169 (8%)
 Frame = +2

Query  155  FFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD---WASSSQGSIPC  325
            F P+A+V  + KD  T QY   L +  +L   +L   +GG FLW D   + SS+   + C
Sbjct  28   FRPKALVAPIVKDPSTLQYYTNLSLKTHLRSERLAFHLGGSFLWIDCDNYVSSTYRPVRC  87

Query  326  GSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
             S + S A  + C           SN+ C +   NP  + +  G L ED +A+   D   
Sbjct  88   RSAQCSAARSRACGSCFATPRPGCSNDTCGVSPYNPFIRTSTGGDLLEDVLAIRSTDGKT  147

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             G  ++ VP+FLFS  P+FL +GL    +G+   G  +I LP QLA  F
Sbjct  148  QGPQVT-VPHFLFSCAPAFLTEGLTGSASGLAGFGRGKIGLPEQLAAKF  195



>ref|NP_001055496.1| Os05g0402900 [Oryza sativa Japonica Group]
 dbj|BAF17410.1| Os05g0402900 [Oryza sativa Japonica Group]
Length=437

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 87/169 (51%), Gaps = 16/169 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P A+++ VSKD  T QYV   +     APLK V+D+ G  LW D    + SSS   +PCG
Sbjct  34   PSAVLLPVSKDDATQQYVTMFRQRTPQAPLKAVLDLAGATLWVDCEAGYVSSSYARVPCG  93

Query  329  SLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            S +  +A    C +           N+ C    EN V+ ++ SG +  D +++     P 
Sbjct  94   SKQCRLAKTNACATSCDGAPSPACLNDTCGGFPENTVTHVSTSGNVITDVLSLPTTFRPA  153

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             G  L+  P FLF+   +FL +GL  G  G+++L  +R + P+QLA TF
Sbjct  154  PGP-LATAPAFLFTCGATFLTEGLAAGATGMVSLSRARFAFPTQLAATF  201



>ref|XP_010556788.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=464

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 90/176 (51%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            + AQ  F P+A+V+  +KD  T QYVA +     L P+K+VVD+GG F+W +    + SS
Sbjct  55   TFAQISFRPKALVLPTAKDASTLQYVATINQRTPLVPVKVVVDLGGQFMWVNCDKGYVSS  114

Query  305  SQGSIPCGSLKSSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAV  454
            S  ++ C S   S+A+   C S          N+ C     N  +     G L +D  ++
Sbjct  115  SYRTVRCRSAACSLAHSSTCASCFAGPKPGCNNDTCSAFPGNTAAHTNTIGELAQDVFSI  174

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
               +  N G  ++ VP F+F    +FL +GL  G  G+  LG ++I+LPSQ A  F
Sbjct  175  NSTNGSNPGRAVT-VPRFVFVCGTTFLVEGLAKGAVGMAGLGRTKIALPSQFAAAF  229



>ref|XP_004495384.1| PREDICTED: basic 7S globulin-like [Cicer arietinum]
Length=443

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 70/131 (53%), Gaps = 8/131 (6%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDF--PTSQYVAQLQMGYNLAPLKLVVDVGGPFLW-----ADWAS  301
            AQ    P+A+V+ ++KD    T QYV Q++    L P+KL +D+GG +LW      ++ S
Sbjct  27   AQTSLRPKALVLPITKDISSTTPQYVTQIKQRTPLVPIKLTIDLGGGYLWVNCEKGNYVS  86

Query  302  SSQGSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAG  481
            S+     C S + S+    GC S  IC     N ++ ++  G +  D ++V+  D  N G
Sbjct  87   STSKPTLCTSSQCSLFASHGCNSENICARSPTNTITGVSSYGDIHSDIVSVQSTDGNNPG  146

Query  482  SFLSHVPNFLF  514
              +S VPNFLF
Sbjct  147  RVVS-VPNFLF  156



>ref|XP_009590387.1| PREDICTED: basic 7S globulin 2-like [Nicotiana tomentosiformis]
Length=300

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 89/170 (52%), Gaps = 15/170 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            PRA+++ V+KD  T QYV  ++    L P+KL VD+G  FLW D    + SSS  S+ C 
Sbjct  59   PRALLLRVTKDAATKQYVTVIRQRTPLVPIKLTVDLGQRFLWVDCEKGYVSSSVKSVLCD  118

Query  329  SLKSSMANPKGCTSNEICELQFE----------NPVSKMAGSGVLKEDTIAVELIDEPNA  478
            S   +++    C+ N  C    E          N +++      LK+D I+++  D   +
Sbjct  119  STPCNLSRSGMCSGNCSCSSIREPGCTCSHLPYNHITRTNTGCELKDDVISLQSTDGSTS  178

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
            G  +S   N +F  V +FL +GL  G+ G+ ALGN  + LP+QLA  F I
Sbjct  179  GPIVSS-SNLVFDCVAAFLLEGLAKGIEGIAALGNGFVGLPTQLATAFKI  227



>gb|EAY97992.1| hypothetical protein OsI_19909 [Oryza sativa Indica Group]
Length=437

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 87/169 (51%), Gaps = 16/169 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P A+++ VSKD  T QYV   +     AP+K V+D+ G  LW D    + SSS   +PCG
Sbjct  34   PSAVLLPVSKDDATQQYVTMFRQRTPQAPVKAVLDLAGATLWVDCEAGYVSSSYARVPCG  93

Query  329  SLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            S +  +A    C +           N+ C    EN V+ ++ SG +  D +++     P 
Sbjct  94   SKQCRLAKTNACATSCDGAPSPACLNDTCGGFPENTVTHVSTSGNIITDVLSLPTTFRPA  153

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             G  L+  P FLF+   +FL +GL  G  G+++L  +R + P+QLA TF
Sbjct  154  PGP-LATAPAFLFTCGATFLTEGLAAGATGMVSLSRARFAFPTQLAATF  201



>gb|KFK42683.1| hypothetical protein AALP_AA1G026300 [Arabis alpina]
Length=1016

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 56/174 (32%), Positives = 83/174 (48%), Gaps = 15/174 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQ  310
            A+ PF PRA+++ VSKD  T QY   +     L    +V D+GG  LW     D+ S++ 
Sbjct  25   AESPFRPRALILPVSKDKSTLQYTTVINQRTPLVSASVVFDLGGRNLWVECDKDYVSTTY  84

Query  311  GSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  460
             S  C S   S A P+GC           +N  C    +N V+    SG +  D ++++ 
Sbjct  85   NSPRCNSAVCSRAGPRGCGQCFSPLRPGCNNNTCNSFPDNTVTGTITSGEIALDVVSIQS  144

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            I+    G  +  +PNF+F    +FL   L +G  G+  +G   I LPSQ A  F
Sbjct  145  INGSKPGRVVK-IPNFIFVCGSTFLLNRLASGTVGMAGIGRHNIGLPSQFATAF  197



>ref|XP_010522709.1| PREDICTED: basic 7S globulin-like [Tarenaya hassleriana]
Length=418

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 89/176 (51%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASS  304
            + AQ+ F P+A+V+ V+KD  T QYVA +     L P+KLVVD+GG F W      + SS
Sbjct  20   TFAQQSFRPKALVLPVTKDASTLQYVATINQRTPLVPVKLVVDLGGQFQWVVCDKGYVSS  79

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            +     C S   S+A    C           +N  C     N ++ +  SG L +D +++
Sbjct  80   TYRPARCRSAVCSLARSTSCGDCFSAPRPGCNNNTCGAFPANTITPIVTSGELAQDVVSI  139

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            E  D  N G  ++ +P F F    +FL  GL NG  G+  LG + I+LP+Q +  F
Sbjct  140  ESTDGSNPGQIVT-LPRFAFVCGSTFLLDGLANGAVGMAGLGRTNIALPAQFSAAF  194



>ref|XP_006419811.1| hypothetical protein CICLE_v10004995mg [Citrus clementina]
 gb|ESR33051.1| hypothetical protein CICLE_v10004995mg [Citrus clementina]
Length=437

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 91/176 (52%), Gaps = 16/176 (9%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSS  307
            +AQ  F P+A+++ V+KD  T QY+ Q+     L P+K  +D+GG FLW     D+ SSS
Sbjct  23   IAQTSFRPKALILPVTKDASTLQYLTQINQRTPLVPVKYTLDLGGQFLWVVCLEDYESSS  82

Query  308  QGSIPCGSLKSSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAV  454
              S PC S   S+AN           P+   +N  C L  +N ++ ++ +G L  D  ++
Sbjct  83   FTSPPCHSAPCSLANAPFCWDCSDSQPRPGCNNNTCNLLPDNTINGISFNGPLSMDVASI  142

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  +  N G  +S VP  LF     F    L NGV G+  LG + ISLPS  ++ F
Sbjct  143  QSTNGKNPGRVVS-VPKLLFVCADRFHLTDLANGVRGMAGLGRNSISLPSLFSSAF  197



>ref|XP_006419809.1| hypothetical protein CICLE_v10004993mg [Citrus clementina]
 gb|ESR33049.1| hypothetical protein CICLE_v10004993mg [Citrus clementina]
Length=437

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 91/176 (52%), Gaps = 16/176 (9%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSS  307
            +AQ  F P+A+++ V+KD  T QY+ Q+     L P+K  +D+GG FLW     D+ SSS
Sbjct  23   IAQTSFRPKALILPVTKDASTLQYLTQINQRTPLVPVKYTLDLGGQFLWVVCLEDYESSS  82

Query  308  QGSIPCGSLKSSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAV  454
              S PC S   S+AN           P+   +N  C L  +N ++ ++ +G L  D  ++
Sbjct  83   FTSPPCHSAPCSLANAPFCWDCSDSQPRPGCNNNTCNLLPDNTINGISFNGPLSMDVASI  142

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  +  N G  +S VP  LF     F    L NGV G+  LG + ISLPS  ++ F
Sbjct  143  QSTNGKNPGRVVS-VPKLLFVCADRFHLTDLANGVRGMAGLGRNSISLPSLFSSAF  197



>ref|XP_006489297.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 91/176 (52%), Gaps = 16/176 (9%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSS  307
            +AQ  F P+A+++ V+KD  T QY+ Q+     L P+K  +D+GG FLW     D+ SSS
Sbjct  23   IAQTSFRPKALILPVTKDASTLQYLTQINQRTPLVPVKYTLDLGGQFLWVVCLEDYESSS  82

Query  308  QGSIPCGSLKSSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAV  454
              S PC S   S+AN           P+   +N  C L  +N ++ ++ +G L  D  ++
Sbjct  83   FTSPPCHSAPCSLANAPFCWDCSDSQPRPGCNNNTCNLLPDNTINGISFNGPLSMDVASI  142

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  +  N G  +S VP  LF     F    L NGV G+  LG + ISLPS  ++ F
Sbjct  143  QSTNGKNPGRVVS-VPKLLFVCADRFHLTDLANGVRGMAGLGRNSISLPSLFSSAF  197



>ref|XP_006654379.1| PREDICTED: basic 7S globulin-like [Oryza brachyantha]
Length=440

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 83/170 (49%), Gaps = 16/170 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P A+V+ VSKD  T QYV   +      P++ V+D+ G  LW D    +ASSS   +PCG
Sbjct  33   PSAVVLPVSKDGATQQYVTVFRQRTPQVPVRAVLDLAGATLWVDCDAGYASSSYARVPCG  92

Query  329  S-----------LKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            S             S    P     N+ C     N V+++   G +  D +++     P 
Sbjct  93   SRPCRLMKYRECFNSCFGEPSPACLNDTCSAFPGNAVTRVTAGGTIITDVLSLPTTFRPA  152

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
             G  L+  P FLF+   ++L +GL  G  G+ +L  +R +LP+QLA TFG
Sbjct  153  PGP-LATAPAFLFTCAHTYLTEGLATGATGMASLSRARFALPTQLAKTFG  201



>ref|XP_006654378.1| PREDICTED: basic 7S globulin-like [Oryza brachyantha]
Length=436

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 86/169 (51%), Gaps = 16/169 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P A+++  SKD  T QYV   +     AP+K V+D+ G  LW D    + SSS   +PCG
Sbjct  33   PPAVLLPASKDDATQQYVTMFRQRTPQAPVKAVLDLAGATLWVDCEAGYVSSSYARVPCG  92

Query  329  SLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            S    +A    C +           N+ C    EN V+ ++ SG +  D +++     P 
Sbjct  93   SKACRLAKSNACATSCDGAPSPACLNDTCGGFPENTVTHVSTSGNIITDVLSLPTTFRPA  152

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             G  L+  P FLF+   +FL +GL  G  G+++L  +R +LP+QLA TF
Sbjct  153  PGP-LATAPAFLFTCGATFLLEGLAAGATGMVSLSRARFALPTQLAATF  200



>ref|XP_004134153.1| PREDICTED: basic 7S globulin-like [Cucumis sativus]
 gb|KGN57018.1| hypothetical protein Csa_3G149980 [Cucumis sativus]
Length=432

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 95/178 (53%), Gaps = 16/178 (9%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            +IS A   F P+++++ V+K  P+ QY+ Q++    L P+KL VD+GG F+W D    + 
Sbjct  17   SISFAATSFRPKSLLLPVTKH-PSGQYITQIRQRTPLVPVKLTVDLGGQFMWVDCDRGYV  75

Query  299  SSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  448
            SSS   + C S + S++    C           +N  C     N + +++ SG +  D +
Sbjct  76   SSSYKPVRCRSAQCSLSKSTSCGDCFSPPRPGCNNNTCGHFPGNTIIQLSTSGEVTSDVL  135

Query  449  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +V   +  N    +S +PNFLF   P+FL +GL  GV+G+   G + ISLPSQ +  F
Sbjct  136  SVSSTNGFNPTRAVS-IPNFLFVCGPTFLLEGLAGGVSGMAGFGRTGISLPSQFSAAF  192



>ref|XP_006489306.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=394

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 93/168 (55%), Gaps = 18/168 (11%)
 Frame = +2

Query  164  RAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQG----------  313
             +I I V KD  T QYVA++  G +  P+ LV+D+GGP  W D  SS+            
Sbjct  23   NSIAIPVVKDASTLQYVAKIHHGVSQVPINLVLDLGGPLTWVDCDSSADVSSSSSRRLIP  82

Query  314  --SIPCG-SLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVE-LIDEPNAG  481
              SI C  S KS +      T+   C +  +N +S +A +G L EDTIAV   +++P+  
Sbjct  83   SQSIQCSRSGKSPVPRNGSDTTTNTCGVFTQNGISGLATTGDLAEDTIAVRSELEDPS--  140

Query  482  SFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
              ++ V  FLFS  P+FL QGL +GV G+L LG + ISLPSQLA   G
Sbjct  141  --ITAVDEFLFSCAPTFLLQGLASGVRGMLGLGRAPISLPSQLATGIG  186



>ref|XP_004170542.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Cucumis 
sativus]
Length=432

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 95/178 (53%), Gaps = 16/178 (9%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            +IS A   F P+++++ V+K  P+ QY+ Q++    L P+KL VD+GG F+W D    + 
Sbjct  17   SISFAATSFRPKSLLLPVTKH-PSGQYITQIRQRTPLVPVKLTVDLGGQFMWVDCDRGYV  75

Query  299  SSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  448
            SSS   + C S + S++    C           +N  C     N + +++ SG +  D +
Sbjct  76   SSSYKPVRCRSAQCSLSKSTSCGDCFSPPXPGCNNNTCGHFPGNTIIQLSTSGEVTSDVL  135

Query  449  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +V   +  N    +S +PNFLF   P+FL +GL  GV+G+   G + ISLPSQ +  F
Sbjct  136  SVSSTNGFNPTRAVS-IPNFLFVCGPTFLLEGLAGGVSGMAGFGRTGISLPSQFSAAF  192



>gb|EAZ44805.1| hypothetical protein OsJ_29439 [Oryza sativa Japonica Group]
Length=453

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 85/183 (46%), Gaps = 23/183 (13%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDV-GGPFLWAD------WAS  301
             QRP  P+A+ + V +D  T QYVA  Q       +K VVD+ GG  LW D      +AS
Sbjct  34   GQRPTRPKAVAMPVVRDGATRQYVATFQQRTPRVAVKAVVDLSGGATLWVDCDAAAGYAS  93

Query  302  SSQGSIPCGSLKSSMANPKGCTS--------------NEICELQFENPVSKMAGSGVLKE  439
            SS   +PCGS    +     C+               N  C    EN V+   G G +  
Sbjct  94   SSYAGVPCGSKPCRLVESPSCSYIASCLGSPPSPACLNRTCTGHAENTVTSSVGRGNVVT  153

Query  440  DTIAVELI--DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLA  613
            D +++       P     L+  P FLF+  P+ L QGL  G  G+ +L  +R++LP+QLA
Sbjct  154  DVLSLPTTFPSAPVRQGPLATAPAFLFTCGPTSLTQGLAAGAAGMASLSRARLALPAQLA  213

Query  614  NTF  622
             TF
Sbjct  214  GTF  216



>emb|CDP10858.1| unnamed protein product [Coffea canephora]
Length=438

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 88/174 (51%), Gaps = 15/174 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            AQ  F P A+V+ V KD  T QYV ++        L +V+D+GG FLW D    + SS+ 
Sbjct  24   AQSSFRPPALVLPVRKDASTLQYVTKINQRTPSVSLNVVLDLGGQFLWVDCDKNYISSTY  83

Query  311  GSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  460
              + C S + S+A   GC           +   C +  +N V+  A  G + +D++    
Sbjct  84   RPVRCRSAQCSLAGNDGCGNCTNGPKPGCNTNTCVVFPDNTVTHTATGGEVAQDSLTAAS  143

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             D  N G  ++ VP F+F    +FL +GL +G  G+  LG +RI LPSQL+  F
Sbjct  144  TDGSNPGRSVT-VPQFIFGCGSTFLLKGLASGTVGMAGLGRARIGLPSQLSAAF  196



>dbj|BAD33624.1| putative dermal glycoprotein precursor, extracellular [Oryza 
sativa Japonica Group]
 dbj|BAD34099.1| putative dermal glycoprotein precursor, extracellular [Oryza 
sativa Japonica Group]
Length=444

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 85/182 (47%), Gaps = 23/182 (13%)
 Frame = +2

Query  146  QRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDV-GGPFLWAD------WASS  304
            QRP  P+A+ + V +D  T QYVA  Q       +K VVD+ GG  LW D      +ASS
Sbjct  35   QRPTRPKAVAMPVVRDGATRQYVATFQQRTPRVAVKAVVDLSGGATLWVDCDAAAGYASS  94

Query  305  SQGSIPCGSLKSSMANPKGCTS--------------NEICELQFENPVSKMAGSGVLKED  442
            S   +PCGS    +     C+               N  C    EN V+   G G +  D
Sbjct  95   SYAGVPCGSKPCRLVESPSCSYIASCLGSPPSPACLNRTCTGHAENTVTSSVGRGNVVTD  154

Query  443  TIAVELI--DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLAN  616
             +++       P     L+  P FLF+  P+ L QGL  G  G+ +L  +R++LP+QLA 
Sbjct  155  VLSLPTTFPSAPVRQGPLATAPAFLFTCGPTSLTQGLAAGAAGMASLSRARLALPAQLAG  214

Query  617  TF  622
            TF
Sbjct  215  TF  216



>ref|XP_008810759.1| PREDICTED: basic 7S globulin-like [Phoenix dactylifera]
Length=431

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 96/177 (54%), Gaps = 18/177 (10%)
 Frame = +2

Query  134  ISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WAS  301
            IS AQRP    A+V  V+KD  T QYV ++     L  LKLVVD+GG FLW D    + S
Sbjct  19   ISSAQRP---HALVAPVAKDAATLQYVTRVSQRTPLVLLKLVVDLGGRFLWVDCDNGYTS  75

Query  302  SSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  451
            S+   + C S + S+A   GC           +N  C +  ENP  + +  G L ED ++
Sbjct  76   STYRPVRCRSAQCSLAMANGCGDCFSAPRPGCNNNTCGVSPENPFIRTSTGGELAEDVLS  135

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +   D  N G  L+  P+FLFS  P+ L +GL +G  G+  LG ++I LP+QLA TF
Sbjct  136  LPSTDGSNPGP-LATDPSFLFSCAPTSLLEGLASGATGMAGLGRTKIGLPTQLAATF  191



>ref|XP_009411762.1| PREDICTED: basic 7S globulin-like [Musa acuminata subsp. malaccensis]
Length=434

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 89/171 (52%), Gaps = 21/171 (12%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAP---LKLVVDVGGPFLWAD----WASSSQGSI  319
            P A+V+ V KD  T QYV ++   Y   P   L+LVVD+GG +LW D    + SS+    
Sbjct  26   PHALVLPVKKDAATLQYVTRV---YQRTPPVLLELVVDLGGRYLWVDCDAGYVSSTYRPA  82

Query  320  PCGSLKSSMAN----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDE  469
             C S + S+AN          P+   +N  C L  EN   + +  G L  D +++   D 
Sbjct  83   RCRSAQCSLANSFSCGDCSAAPRPGCNNNTCGLAPENLFIRTSTFGELAGDVLSLASTDG  142

Query  470  PNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             N G+ L+  P FLFS  P+FL +GL  G  G+  LG +++ +PSQLA  F
Sbjct  143  SNPGA-LATDPRFLFSCAPTFLLKGLAKGAKGMAGLGRNKVGVPSQLAAAF  192



>ref|XP_006419821.1| hypothetical protein CICLE_v10005127mg [Citrus clementina]
 gb|ESR33061.1| hypothetical protein CICLE_v10005127mg [Citrus clementina]
Length=394

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 93/168 (55%), Gaps = 18/168 (11%)
 Frame = +2

Query  164  RAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQG----------  313
             +I I V KD  T QYVA++  G +  P+ LV+D+GGP  W D  SS+            
Sbjct  23   NSIAIPVVKDASTLQYVAKIHHGVSQVPINLVLDLGGPLTWVDCDSSADVSSSSSRRLIP  82

Query  314  --SIPCG-SLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVE-LIDEPNAG  481
              SI C  S KS +      T+   C +  +N +S +A +G L EDTIAV   +++P+  
Sbjct  83   SQSIQCSRSGKSPVPGNGSDTTTNTCGVFTQNGISGLATTGDLAEDTIAVRSELEDPS--  140

Query  482  SFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
              ++ V  FLFS  P+FL QGL +GV G+L LG + ISLPSQLA   G
Sbjct  141  --ITAVDEFLFSCAPTFLVQGLASGVRGMLGLGRAPISLPSQLATGIG  186



>ref|XP_008438715.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=436

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 92/174 (53%), Gaps = 16/174 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            A   F P+++V+ V+K  P+ QY+ Q++    L P+KL VD+GG F+W D    + SSS 
Sbjct  25   AATSFRPKSLVLPVTKH-PSGQYITQIRQRTPLVPVKLTVDLGGRFMWVDCDSGYVSSSY  83

Query  311  GSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  460
              + C S + S++    C           +N  C     N + +++ SG +  D ++V  
Sbjct  84   KPVRCRSAQCSLSKSTSCGECFSPPRPGCNNNTCGHFPGNTIIQLSTSGEVTTDVVSVSS  143

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             +  N    +S VPNF+F   P+FL +GL  GV+G+   G + ISLPSQ A  F
Sbjct  144  TNGFNPTRAVS-VPNFIFVCGPTFLLEGLNGGVSGMAGFGRTGISLPSQFAAAF  196



>ref|XP_011015097.1| PREDICTED: basic 7S globulin-like isoform X2 [Populus euphratica]
Length=429

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 91/177 (51%), Gaps = 26/177 (15%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            SL++  F P+A+V+ VSKD  + QYV  +     L P+KL +D+GG F W D    + SS
Sbjct  21   SLSKTSFRPKALVLPVSKDASSLQYVTLINQRTPLVPVKLTLDLGGQFQWVDCEEGYVSS  80

Query  305  SQGSIPCGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIA  451
            S   + C S + ++A  K C +           N  C +  +N V+  A SG + +D ++
Sbjct  81   SYKPVRCRSAQCALARSKSCVTECYSGPRPGCNNNTCSVLPDNTVTSTATSGEVGQDVVS  140

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  D  N G  +S V   +F+           +GVNG+   G ++ISLPSQL+  F
Sbjct  141  IQSTDGSNPGRVVS-VKKLIFA----------CSGVNGMAGFGRTKISLPSQLSAAF  186



>gb|KDO70938.1| hypothetical protein CISIN_1g041364mg, partial [Citrus sinensis]
Length=311

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = +2

Query  173  VIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGSIPCGSLKSSMAN  352
            VI V KD  T QYVA+++    L P+KL V +GG      + SS+     CGS + ++AN
Sbjct  4    VIPVVKDAATLQYVAEIKQTTPLVPVKLTVHLGG------YVSSTNKIARCGSAQCNLAN  57

Query  353  PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVPNFLFSFVPSF  532
             K C    IC    ENP+S     G ++ D ++++  +  N G  ++ V NF+F     F
Sbjct  58   VKAC-GGGICGADPENPISNTGTFGDIRIDVLSIQSTNSRNPGRAVT-VLNFIFLCGSEF  115

Query  533  LFQglgngvngvlalgnSRISLPSQLANTFGI  628
            + QGL NGV G+  LG S+++LPSQLA  F +
Sbjct  116  VLQGLANGVVGIAGLGRSKVALPSQLAAAFSL  147



>ref|XP_009597883.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=432

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 85/162 (52%), Gaps = 8/162 (5%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            PRA+++ V+KD  T QYV  ++    L P+KL +D+G  FLW D    + SSS   +PC 
Sbjct  29   PRALLLPVTKDAATKQYVTVIRQRTPLVPVKLTIDLGQRFLWVDCEKGYVSSSYKPVPCD  88

Query  329  SLKSSMANPKGC---TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFL-SH  496
            S     +    C    ++  C     NP    +  G L +D ++++  D  N G F+ S 
Sbjct  89   STPCKRSFSGACAVGNNHSTCVHDPYNPFIHTSTGGELAQDVVSLQSTDGSNPGRFIGSA  148

Query  497  VPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             P  +F    +FL +GL NGV G+  LGN  I LPSQLA+ F
Sbjct  149  RPGVVFGCGATFLLEGLANGVKGIAGLGNGFIGLPSQLADAF  190



>gb|KDP40109.1| hypothetical protein JCGZ_02107 [Jatropha curcas]
Length=414

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 88/166 (53%), Gaps = 20/166 (12%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPT-SQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASS  304
            +AQ  F P+A+V+ V KD  T  QYV Q+     L P+ + +D+GG FLW     D+ SS
Sbjct  22   IAQTTFRPKALVLPVQKDSSTLRQYVTQINQRTPLVPVNVTLDLGGLFLWVDCEQDYVSS  81

Query  305  SQGSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGS  484
            S     C S + S+ N + C SNEIC              G + +D ++V+  D  N G 
Sbjct  82   SYRPARCNSAQCSLINARRC-SNEICL-------------GQVGQDVVSVQSTDGSNPGK  127

Query  485  FLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
              S V N LF+   +F+ + L NGV G+  LG +R SLP+Q ++ F
Sbjct  128  NAS-VSNLLFTCGRTFVLEVLPNGVKGMAGLGRNRASLPTQFSSAF  172



>ref|NP_001174419.1| Os05g0403000 [Oryza sativa Japonica Group]
 gb|AAT85210.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EEE63671.1| hypothetical protein OsJ_18489 [Oryza sativa Japonica Group]
 dbj|BAH93147.1| Os05g0403000 [Oryza sativa Japonica Group]
Length=437

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 85/170 (50%), Gaps = 16/170 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            PRA+V+ VSKD  T QY    +      P+K V+D+ G  LW D    + SSS   +PCG
Sbjct  32   PRAVVLPVSKDDATQQYATVFRQRTPQVPVKAVLDLAGATLWVDCDTGYVSSSYARVPCG  91

Query  329  SLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            S    +    GC +           N  C    +N V+++   G +  D +++       
Sbjct  92   SKPCRLTKTGGCFNSCFGAPSPACLNGTCSGFPDNTVTRVTAGGNIITDVLSLPTTFRTA  151

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
             G F + VP FLF+   +FL +GL NG  G+++L  +R + P+QLA TFG
Sbjct  152  PGPF-ATVPEFLFTCGHTFLTEGLANGATGMVSLSRARFAFPTQLARTFG  200



>gb|KDO74801.1| hypothetical protein CISIN_1g040581mg [Citrus sinensis]
Length=394

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 90/168 (54%), Gaps = 18/168 (11%)
 Frame = +2

Query  164  RAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQG----------  313
             ++ I V KD  T QYVA++  G +  P+ LV+D+GGP  W D  SS+            
Sbjct  23   NSVAIPVVKDVSTLQYVAKIHHGVSQVPINLVLDLGGPLTWVDCDSSADVSSSSSRRLIP  82

Query  314  --SIPCG-SLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVE-LIDEPNAG  481
              SI C  S KS +      T+   C +  +N +S +  +G L EDTIAV   +++P+  
Sbjct  83   SQSIQCSRSGKSPVPGNGSDTTTNTCGVFTQNGISGLVTTGDLAEDTIAVRSELEDPS--  140

Query  482  SFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
              ++ V  FLFS  P+FL QGL  G  G+L LG + ISLPSQLA   G
Sbjct  141  --ITAVDQFLFSCAPTFLLQGLARGARGMLGLGRAPISLPSQLATGIG  186



>ref|XP_009111159.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin-like [Brassica 
rapa]
Length=434

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 85/174 (49%), Gaps = 15/174 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            AQ  F P+A+V+ V+KD  T QY   +     L P  +V D+GG  LW D    + SS+ 
Sbjct  23   AQPSFRPKALVLPVTKDQTTLQYTTVINQRTPLVPASVVFDLGGRNLWVDCDRGYVSSTY  82

Query  311  GSIPCGSLKSSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIAVEL  460
             S  C S   S A   GC+          +N  C    +N V++ A SG +  D ++++ 
Sbjct  83   RSPRCRSAVCSRAGSDGCSQCFSPPRPGCNNNTCSGTPDNTVTRTATSGEIATDVVSIQS  142

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             +  N G  +  +P+ +F    +FL QGL +G  G+  +G   I LPSQ A  F
Sbjct  143  TNGSNPGRIV-QIPDLVFVCGATFLLQGLASGTVGMAGMGRHNIGLPSQFAAAF  195



>ref|XP_006387875.1| hypothetical protein POPTR_0509s00200g, partial [Populus trichocarpa]
 gb|ERP46789.1| hypothetical protein POPTR_0509s00200g, partial [Populus trichocarpa]
Length=411

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 89/171 (52%), Gaps = 16/171 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P+A+V+ VSKD  + QYV  +     L P+KL +D+GG F W D    + SSS   + C 
Sbjct  1    PKALVLPVSKDASSLQYVTLMNQRTPLVPVKLTLDLGGQFQWVDCEEGYVSSSYKPVRCT  60

Query  329  SLKSSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            S + S+A  K C            +N  C +  +N V+  A SG + +D ++++  D  N
Sbjct  61   SAQCSLARSKSCVNECYSSPRPGCNNNTCSVLPDNTVTSTATSGDVGQDAVSIQSTDGSN  120

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
             G  ++ V   +F+   +   +GL NGV G+   G ++ISLPSQ +  F +
Sbjct  121  PGR-VASVNKLIFACSETRFLEGLANGVKGMAGFGRTKISLPSQFSAAFSL  170



>gb|EAY97993.1| hypothetical protein OsI_19910 [Oryza sativa Indica Group]
Length=237

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 86/170 (51%), Gaps = 16/170 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P ++V+ VSKD  T QYV   +      P+K V+D+ G  LW D    + SSS   + CG
Sbjct  32   PSSVVLPVSKDDATQQYVTMFRQRTPQVPVKAVLDLAGTMLWVDCDAGYVSSSYAGVRCG  91

Query  329  SLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            +    +    GC             N+ C    +N  + ++ +G +  D +++     P 
Sbjct  92   AKPCRLLKNAGCAITCLDAPSAGCLNDTCSEFPKNTATSVSTAGNIITDVLSLPTTFRPA  151

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
             G  L+  P FLF+   +FL QGL +G  G+++L  +R +LP+QLA+TFG
Sbjct  152  PGP-LATAPAFLFTCAHTFLTQGLADGATGMVSLSRARFALPTQLADTFG  200



>emb|CDX86682.1| BnaC08g00210D [Brassica napus]
Length=415

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 85/175 (49%), Gaps = 15/175 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            AQ  F P+A+V+ V+KD  T QY   +     L P  +V D+GG  LW D    + SS+ 
Sbjct  23   AQPSFRPKALVLPVTKDQTTLQYTTVINQRTPLVPASVVFDLGGRNLWVDCDRGYVSSTY  82

Query  311  GSIPCGSLKSSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIAVEL  460
             S  C S   S A   GC+          +N  C    +N V++ A SG +  D ++++ 
Sbjct  83   RSTRCRSAVCSRAGSDGCSQCFSPPRPGCNNNTCSGTPDNTVTRTATSGEIATDVVSIQS  142

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
             +  N G  +  +P+ +F    +FL QGL +G  G+  +G   I LPSQ    FG
Sbjct  143  TNGSNPGRIV-QIPDLVFVCGATFLLQGLASGTVGMAGMGRHNIGLPSQGVAFFG  196



>ref|XP_006349245.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=440

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 89/177 (50%), Gaps = 16/177 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            A+ P  PRA ++ ++KD  T Q++  +     L P KL +D+G  FLW D    + SSS 
Sbjct  23   AKTPPKPRAFLLPITKDAATKQFITTIYQRTPLVPAKLTIDLGQRFLWVDCDKGYVSSSY  82

Query  311  GSIPCGSL-----------KSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVE  457
              +PCGS+           +S + +P    +N  C     NP  + + +G L ED ++++
Sbjct  83   KPVPCGSIPCKRSFSGACTESCVGSPSPGCNNNTCGQTIYNPFIRTSTTGELAEDVVSLQ  142

Query  458  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
              D  N   + S     +F    +FL + L  GVNG+L LGN  +  P+QLAN F +
Sbjct  143  STDGSNPRKYFS-TNGVVFGCGSTFLLEKLAKGVNGILGLGNGYVGFPTQLANAFSV  198



>gb|KJB61114.1| hypothetical protein B456_009G341600 [Gossypium raimondii]
Length=403

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 80/157 (51%), Gaps = 10/157 (6%)
 Frame = +2

Query  182  VSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASS---------SQGSIPCGSL  334
            V+KD  T QYVA++  G  L    LVVD+GG FLW D  S          S  S+ C   
Sbjct  35   VAKDAATLQYVARISHGAPLGSTDLVVDLGGSFLWMDCNSGHVSSSYRLISSCSVNCSRA  94

Query  335  KSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVPNFLF  514
            K        C  N  C +   N V+     G L ED IAV+ +D  + G   + V +FLF
Sbjct  95   KFHDLGSTSCLLNTNCYVSPYNGVTGSTSMGELVEDVIAVDSVDPSDVGQSTT-VDHFLF  153

Query  515  SFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
            +   +F  QGL +G  G++ LG + ISLPSQL+++ G
Sbjct  154  ACASTFHLQGLASGAKGMMGLGKASISLPSQLSSSIG  190



>gb|EYU20619.1| hypothetical protein MIMGU_mgv1a026442mg, partial [Erythranthe 
guttata]
Length=427

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 85/172 (49%), Gaps = 20/172 (12%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW---ADW--ASSSQGSIPC  325
            P A    + KD  T+QY   +Q G N   L +V+D+GG FLW    D+  A+S+   IPC
Sbjct  21   PEAFTFPIKKDDTTNQYYTNIQFGSNSTKLNVVIDLGGNFLWFNSEDYLNAASTFHPIPC  80

Query  326  GSLKSSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  472
            G+ K  +A   GCT           +N  C     NP S  +G   L EDT+ +      
Sbjct  81   GTRKCRIAEAIGCTFCFLKPAQPGCTNNTCSDYSLNPFSGTSGYSGLGEDTLRL----RS  136

Query  473  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
              G  +  V +F F +    + +GL    +GV+ALG +RISL +QLA+ F I
Sbjct  137  ARGGNVYAVDDFPFQYAHDAMLEGLAGPASGVIALGRTRISLQAQLASAFKI  188



>emb|CAN68737.1| hypothetical protein VITISV_030194 [Vitis vinifera]
Length=439

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 88/170 (52%), Gaps = 16/170 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P A+V+ VSK+  T+ +V  +Q    L P+ LV+DV G  LW D    + SS+  +  C 
Sbjct  38   PNALVLLVSKNEATNLHVVDIQKRTPLKPVPLVLDVNGRSLWVDCESNYLSSTYNAPQCH  97

Query  329  SLKSSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
            S + S AN   C +          N  C L   NP+S     G L +D +++   D  + 
Sbjct  98   STQCSRANLHDCRTCSAQTRPGCHNNTCGLNAANPISGETAFGELAQDVLSIPSTDGSSL  157

Query  479  GSFLSHVPNFLFSFVPSFLFQgl-gngvngvlalgnSRISLPSQLANTFG  625
            G  ++ +P FLF+  PS L Q      V GV+ LG++ I+LP+QLA+ FG
Sbjct  158  GQLVT-IPQFLFACAPSSLAQKGFPPAVQGVVGLGHTSIALPTQLASHFG  206



>ref|XP_006489295.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=436

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 89/177 (50%), Gaps = 17/177 (10%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD-----WAS  301
            S A+  F P+A+V+ V+KD  T QYV +++      P+KL +D+GG  LW +     + S
Sbjct  22   STAKTSFRPKALVLPVTKDSSTLQYVTEIKQRTPHVPVKLTIDLGGRSLWVNCDEETYKS  81

Query  302  SSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  451
            SS    PC S   S+AN + C            N  C +  +NP+  +  +G +  D ++
Sbjct  82   SSYKFAPCHSAPCSLANARICWDCFSEPRQFCQNRTCNILPDNPIRGIFSNGPVSMDVVS  141

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  D  N G  +S +P  LF    SF    L  GV G+  LG ++ISLPS  +  F
Sbjct  142  IQSTDGKNPGKVVS-LPQLLF-VCASFDLSDLAKGVTGMAGLGRAKISLPSLFSAAF  196



>ref|XP_010659830.1| PREDICTED: basic 7S globulin-like [Vitis vinifera]
Length=455

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 88/170 (52%), Gaps = 16/170 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P A+V+ VSK+  T+ +V  +Q    L P+ LV+DV G  LW D    + SS+  +  C 
Sbjct  54   PNALVLLVSKNEATNLHVVDIQKRTPLKPVPLVLDVNGRSLWVDCESNYLSSTYNAPQCH  113

Query  329  SLKSSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
            S + S AN   C +          N  C L   NP+S     G L +D +++   D  + 
Sbjct  114  STQCSRANLHDCRTCSAQTRPGCHNNTCGLNAANPISGETAFGELAQDVLSIPSTDGSSL  173

Query  479  GSFLSHVPNFLFSFVPSFLFQgl-gngvngvlalgnSRISLPSQLANTFG  625
            G  ++ +P FLF+  PS L Q      V GV+ LG++ I+LP+QLA+ FG
Sbjct  174  GQLVT-IPQFLFACAPSSLAQKGFPPAVQGVVGLGHTSIALPTQLASHFG  222



>ref|XP_011011197.1| PREDICTED: basic 7S globulin-like isoform X2 [Populus euphratica]
Length=429

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 90/177 (51%), Gaps = 26/177 (15%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            SL++  F P+A+V+ VSKD  + QYV  +     L P+KL +D+GG F W D    + SS
Sbjct  21   SLSKTSFRPKALVLPVSKDASSLQYVTLINQRTPLVPVKLTLDLGGQFQWVDSEEGYVSS  80

Query  305  SQGSIPCGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIA  451
            S   + C S + ++A  K C +           N  C +  +N V+  A SG + +D ++
Sbjct  81   SYKPVRCRSAQCALARSKSCVTECYSGPRPGCNNNTCSVLPDNTVTSTATSGEVGQDVVS  140

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  D  N G  +S V   +F+           +GVNG+   G ++ISLPSQ +  F
Sbjct  141  IQSTDGSNPGRVVS-VKKLIFA----------CSGVNGMAGFGRTKISLPSQFSAAF  186



>ref|XP_006419808.1| hypothetical protein CICLE_v10006987mg [Citrus clementina]
 gb|ESR33048.1| hypothetical protein CICLE_v10006987mg [Citrus clementina]
Length=436

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 89/177 (50%), Gaps = 17/177 (10%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD-----WAS  301
            S A+  F P+A+V+ V+KD  T QYV +++      P+KL +D+GG  LW +     + S
Sbjct  22   STAKTSFRPKALVLPVTKDSSTLQYVTEIKQRTPHVPVKLTIDLGGRSLWVNCDEETYKS  81

Query  302  SSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIA  451
            SS    PC S   S+AN + C            N  C +  +NP+  +  +G +  D ++
Sbjct  82   SSYKFAPCHSAPCSLANARICWDCFSEPRQFCQNRTCNILPDNPIRGIFSNGPVSMDVVS  141

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            ++  D  N G  +S +P  LF    SF    L  GV G+  LG ++ISLPS  +  F
Sbjct  142  IQSTDGKNPGKVVS-LPQLLF-VCASFDLSDLAKGVTGMAGLGRAKISLPSLFSAAF  196



>ref|XP_008340919.1| PREDICTED: basic 7S globulin [Malus domestica]
Length=406

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 97/172 (56%), Gaps = 14/172 (8%)
 Frame = +2

Query  131  TISLAQ-RPFFP-RAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWA--  298
            T S++Q +P+     ++  V KD  T QYV ++  G  L P KLVVD+GGPFLW + A  
Sbjct  16   TFSISQAKPYNQLNGLIFHVKKDXSTLQYVTEIHHGTPLVPTKLVVDLGGPFLWLNCASS  75

Query  299  ----SSSQGSIPCGSLKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELID  466
                  SQ SI C + K    +     SN+ C++  EN ++++A  G L ED +AV+ + 
Sbjct  76   SSSRLISQRSIQCLAAKPKXQDQG---SNKKCDIFTENRITQVATQGDLLEDIMAVDQVT  132

Query  467  EPN---AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLA  613
            + +   + S  +   NFLFS  P FL  G+ +G  G+L LG +++S+ SQ++
Sbjct  133  DGSKTXSKSITTVGYNFLFSCAPMFLLNGIASGAKGMLGLGRTQMSMASQIS  184



>ref|XP_006489296.1| PREDICTED: basic 7S globulin-like [Citrus sinensis]
Length=437

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 90/176 (51%), Gaps = 16/176 (9%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSS  307
            +AQ  F P+A+++ V+KD  T QY+ Q+     L P+K  +D+GG FLW     D+ SSS
Sbjct  23   IAQTSFRPKALILPVTKDASTLQYLTQINQRTPLVPVKYTLDLGGQFLWVVCLEDYESSS  82

Query  308  QGSIPCGSLKSSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAV  454
              S  C S   S+AN           P+   +N  C L  +N ++ ++ +G L  D  ++
Sbjct  83   FTSPLCHSAPCSLANAPFCWDCSDSQPRPGCNNNTCNLLPDNTINGISFNGPLSMDVASI  142

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  +  N G  +S VP  LF     F    L NGV G+  LG + ISLPS  ++ F
Sbjct  143  QSTNGKNPGRVVS-VPKLLFVCADRFHLTDLANGVRGMAGLGRNSISLPSLFSSAF  197



>emb|CDY15456.1| BnaA08g27400D [Brassica napus]
Length=415

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 85/175 (49%), Gaps = 15/175 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            AQ  F P+A+V+ V+KD  T QY   +     L P  +V D+GG  LW D    + SS+ 
Sbjct  23   AQPSFRPKALVLPVTKDQTTLQYTTVINQRTPLVPASVVFDLGGRNLWVDCDRGYVSSTY  82

Query  311  GSIPCGSLKSSMANPKGCT----------SNEICELQFENPVSKMAGSGVLKEDTIAVEL  460
             S  C S   S A   GC+          +N  C    +N V++ A SG +  D ++++ 
Sbjct  83   TSPRCRSAVCSRAGSDGCSQCFSPPRPGCNNNTCSGTPDNTVTRTATSGEIATDVVSIQS  142

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
             +  N G  +  +P+ +F    +FL QGL +G  G+  +G   + LPSQ    FG
Sbjct  143  TNGSNPGRVV-QIPDLVFVCGATFLLQGLASGTVGMAGMGRHNVGLPSQGVAFFG  196



>gb|EEC84612.1| hypothetical protein OsI_31447 [Oryza sativa Indica Group]
Length=598

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 83/181 (46%), Gaps = 23/181 (13%)
 Frame = +2

Query  149  RPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDV-GGPFLWAD------WASSS  307
            R   P+A+ + V +D  T QYVA  Q       +K VVD+ GG  LW D      +ASSS
Sbjct  35   RATRPKAVAMPVGRDGATRQYVATFQQRTPRVAMKAVVDLSGGATLWVDCDAAAGYASSS  94

Query  308  QGSIPCGSLKSSMANPKGCTS--------------NEICELQFENPVSKMAGSGVLKEDT  445
               +PCGS    +     C+               N  C    EN V+   G G +  D 
Sbjct  95   YAGVPCGSKPCRLVESPSCSYIASCLGSPPSPACLNRTCTGHAENTVTSSVGRGNVVTDV  154

Query  446  IAVELI--DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANT  619
            +++       P     L+  P FLF+  P+ L QGL  G  G+ +L  +R++LP+QLA T
Sbjct  155  LSLPTTFPSAPVRQGPLATAPAFLFTCGPTSLTQGLAAGATGMASLSRARLALPAQLAGT  214

Query  620  F  622
            F
Sbjct  215  F  215



>dbj|BAJ94733.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91936.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 82/169 (49%), Gaps = 16/169 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P A+V+ V KD  T QY+   +      P+  V+D+GG  LW D    + SSS   +PC 
Sbjct  27   PSAVVLPVRKDSATGQYLTGFRQRTPQVPVTAVLDLGGASLWVDCDAGYVSSSYAGVPCA  86

Query  329  SLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            S    +A    C +           N+ C    EN V++++  G L  D ++V     P 
Sbjct  87   SKLCRLAKSVACATSCVGKPSPGCLNDTCSGFPENTVTRVSTGGNLITDVLSVPTTFRPA  146

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             G  L+  P FLF+   +FL  GL  G  G+ +L  +R +LP+QLA TF
Sbjct  147  PGP-LATAPAFLFTCGATFLTDGLAAGATGMASLSRARFALPTQLAATF  194



>ref|NP_001274964.1| xyloglucan-specific endoglucanase inhibitor 4 precursor [Solanum 
tuberosum]
 gb|ADU58605.1| xyloglucan-specific endoglucanase inhibitor 4 [Solanum tuberosum]
Length=440

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 90/178 (51%), Gaps = 18/178 (10%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            A+ P  PRA ++ V+KD  T Q+V  +     L P+KL +D+G  FLW D    + SSS 
Sbjct  23   AKTPSKPRAFLLPVTKDASTKQFVTTISQRTPLVPVKLTIDLGQRFLWVDCEKGYVSSSY  82

Query  311  GSIPCGSL-----------KSSMANPK-GCTSNEICELQFENPVSKMAGSGVLKEDTIAV  454
              +PCGS+           +S +  P  GC +N    + + + +    G G L +D +++
Sbjct  83   KPVPCGSIPCKRSLSGACVESCVGPPSPGCNNNTCSHIPYNHFIRTSTG-GELAQDVVSL  141

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
            +  D  N   +LS     +F   P  L +GL  GV G+L LGN  +  P+QLAN F +
Sbjct  142  QSTDGSNPRKYLS-TNGVVFDCAPHSLLEGLAKGVKGILGLGNGYVGFPTQLANAFSV  198



>ref|XP_002284868.1| PREDICTED: basic 7S globulin-like [Vitis vinifera]
Length=441

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 93/178 (52%), Gaps = 17/178 (10%)
 Frame = +2

Query  137  SLAQRPFF-PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW----ADWAS  301
            S++Q P   P A+V+ ++K   T QYV  +     L PL ++VD+GG FLW    +++ S
Sbjct  21   SISQTPLIHPNALVLPLTKHASTLQYVTIISQRTPLVPLNVIVDLGGQFLWVGCGSNYVS  80

Query  302  SSQGSIPCGSLKSSMAN-PKGCT----------SNEICELQFENPVSKMAGSGVLKEDTI  448
            SS     C S +  +A+ PK C           +N  C L  EN  +    +G L ED +
Sbjct  81   SSYRPAQCHSSQCFLAHGPKSCDHCLSRGRPKCNNGTCILFSENVFTSKVSAGDLSEDVL  140

Query  449  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +++  D  N  S ++ +P+FLFS  P  L QGL  G  G+  LG+ RI LP+ L++  
Sbjct  141  SLQSTDGLNPRSAVA-IPHFLFSCAPEVLLQGLAGGAEGIAGLGHGRIGLPTLLSSAL  197



>ref|XP_006349243.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=441

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 92/179 (51%), Gaps = 19/179 (11%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            A+ P  PRA ++ V+KD  T Q +  +     L P+KL +D+G  FLW D    + SSS 
Sbjct  23   AKTPPRPRAFLLPVTKDVVTKQLITTISQRTPLVPVKLTIDLGQRFLWLDCGNGYVSSSY  82

Query  311  GSIPCGSL--KSSMA--------NPK---GCTSNEICELQFENPVSKMAGSGVLKEDTIA  451
              +PCGS+  K S++        +P+   GC  N    + + NP S+ +  G L +D ++
Sbjct  83   KPVPCGSIPCKRSLSHDCAETCLDPQASPGCNHNTCSHIPY-NPFSRTSTGGELAQDVLS  141

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
            ++  D  N   +LS     +F   P  L +GL   V G+L LGN  +  P+QLAN F +
Sbjct  142  LQSTDGLNPRKYLS-ANGVVFDCAPKPLLEGLAKSVEGILGLGNGYVGFPTQLANAFRV  199



>emb|CAN68736.1| hypothetical protein VITISV_030193 [Vitis vinifera]
Length=441

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 93/178 (52%), Gaps = 17/178 (10%)
 Frame = +2

Query  137  SLAQRPFF-PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW----ADWAS  301
            S++Q P   P A+V+ ++K   T QYV  +     L PL ++VD+GG FLW    +++ S
Sbjct  21   SISQTPLIHPNALVLPLTKHASTLQYVTIISQRTPLVPLNVIVDLGGQFLWVGCGSNYVS  80

Query  302  SSQGSIPCGSLKSSMAN-PKGCT----------SNEICELQFENPVSKMAGSGVLKEDTI  448
            SS     C S +  +A+ PK C           +N  C L  EN  +    +G L ED +
Sbjct  81   SSYRPARCHSSQCFLAHGPKSCDHCLSRGRPKCNNGTCILFSENVFTSKVSAGDLSEDVL  140

Query  449  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +++  D  N  S ++ +P+FLFS  P  L QGL  G  G+  LG+ RI LP+ L++  
Sbjct  141  SLQSTDGLNPRSAVA-IPHFLFSCAPEVLLQGLAGGAEGIAGLGHGRIGLPTLLSSAL  197



>ref|XP_006349244.1| PREDICTED: basic 7S globulin-like [Solanum tuberosum]
Length=441

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 88/178 (49%), Gaps = 18/178 (10%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            A+ P  PRA ++ V+KD  T QYV  +     L P+KL +D+G  FLW D    + S S 
Sbjct  23   AKTPPRPRAFLLPVTKDASTKQYVTTIYQRTPLVPVKLTIDLGQRFLWVDCEKGYVSKSY  82

Query  311  -----GSIPC-----GSLKSSMANP--KGCTSNEICELQFENPVSKMAGSGVLKEDTIAV  454
                 GSIPC     G+   S   P   GC +N  C     NP  + +  G L +D +++
Sbjct  83   KPVRCGSIPCKRSLSGACVESCVGPPSPGC-NNNTCSHTPYNPFIRTSTGGELAQDVVSL  141

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
            +  D  N   +LS     +F   P  L +GL  GV G+L LGN  +  P+QLAN F +
Sbjct  142  QSTDGSNPRKYLS-TNGVVFDCAPHSLLEGLAKGVKGILGLGNGYVGFPTQLANAFSV  198



>ref|XP_009364261.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin, partial [Pyrus 
x bretschneideri]
Length=416

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 84/174 (48%), Gaps = 17/174 (10%)
 Frame = +2

Query  149  RPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQGS  316
            + F P+A+V+ V K+  T QY+   +    L PLKL +D+GG   W     D+ SS+   
Sbjct  1    KSFRPKALVLPVXKNASTLQYLTTFKQRTPLVPLKLTIDLGGELFWVDCEKDFVSSTYKP  60

Query  317  IPCGSLKSSMANPKGC-----------TSNEICELQFENPVSKMAGS-GVLKEDTIAVEL  460
              C S + S+AN K C            +N  C L   N + +  G+   L  D +A+  
Sbjct  61   SRCHSAQCSLANSKSCHDCNSPPVRPGCNNNTCVLMPANTIIRXGGNFNQLGLDRVALHS  120

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             D    G  +SH  N LF    +FL   L +GV G+  LG ++I LPSQ A+ F
Sbjct  121  TDGSQPGRLVSH-RNVLFVCGETFLLTQLADGVTGMAGLGRAKIGLPSQFASAF  173



>ref|XP_010039912.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
 gb|KCW45637.1| hypothetical protein EUGRSUZ_L00588 [Eucalyptus grandis]
Length=453

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 92/174 (53%), Gaps = 25/174 (14%)
 Frame = +2

Query  152  PFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGS----I  319
            P   R +V+ +++D  T +YVA +  G +L PL+L VD+GGP LW D ++ S GS    +
Sbjct  21   PSRARTLVLPLARDASTLRYVATVYHGPSLDPLELAVDLGGPSLWLDCSAPSSGSSVRRV  80

Query  320  PCGSLKSSMANP------KGCTS--NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            PC S++   A        + C S  + +C ++ E        +GVL E  +AV+ +D   
Sbjct  81   PCRSIQCLAATSDASGLRRACPSGPSSVCGVRAEG-----GEAGVLGEGALAVDSVDGSG  135

Query  476  AGSFLSHVPNFLFS---FVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
              S ++ V  FL S     P F      +GV G L LG SRISLPSQ+A  FG+
Sbjct  136  ERS-VAAVDRFLISCARAAPGF----GASGVGGTLGLGRSRISLPSQVATAFGV  184



>ref|XP_006844967.1| hypothetical protein AMTR_s00058p00179910 [Amborella trichopoda]
 gb|ERN06642.1| hypothetical protein AMTR_s00058p00179910 [Amborella trichopoda]
Length=437

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 89/178 (50%), Gaps = 16/178 (9%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            ++S AQ  F P+A+V+ V KD  T QY+  L +   L P  L +D+GG FLW +    + 
Sbjct  22   SLSHAQS-FRPKALVVPVKKDPATLQYLITLHLKTPLQPETLTLDLGGAFLWLECGTTYT  80

Query  299  SSSQGSIPCGSLKSSMANPK----------GCTSNEICELQFENPVSKMAGSGVLKEDTI  448
            SSS   I C   + S+              GC  N  C +   NP   ++G G L ED +
Sbjct  81   SSSYQPILCRRSQCSIVTTGCARCYTLPGPGCAPNRTCGVVPSNPFIAISGLGGLLEDVL  140

Query  449  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            A+   D    G  ++   N+LFS  PS L +GL    +G+  LGN +ISL +QLA  F
Sbjct  141  AIRSTDGRAPGIQVT-TRNYLFSCAPSSLTKGLAPPSHGIAGLGNRKISLSAQLATKF  197



>gb|AAM61574.1| EDGP precursor [Arabidopsis thaliana]
Length=433

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 82/176 (47%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S AQ PF P+A+++ V+KD  T QY   +     L P  +V D+GG  LW D    + SS
Sbjct  20   SSAQTPFRPKALLLPVTKDQSTLQYTTVINQRTPLVPASVVFDLGGRELWVDCDKGYVSS  79

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            +  S  C S   S A    C           SN  C    +N V+  A SG    D +++
Sbjct  80   TYQSPRCNSAVCSRAGSTSCGTCFSPPRPGCSNNTCGGIPDNTVTGTATSGEFALDVVSI  139

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  +  N G  +  +PN +F    +FL +GL  G  G+  +G   I LPSQ A  F
Sbjct  140  QSTNGSNPGRVV-KIPNLIFDCGATFLLKGLAKGTVGMAGMGRHNIGLPSQFAAAF  194



>gb|KDO74790.1| hypothetical protein CISIN_1g035972mg, partial [Citrus sinensis]
Length=334

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 84/168 (50%), Gaps = 16/168 (10%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASS  304
            S+A+  F P+A+V+ V+KD  T QY+ Q++    L P+KL +D+GG FLW     ++ SS
Sbjct  20   SIAKTSFRPKALVLPVTKDGSTLQYLTQIKQRTPLVPVKLTLDLGGQFLWVVCEKEYVSS  79

Query  305  SQGSIPCGSLKSSMANPKGCTS--NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
            S    PC S   S+AN   C           F  PVS          D  +++  D  N 
Sbjct  80   SYRFAPCHSAPCSLANAPYCFECFGTKPRPGFNGPVS---------MDVASIQSTDGKNP  130

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            G  +S VP  LF    SF    L  GV G+  LG ++ISLPS  ++ F
Sbjct  131  GKVVS-VPKLLFVCADSFHLTDLAKGVTGMAGLGRTKISLPSLFSSAF  177



>ref|NP_171821.1| aspartyl protease-like protein [Arabidopsis thaliana]
 gb|AAK17160.1|AF325092_1 unknown protein [Arabidopsis thaliana]
 gb|AAC72119.1| Strong similarity to gb|D14550 extracellular dermal glycoprotein 
(EDGP) precursor from Daucus carota. ESTs gb|H37281, gb|T44167, 
gb|T21813, gb|N38437, gb|Z26470, gb|R65072, gb|N76373, 
gb|F15470, gb|Z35182, gb|H76373, gb|Z34678 and gb|Z35387 
come from this gene [Arabidopsis thaliana]
 gb|AAK59531.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15204.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27546.1| aspartyl protease-like protein [Arabidopsis thaliana]
Length=433

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 82/176 (47%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            S AQ PF P+A+++ V+KD  T QY   +     L P  +V D+GG  LW D    + SS
Sbjct  20   SSAQTPFRPKALLLPVTKDQSTLQYTTVINQRTPLVPASVVFDLGGRELWVDCDKGYVSS  79

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            +  S  C S   S A    C           SN  C    +N V+  A SG    D +++
Sbjct  80   TYQSPRCNSAVCSRAGSTSCGTCFSPPRPGCSNNTCGGIPDNTVTGTATSGEFALDVVSI  139

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  +  N G  +  +PN +F    +FL +GL  G  G+  +G   I LPSQ A  F
Sbjct  140  QSTNGSNPGRVV-KIPNLIFDCGATFLLKGLAKGTVGMAGMGRHNIGLPSQFAAAF  194



>gb|EYU41536.1| hypothetical protein MIMGU_mgv1a024772mg [Erythranthe guttata]
Length=419

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 82/163 (50%), Gaps = 21/163 (13%)
 Frame = +2

Query  176  IAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW---ADWASSSQGSIPCGSLKSSM  346
            +++ KD  T QY   + MG N +P+ +++D+GGP+LW    D+ S++   IPCGS K  +
Sbjct  31   LSLKKDPKTRQYYTTITMGSNRSPINVIIDIGGPYLWFSCNDYKSNTYAPIPCGSPKCEL  90

Query  347  ANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSH  496
            A   GC           +N+ C     NP + M  S    ED+         +    L+ 
Sbjct  91   AKGIGCYGCNLPKRPGCTNDTCAASPYNPFTNMLVSQGFYEDSF--------HPAGRLAP  142

Query  497  VPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
            +P ++FS +     +GL +G  G+L LG + ISL  Q+A  FG
Sbjct  143  LPRYIFSCMDKDYLEGLASGTTGMLGLGRTDISLHKQVAGVFG  185



>ref|NP_001055497.1| Os05g0403300 [Oryza sativa Japonica Group]
 gb|AAT85212.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17411.1| Os05g0403300 [Oryza sativa Japonica Group]
Length=455

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 86/170 (51%), Gaps = 16/170 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P ++V+ VSKD  T QYV   +      P+K V+D+ G  LW D    + SSS   + CG
Sbjct  32   PSSVVLPVSKDDATQQYVTMFRQRTPQVPVKAVLDLAGTMLWVDCDAGYVSSSYAGVRCG  91

Query  329  SLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN  475
            +    +    GC             N+ C    +N  + ++ +G +  D +++     P 
Sbjct  92   AKPCRLLKNAGCAITCLDAVSAGCLNDTCSEFPKNTATSVSTAGNIITDVLSLPTTFRPA  151

Query  476  AGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
             G  L+  P FLF+   +FL QGL +G  G+++L  +R +LP+QLA+TFG
Sbjct  152  PGP-LATAPAFLFTCGHTFLTQGLADGATGMVSLSRARFALPTQLADTFG  200



>ref|XP_010035585.1| PREDICTED: basic 7S globulin [Eucalyptus grandis]
Length=436

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 84/178 (47%), Gaps = 17/178 (10%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            +LA   F P+A+VI V+KD  T QY  Q++    L P+KL +DVGG F W +    + SS
Sbjct  21   TLATTSFQPKALVIPVTKDSSTLQYTTQIKQRTPLVPVKLTIDVGGNFQWVNCDGGYVSS  80

Query  305  SQGSIPCGSLKSSMANPKGCTS-----------NEICELQFENPVSKMA-GSGVLKEDTI  448
            S   +PC S     +    C +           N  C    +NP S +  G G +  DT 
Sbjct  81   SYRPVPCDSPICKASGSAACETECLAPPGPGCYNNTCSHIPDNPFSSIGIGGGEMASDTT  140

Query  449  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             ++  D    G  +  VP  +F+   + +  GL  G  G+  LG S +SLP Q A+ F
Sbjct  141  VIQSTDGRTVGKAVV-VPRVVFTCGTTSVLGGLSAGALGMAGLGRSEVSLPVQFASAF  197



>gb|EPS72958.1| hypothetical protein M569_01796, partial [Genlisea aurea]
Length=422

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 85/170 (50%), Gaps = 9/170 (5%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WA  298
            T   A  P  PR +++ V KD  T QYV  ++      P+KLVVD+GG FLW D    + 
Sbjct  11   TTGHASSPPRPRELLLTVRKDAATQQYVTVIRQRTPEVPVKLVVDLGGQFLWVDCDRNYI  70

Query  299  SSSQGSIPCGSLKSSMA-NPKGCTSN-EICELQFENPVSKMAGSGVLKEDTIAVELIDEP  472
            SSS  ++ C + + ++A N   C +N   C +   +P     G   L ED ++V   D  
Sbjct  71   SSSLRNVRCNTAECNLAGNSVACGNNGTTCSVFPGSPFLTTIGD--LVEDVVSVASTDGT  128

Query  473  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            N G + + VP F F+   + L  GL  G  G+  LG SRI +P Q A  F
Sbjct  129  NPGPY-ATVPRFAFACGSTALLHGLARGATGIAGLGRSRIGVPLQFAADF  177



>ref|XP_009625013.1| PREDICTED: basic 7S globulin-like [Nicotiana tomentosiformis]
Length=436

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 92/183 (50%), Gaps = 19/183 (10%)
 Frame = +2

Query  128  ATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            +T  LA+  F P+ + +AV KD  + QY+ ++Q    L PLKL + + G  LW D    +
Sbjct  22   STNCLAKTTFHPKTLFLAVKKDPSSLQYITEIQQRTPLVPLKLAIHLAGDSLWVDCENGY  81

Query  296  ASSSQGSIPCGSLKSSMANPKGC-------------TSNEICELQFENPVSKMAGSGVLK  436
             SS+     C S +  +A+   C              + + C    ENP+ ++  SG + 
Sbjct  82   KSSTYKPSRCKSKQCKLASTTQCGECLLGFVQRGPGCNKDACYNHVENPLVEILTSGEIA  141

Query  437  EDTIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvla-lgnSRISLPSQLA  613
            +D ++++ I+E   G  ++ +P F+FS   S++ Q LG  V G +     S +S+P+Q A
Sbjct  142  DDVLSIQSINESFPGP-VATIPKFIFSCAGSYVTQDLGKDVKGTVGFGHQSAVSVPAQFA  200

Query  614  NTF  622
            + F
Sbjct  201  SAF  203



>ref|XP_006304586.1| hypothetical protein CARUB_v10011636mg [Capsella rubella]
 gb|EOA37484.1| hypothetical protein CARUB_v10011636mg [Capsella rubella]
Length=434

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 80/174 (46%), Gaps = 15/174 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            AQ  F P+A+++ V+KD  + QY   L     L P  +V D+GG  LW D    + SS+ 
Sbjct  24   AQTSFRPKALILPVTKDPSSLQYTTVLNQRTPLVPASVVFDLGGRDLWVDCDRGYVSSTY  83

Query  311  GSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  460
             S  C S   + A    C           SN  C    +N V+  A SG L  D ++++ 
Sbjct  84   QSPRCNSAVCTRAGSTSCGQCFSPPRPGCSNNTCGATPDNTVTGTATSGELALDVVSIQS  143

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             D  N G  +  +PN +F    +FL  GL  G  G+  +G   I LPSQ A  F
Sbjct  144  TDGSNPGPVV-KIPNLIFVCGSTFLLNGLAKGTVGMAGMGRHNIGLPSQFAAAF  196



>ref|XP_004962140.1| PREDICTED: basic 7S globulin-like [Setaria italica]
Length=434

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 85/170 (50%), Gaps = 17/170 (10%)
 Frame = +2

Query  161  PRAIVIAVSKDFP-TSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPC  325
            P A+V+ VSKD   T QYV   +    LAP++ V+D+ G  LW D    +ASS+   +PC
Sbjct  29   PSAVVLPVSKDAAATQQYVTSFRQRTPLAPVEAVLDLAGATLWVDCEAGYASSTYRRVPC  88

Query  326  GSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  472
             S    ++    C +           N+ C     N V+ ++  G +  D +A+     P
Sbjct  89   ASKPCRLSRSAACATSCLGAPSPSCLNDTCAGFPGNTVTHVSTGGNIITDVLALPTTFRP  148

Query  473  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
              G  L+  P FLF+   +FL +GL  G  G+ +L  +R +LP+QLA TF
Sbjct  149  APGP-LATAPAFLFTCGATFLTEGLAAGATGMASLSRARFALPTQLAATF  197



>ref|XP_010475063.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=434

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 79/170 (46%), Gaps = 15/170 (9%)
 Frame = +2

Query  155  FFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  322
            F P+A+++ ++KD  T QY   +     L P  LV D+GG  LW D    + SS+  S  
Sbjct  28   FRPKALLLPITKDQSTLQYTTVINQRTPLVPASLVFDLGGRDLWVDCDKGYVSSTYQSPR  87

Query  323  CGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  472
            C S   S A    C           SN  C    +N V+  A SG L  D ++++  D  
Sbjct  88   CNSAVCSRAGSTSCGTCFSPPRPGCSNNTCGAIPDNTVTGTATSGELALDVVSIQSTDGS  147

Query  473  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            N G  +  +PN +F    +FL +GL  G  G+  +G   I LPSQ A  F
Sbjct  148  NPGRVV-KIPNLIFVCGSTFLLEGLAKGAVGMAGMGRHNIGLPSQFAAAF  196



>ref|XP_008438716.1| PREDICTED: basic 7S globulin-like isoform X1 [Cucumis melo]
 ref|XP_008438717.1| PREDICTED: basic 7S globulin-like isoform X2 [Cucumis melo]
Length=425

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 88/174 (51%), Gaps = 16/174 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            A   F P+++V+ V K  P+ QY+ Q+     L P+ L VD+GG F+W D    + SSS 
Sbjct  22   AATSFTPKSLVLPVIKH-PSLQYIIQIHQRTPLVPVNLTVDLGGRFMWVDCDRGYVSSSY  80

Query  311  GSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  460
                C S +  +A    C           +N  C L  EN V +++ SG +  D ++V  
Sbjct  81   KPARCRSAQCYLAKSISCGKCYLPPHPGCNNHTCHLPAENTVIQLSSSGEVTSDVVSVSS  140

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             ++ N    LS V NFLF    +FL +GL  GV G+   G +RISLPSQ A  F
Sbjct  141  TNDFNPTRALS-VHNFLFVCSSTFLLEGLAGGVTGMAGFGRTRISLPSQFAAAF  193



>ref|XP_010457449.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=433

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 79/168 (47%), Gaps = 15/168 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P+A+++ ++KD  T QY   +     L P  LV D+GG  LW D    + SS+  S  C 
Sbjct  29   PKALLLPITKDQSTLQYTTVINQRTPLVPASLVFDLGGRDLWVDCDKGYVSSTYRSPRCN  88

Query  329  SLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
            S   S+A    C           SN  C    +N V+  A SG L  D ++++  D  N 
Sbjct  89   SAVCSLAGSTSCGTCFSPPRPGCSNNTCGAIPDNTVTGTATSGELALDVVSIQSTDGSNP  148

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            G  +  +PN +F    +FL +GL  G  G+  +G   I LPSQ A  F
Sbjct  149  GRVV-KIPNLIFVCGSTFLLEGLAKGAVGMAGMGRHNIGLPSQFAAAF  195



>ref|XP_003626314.1| Basic 7S globulin [Medicago truncatula]
 gb|ABD32384.1| Peptidase A1, pepsin [Medicago truncatula]
 gb|AES82532.1| basic 7S globulin-like protein [Medicago truncatula]
Length=437

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 87/171 (51%), Gaps = 16/171 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P  +V+ V +D  T  + A +     L  + +++D+ G  LW +    +ASS+  +  C 
Sbjct  35   PNLLVLPVQQDASTGLHWANIHKRTPLMQVPVLLDLNGKHLWVNCEQHYASSTYQAPYCH  94

Query  329  SLKSSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
            S + S AN   C +          N  C L   NPV++    G L +D +A+  I+ P  
Sbjct  95   STQCSRANAHTCHTCVSSFRPGCHNNTCGLMSANPVTQQTAMGELAQDVLAIYAINGPKP  154

Query  479  GSFLSHVPNFLFSFVPSFLFQglg-ngvngvlalgnSRISLPSQLANTFGI  628
            G  ++ +P FLFS  PSFL Q    N V GV+ L +S ISL +QL++ FG+
Sbjct  155  GPMVT-IPQFLFSCAPSFLAQKGLPNNVQGVVGLAHSPISLQNQLSSHFGL  204



>ref|XP_010483190.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=433

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 78/168 (46%), Gaps = 15/168 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P+A+++ V+KD  T QY   +     L P  LV D+GG  LW D    + S+S  S  C 
Sbjct  29   PKALILPVTKDQSTLQYTTVINQRTPLVPASLVFDLGGRDLWVDCDKGYVSTSYRSPRCH  88

Query  329  SLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
            S   S A    C           SN  C    +N V+  A SG L  D ++++  D  N 
Sbjct  89   SAVCSRAGSTSCGTCFSPPRPGCSNNTCGAIPDNTVTGTATSGELALDAVSIQSTDGSNP  148

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            G  +  +PN +F    +FL +GL  G  G+  +G   I LPSQ A  F
Sbjct  149  GRVV-KIPNLIFVCGSTFLLEGLAKGAVGMAGMGRHNIGLPSQFAAAF  195



>ref|XP_009118711.1| PREDICTED: basic 7S globulin-like [Brassica rapa]
Length=432

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 82/174 (47%), Gaps = 15/174 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQ  310
            AQ+ F P+A+++ V+KD  T+QY   +     L    +V D+GG  LW     D+ SS+ 
Sbjct  21   AQQSFRPKALLLPVTKDKSTNQYTTVINQRTPLVAASVVFDLGGRNLWVDCDKDYVSSTY  80

Query  311  GSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  460
             S  C S   S     GC           SN  C L  +N V+  A SG +  D ++++ 
Sbjct  81   RSPRCNSAVCSRTGSTGCGTCFSPPRPGCSNNTCSLIPDNTVTGTATSGEVATDVVSIQS  140

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             +  N G  +  +PN +F    +FL +GL  G  G+  +G     LP Q A+ F
Sbjct  141  TNGVNPGRVV-KIPNLIFGCGATFLLKGLATGTVGMAGMGRHNSGLPLQFASAF  193



>emb|CDY37436.1| BnaC08g45740D [Brassica napus]
Length=296

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 84/178 (47%), Gaps = 15/178 (8%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWA  298
            ++S AQ  F P+A+++ V+KD  T+QY   +     L    +V D+GG  LW     D+ 
Sbjct  18   SLSSAQPSFRPKALLLPVTKDKSTNQYTTVINQRTPLVAASVVFDLGGRNLWVDCDKDYV  77

Query  299  SSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  448
            SS+  S  C S   S A    C           SN  C    +N V+  A SG    D +
Sbjct  78   SSTYRSPRCNSAVCSRAGSTSCGECYSPPRPGCSNNTCGSIPDNTVTGTATSGEFATDVV  137

Query  449  AVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +++  +  N G F+  +P+ +F    +FL  GL  G  G+  +G   I LPSQ A+ F
Sbjct  138  SIQSTNGFNPGRFV-QIPDLIFGCGATFLLNGLAPGTVGMAGMGRHNIGLPSQFASAF  194



>ref|XP_002439768.1| hypothetical protein SORBIDRAFT_09g019770 [Sorghum bicolor]
 gb|EES18198.1| hypothetical protein SORBIDRAFT_09g019770 [Sorghum bicolor]
Length=450

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 87/168 (52%), Gaps = 16/168 (10%)
 Frame = +2

Query  167  AIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD---WASSSQGSIPCGS--  331
            A+V+ VSKD  T QYV   +    L P+K V+D+ G  LW D   +ASS+   +PCGS  
Sbjct  41   AVVLPVSKDDATQQYVTGFRQRTPLVPVKAVLDLAGATLWVDCDGYASSTYTRVPCGSTL  100

Query  332  ---LKSSMANPKGCTS-------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPN-A  478
               L  S A    C+        N+ C    EN V++++  G +  D +A+     P  A
Sbjct  101  CRGLSRSPACATTCSGAPSPSCLNDTCGGFPENTVTRLSTGGNVITDVLALPTTFRPAPA  160

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
               L+  P FLF+   + L +GL  G  G+ +L  +R +LP+QLA+TF
Sbjct  161  PGPLATAPAFLFACGSTSLTRGLAAGAAGMASLSRARFALPTQLASTF  208



>ref|XP_008246503.1| PREDICTED: basic 7S globulin-like [Prunus mume]
Length=431

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 88/183 (48%), Gaps = 19/183 (10%)
 Frame = +2

Query  128  ATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            AT S  Q P  P  +V+ V KD  T+ +VAQ+     L     V+D+ G FL  +    +
Sbjct  24   ATKSQTQVPIRPNKLVLKVQKDRATNLHVAQIHKRTPLVQFPFVIDLTGRFLSVNCENQY  83

Query  296  ASSSQGSIPCGSLKSSMANPK------------GCTSNEICELQFENPVSKMAGSGVLKE  439
             SS+  +  C S + + AN              GC +N  C L   NPV++ +  G L E
Sbjct  84   TSSTYKAPDCHSSQCARANSHTCRTCSSSKTRPGCHTNA-CGLLTTNPVTQQSALGELAE  142

Query  440  DTIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglg-ngvngvlalgnSRISLPSQLAN  616
            D + +      + G  ++H P FLF+  PS + Q      V GV  LG+S ISLP QLA+
Sbjct  143  DVLKIPSTQGSSPGPMVTH-PQFLFACAPSNILQKGLPKNVQGVAGLGHSPISLPYQLAS  201

Query  617  TFG  625
             FG
Sbjct  202  HFG  204



>gb|KFK26154.1| hypothetical protein AALP_AA8G210500 [Arabis alpina]
Length=381

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 80/159 (50%), Gaps = 17/159 (11%)
 Frame = +2

Query  167  AIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQ--------GSIP  322
             +V  V +D PT QYVAQ+ +G +  P+KLVVD+ GP LW D +S               
Sbjct  26   GVVFPVIRDIPTGQYVAQILLGDSSEPVKLVVDLAGPLLWFDCSSRQHVSSSRSFISGSS  85

Query  323  CGSLKSSMANPKGCTSNE--ICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSH  496
             G LK+ + N +    N    C+L   N V+ +A  G L  D ++      P        
Sbjct  86   TGCLKARVGNERISRGNHNADCDLLVRNGVNGIAARGELVTDFLSFGSSSSPGR------  139

Query  497  VPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLA  613
              + LF+  P +L +GL +G  GV+ LG ++ISLPSQLA
Sbjct  140  -VDLLFACAPPWLLRGLASGAQGVMGLGRAQISLPSQLA  177



>ref|XP_006654380.1| PREDICTED: basic 7S globulin-like [Oryza brachyantha]
Length=457

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 83/167 (50%), Gaps = 16/167 (10%)
 Frame = +2

Query  167  AIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGSL  334
            A+V+ V+KD  T QYV   +      P+K V+D+ G  LW D    + SSS   +PCGS 
Sbjct  36   AVVLPVNKDDATQQYVTVFRQRTPQVPVKAVLDLAGAMLWVDCDAGYVSSSYAGVPCGSK  95

Query  335  KSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAG  481
               +    GC             N  C    +N V+ ++ +G +  D +++     P  G
Sbjct  96   PCRLLKNAGCAVSCLDAPSSGCLNGTCAEFPKNTVTSVSTAGNVLTDVLSLPTTFRPAPG  155

Query  482  SFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
              L+  P FLF+   +FL +GL  G  G+++L  +R +LP+QLA TF
Sbjct  156  P-LATAPAFLFTCGRTFLTEGLAAGATGMVSLSRARFALPTQLAGTF  201



>ref|XP_009342158.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin [Pyrus x bretschneideri]
Length=408

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 89/163 (55%), Gaps = 8/163 (5%)
 Frame = +2

Query  149  RPFFP-RAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWA-SSSQGSIP  322
            +PF P   ++  V KD  T QYV ++ +G  L   KL VD+GGPF W + A SSS   + 
Sbjct  24   KPFNPTDGLIFHVKKDVSTLQYVTEIHIGTPLLLSKLAVDLGGPFPWFNCAPSSSSRLVN  83

Query  323  CGSLKSSMANPKGC---TSNEICELQFENPVSKMAGSGVLKEDTIAV-ELIDEPNAG--S  484
              S++   A PK      SN+ C +  EN +++MA  G L ED +AV ++ D    G  S
Sbjct  84   KRSIQCLAAKPKTHQYRRSNKKCHIFTENRITQMAIQGDLVEDIMAVNQVTDGSKTGSKS  143

Query  485  FLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLA  613
              +   NF FS  P  L  GL +G  G+L LG +++S+ SQ++
Sbjct  144  ITTVDYNFQFSCAPMLLLNGLASGAKGMLGLGRTQMSMTSQIS  186



>ref|XP_007034627.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
 gb|EOY05553.1| Eukaryotic aspartyl protease family protein, putative [Theobroma 
cacao]
Length=456

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 94/180 (52%), Gaps = 19/180 (11%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWA  298
            +I+LA   F P+A+V+ V K+  + QY+ Q+     L P+ L VD+GG FLW     D+ 
Sbjct  37   SITLAS--FRPKALVLPVWKEPSSLQYLTQIWQRTPLVPVNLTVDLGGQFLWVNCAKDYV  94

Query  299  SSSQGSIPCGSLKSSMANPKGCT------------SNEICELQFENPVSKMAGSGVLKED  442
            SSS     C S + S+A    C+            +N+ C L  +N V + A    L +D
Sbjct  95   SSSYRPGTCRSSQCSLARALLCSNCSSSATPSPGCNNKTCTLFPDNTVIRAATFAELAQD  154

Query  443  TIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
              +++  D  N GS +S VP FLFS   +F+ +GL NGV G+  LG   ISLPS  +  F
Sbjct  155  VFSIQSTDGKNPGSVVS-VPKFLFSCGATFILEGLANGVTGMAGLGRYPISLPSFFSAAF  213



>ref|XP_002517174.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45337.1| conserved hypothetical protein [Ricinus communis]
Length=445

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 89/172 (52%), Gaps = 21/172 (12%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGSI----PCG  328
            PRA+V+ ++KD  T QY+ +L +G    P  LVVD+GG  LW D  +  Q S      CG
Sbjct  31   PRALVLPITKDSYTLQYLTRLNLGTPPVPRNLVVDLGGQHLWIDCDTGYQSSTYRPGYCG  90

Query  329  SLKSSMA---------NPKG-CTSNEICELQFENPVSKMAGSGVLKE---DTIAVELIDE  469
            S   S+A         NP+G   +N  C++   N V    G G+  E   D I+++  D 
Sbjct  91   SASCSLAKAACVSICPNPRGPGCNNNTCKVLARNSV---FGGGIFPEVSLDVISLQSTDG  147

Query  470  PNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
              AG  +S V +F+F    ++    L N  NG++ LG  R++ PSQL++ FG
Sbjct  148  SEAGPPVS-VSDFIFGCANTWDLIDLANAANGMIGLGKERVAFPSQLSSVFG  198



>ref|XP_007205231.1| hypothetical protein PRUPE_ppa006032mg [Prunus persica]
 gb|EMJ06430.1| hypothetical protein PRUPE_ppa006032mg [Prunus persica]
Length=431

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 88/183 (48%), Gaps = 19/183 (10%)
 Frame = +2

Query  128  ATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            AT S    P  P  +V+ V KD  T+ +VAQ+     L     V+D+ G FL  +    +
Sbjct  24   ATKSQTHVPIRPNKLVLKVQKDRATNLHVAQIHKRTPLVQFPFVIDLTGRFLSVNCENQY  83

Query  296  ASSSQGSIPCGSLKSSMANPK------------GCTSNEICELQFENPVSKMAGSGVLKE  439
             SS+  +  C S + + AN              GC +N  C L   NPV++ +  G L E
Sbjct  84   TSSTYKAPVCHSSQCARANSHMCRTCSSLKTRPGCHTNA-CGLLTTNPVTQQSAQGELAE  142

Query  440  DTIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglg-ngvngvlalgnSRISLPSQLAN  616
            D + +      + G  ++H P+FLF+  PS + Q      V GV  LG+S ISLP QLA+
Sbjct  143  DVLKIPSTQGSSPGPMVTH-PHFLFACAPSNILQKGLPKNVQGVAGLGHSPISLPYQLAS  201

Query  617  TFG  625
             FG
Sbjct  202  HFG  204



>ref|XP_006419825.1| hypothetical protein CICLE_v10007108mg [Citrus clementina]
 gb|ESR33065.1| hypothetical protein CICLE_v10007108mg [Citrus clementina]
Length=409

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 83/154 (54%), Gaps = 6/154 (4%)
 Frame = +2

Query  173  VIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGSLKS  340
            V+ V K+    QYV Q++    L P+KLVV +GG  LW D    + SS+  +  CGS + 
Sbjct  19   VLPVLKNAAVFQYVTQIKQRTPLVPVKLVVHLGGNLLWVDCEKGYVSSTNKTARCGSAQC  78

Query  341  SMANPKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVPNFLFSF  520
            ++     C   +  +    NP+S     G ++ D ++V+  +  N G  ++ VPNF+F  
Sbjct  79   NLIGLVACGGGKCGDFS-NNPISNTGTIGDIRIDVVSVQSTNGRNPGRGVT-VPNFIFLC  136

Query  521  VPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
               F+ QGL +GV G+ ALG ++ +LP QLA  F
Sbjct  137  GSEFVLQGLASGVTGIAALGRTKTALPLQLAAAF  170



>ref|XP_002889446.1| EDGP precursor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65705.1| EDGP precursor [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 81/176 (46%), Gaps = 15/176 (9%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASS  304
            S AQ  F P+A+++ V+KD  T QY   +     L P  +V D+GG  LW     D+ SS
Sbjct  20   SSAQTSFRPKALLLPVTKDQSTLQYTTVINQRTPLVPASVVFDLGGRELWVDCDKDYVSS  79

Query  305  SQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAV  454
            +  S  C S   S A    C           SN  C    +N V+  A SG    D +++
Sbjct  80   TYQSPRCKSAVCSRAGSNSCGTCFSPPRPGCSNNTCGGIPDNTVTGTATSGEFALDVVSI  139

Query  455  ELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            +  +  N G  +  +PN +F    +FL +GL  G  G+  +G   I LPSQ A  F
Sbjct  140  QSTNGSNPGRVV-KIPNLIFDCGATFLLKGLATGTVGMAGMGRHNIGLPSQFAAAF  194



>ref|XP_004246189.2| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=440

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 68/157 (43%), Gaps = 24/157 (15%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQG--  313
            LAQ  F P+   +AV +D  T QY+ ++Q    L P+KL V VGG  LW D  +  +   
Sbjct  36   LAQTNFHPKTFFLAVKQDPSTLQYITEIQQRTPLVPVKLAVHVGGENLWVDCQTGFKSST  95

Query  314  ---------------SIPCGSLKSSMANPKGCTSNEICELQFENPV--SKMAGSGVLKED  442
                           S  CG  K+      GC SN  C     NP   +       + ED
Sbjct  96   YKPARCNSRQCNLAKSTSCGDCKTKNKTRPGCNSNA-CYNIVSNPALNNTFYSGAEIAED  154

Query  443  TIAVELIDEPNAG----SFLSHVPNFLFSFVPSFLFQ  541
             + ++ I+  N G      +  +PNF+FS  PSFL Q
Sbjct  155  VMTIQSINGSNTGPESRGPVVTIPNFIFSCSPSFLTQ  191



>ref|XP_002517167.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
 gb|EEF45330.1| basic 7S globulin 2 precursor small subunit, putative [Ricinus 
communis]
Length=435

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 85/173 (49%), Gaps = 15/173 (9%)
 Frame = +2

Query  152  PFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD---WASSSQGSIP  322
            P  P+ +V+ V KD  + QYV Q+     L  +KL VD+GG F+W D   + SSS   + 
Sbjct  30   PARPKPLVLPVLKDKCSHQYVTQINQRTPLVAVKLTVDLGGTFMWVDCDNYVSSSYTPVR  89

Query  323  CGSLKSSMANPKGCTS-----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDE  469
            C S    +A+   CT+           N  C     NPV  ++ SG +  D ++++ +D 
Sbjct  90   CDSALCKLADSHSCTTECYSSPKPGCYNNTCSHIPYNPVVHVSTSGDIGLDVVSLQSMDG  149

Query  470  PNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
               G  +S VPN  F     F+ + L +GV GV  LG   ISLP+  ++  G+
Sbjct  150  KYPGRNVS-VPNVPFVCGTGFMLENLADGVLGVAGLGRGNISLPAYFSSALGL  201



>emb|CDY32500.1| BnaA09g50960D [Brassica napus]
Length=434

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 82/174 (47%), Gaps = 15/174 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQ  310
            AQ+ F P+A+++ V+KD  T+QY   +     L    +V D+GG  LW     D+ S++ 
Sbjct  23   AQQSFRPKALLLPVTKDKSTNQYTTVINQRTPLVAASVVFDLGGRNLWVDCDKDYVSTTY  82

Query  311  GSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  460
             S  C S   S     GC           SN  C L  +N V+  A SG +  D ++++ 
Sbjct  83   RSPRCNSAVCSRTGSTGCGTCFSPPRPGCSNNTCSLIPDNTVTGTATSGEVATDVVSIQS  142

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             +  N G  +  +PN +F    +FL +GL  G  G+  +G     LP Q A+ F
Sbjct  143  TNGVNPGRVV-KIPNLIFGCGATFLLKGLATGTVGMAGMGRHNSGLPLQFASAF  195



>emb|CDP03611.1| unnamed protein product [Coffea canephora]
Length=186

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 69/145 (48%), Gaps = 15/145 (10%)
 Frame = +2

Query  131  TISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWA  298
            T   AQ  F P A+V+ V+KD  T QYVA++        L +V+D+GG FLW     D+ 
Sbjct  29   TTCAAQGSFRPHALVVPVTKDASTLQYVAKVNQRTPSVSLNVVLDLGGRFLWVDCDKDYV  88

Query  299  SSSQGSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTI  448
            SS+   + C S + S+A   GC           + + C L  EN V+  +  G + +D +
Sbjct  89   SSTYRPVRCRSAQCSLAGNAGCGNCTGAPKPGCNTDTCALFPENTVTHTSTGGEVAQDAL  148

Query  449  AVELIDEPNAGSFLSHVPNFLFSFV  523
             +   D  N G   + VP+ L   V
Sbjct  149  TLSSTDGSNPGPSAT-VPHCLLPSV  172



>gb|KCW84282.1| hypothetical protein EUGRSUZ_B01133 [Eucalyptus grandis]
Length=437

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 92/183 (50%), Gaps = 21/183 (11%)
 Frame = +2

Query  131  TISLAQ-RPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            T+S  Q + F P+A+++ V+KD    QY  Q++    L P+KL +DVGG F+W      +
Sbjct  17   TVSQPQAKTFQPKALLLPVTKDSSLQQYTTQIKQRTPLVPIKLTIDVGGNFMWVKCEKGY  76

Query  296  ASSSQGSIPCGS------------LKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKE  439
             SSS   +PCGS            +K    +  GC  N      + NP ++++  G +  
Sbjct  77   VSSSYRYVPCGSKICKISRSGACVVKCPPPHRPGCNDNACSHFSY-NPYTRISTLGEMAA  135

Query  440  DTIAVELIDEPNAGSFLSHVPNFLFS--FVPSFLFQglgngvngvlalgnSRISLPSQLA  613
            D + ++  D  ++G  +  VP  +FS  F    L +GL +G  G+  LG S +SLPS  A
Sbjct  136  DAVLIQSTDGRSSGPMV-FVPGLVFSCTFRSPSLLKGLSSGAEGIAGLGRSLVSLPSLFA  194

Query  614  NTF  622
            + F
Sbjct  195  SAF  197



>ref|XP_010045852.1| PREDICTED: basic 7S globulin-like [Eucalyptus grandis]
Length=456

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 92/183 (50%), Gaps = 21/183 (11%)
 Frame = +2

Query  131  TISLAQ-RPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----W  295
            T+S  Q + F P+A+++ V+KD    QY  Q++    L P+KL +DVGG F+W      +
Sbjct  36   TVSQPQAKTFQPKALLLPVTKDSSLQQYTTQIKQRTPLVPIKLTIDVGGNFMWVKCEKGY  95

Query  296  ASSSQGSIPCGS------------LKSSMANPKGCTSNEICELQFENPVSKMAGSGVLKE  439
             SSS   +PCGS            +K    +  GC  N      + NP ++++  G +  
Sbjct  96   VSSSYRYVPCGSKICKISRSGACVVKCPPPHRPGCNDNACSHFSY-NPYTRISTLGEMAA  154

Query  440  DTIAVELIDEPNAGSFLSHVPNFLFS--FVPSFLFQglgngvngvlalgnSRISLPSQLA  613
            D + ++  D  ++G  +  VP  +FS  F    L +GL +G  G+  LG S +SLPS  A
Sbjct  155  DAVLIQSTDGRSSGPMV-FVPGLVFSCTFRSPSLLKGLSSGAEGIAGLGRSLVSLPSLFA  213

Query  614  NTF  622
            + F
Sbjct  214  SAF  216



>gb|EYU20615.1| hypothetical protein MIMGU_mgv1a006692mg [Erythranthe guttata]
Length=435

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 84/170 (49%), Gaps = 16/170 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW---ADWASSSQGSIPCGS  331
            P A    + KD  T+QY   +Q+G N     +V+D+GG  L+    +++++S   + CG+
Sbjct  28   PEAFTFPIKKDDSTNQYYTNIQIGSNSTKFSVVIDLGGKLLYFNSINYSTASYRPVLCGT  87

Query  332  LKSSMANPKGC-----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
             + S+++  GC            +N  C     NP S   G   L +D++ V       A
Sbjct  88   PQCSISSGGGCMFCVFSPPDTPCTNNTCTDYALNPFSGTRGCSPLGQDSLLVRY--ARGA  145

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
              + + V NF F F    L +GL     G++ LG +RISLP+Q+A+ FG+
Sbjct  146  HRYYTTVDNFPFQFSDPVLREGLAGPAAGLIGLGRTRISLPAQIASAFGV  195



>ref|XP_011091050.1| PREDICTED: basic 7S globulin 2-like [Sesamum indicum]
Length=404

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 77/160 (48%), Gaps = 22/160 (14%)
 Frame = +2

Query  188  KDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW---ADWASSSQGSIPCGSLKSSMANPK  358
            KD  TSQ+   +QMG NL  +  V+D+GGPFLW    D+ S++   IPCGS K  +A   
Sbjct  30   KDMKTSQFYTTIQMGSNLVAINAVIDLGGPFLWFACNDYVSNTYAPIPCGSTKCEVAKGI  89

Query  359  GCT----------SNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVPNF  508
            GC           +N+ C     NP   M  S    EDT  ++          LS +P+F
Sbjct  90   GCVGCNLPPRPGCTNDTCGASPYNPFMDMLVSQGYAEDTFYMK--------DRLS-LPDF  140

Query  509  LFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
             FS +     +GL +G  G+L L  + IS   Q A+ F +
Sbjct  141  SFSCMDKDFLEGLASGSTGMLGLARTDISFHKQAAHRFNL  180



>ref|XP_006296506.1| hypothetical protein CARUB_v10025694mg [Capsella rubella]
 gb|EOA29404.1| hypothetical protein CARUB_v10025694mg [Capsella rubella]
Length=437

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 84/174 (48%), Gaps = 15/174 (9%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQ  310
            A+  F P+A+++ ++KD  T QY   ++    L P+ +V D+GG  LW D    + SSS 
Sbjct  27   AKTSFRPKALILPITKDPSTLQYTTVIKQRTPLVPVSVVFDLGGRDLWVDCDKGYVSSSY  86

Query  311  GSIPCGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVEL  460
             S  C S   S A    C           SN  C    +N V+  A SG    D ++++ 
Sbjct  87   HSPRCNSAVCSRAGSTSCGTCFSPPKPGCSNNTCGSIPDNTVTGWATSGEYALDVVSIQS  146

Query  461  IDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
             +  N G F+  +P+F+FS     + +GL  G  G+ A+G   I LPSQ A  F
Sbjct  147  TNGSNPGRFV-KIPSFIFSCGSDNILKGLAKGTVGMAAMGRHNIGLPSQFAAAF  199



>gb|KDP40115.1| hypothetical protein JCGZ_02113 [Jatropha curcas]
Length=444

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 86/173 (50%), Gaps = 17/173 (10%)
 Frame = +2

Query  152  PFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSI  319
            P  P+A+V+ ++KD  T QY+ +L +G       LVVD+GG  LW D    + SS+    
Sbjct  27   PSKPKALVLPITKDPSTLQYLTRLNLGTPSVEKALVVDLGGRHLWIDCENEYESSTYRPG  86

Query  320  PCGSLKSSMANPK-----------GCTSNEICELQFENPVSKMAGSGVLKEDTIAVELID  466
             CGS   S +              GC  N  C L  +NP+    G   +  D ++++  +
Sbjct  87   LCGSASCSFSKAMCVSKCLTPARPGC-HNNTCRLLTKNPIWGTYGISEVAIDAVSLQSTN  145

Query  467  EPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
               AGS +S +PN +F+   S     L +G  GVL L   R+S+P+QL++ FG
Sbjct  146  GAKAGSLVS-IPNLIFACEGSSNLLQLADGAKGVLGLAKERVSIPTQLSSAFG  197



>gb|KEH36784.1| xyloglucanase-specific endoglucanase inhibitor protein [Medicago 
truncatula]
Length=430

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 84/168 (50%), Gaps = 16/168 (10%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P A+V+ V++D+ TSQYV  +     + P+KL +D+ G FLW +    + SSS   + C 
Sbjct  25   PNALVLPVTRDYATSQYVTLIHQRTPIVPIKLTLDLSGQFLWINCDEGYVSSSYHPVHCN  84

Query  329  SLKSSMANPK----------GCTSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
            + + S+   K          GC  N  C L   N  ++    G +  D +A+   D    
Sbjct  85   TKQCSLTGSKSCRNCFLSEPGCNMNT-CNLFPNNIFTRTNQIGEVALDVVAIHSTDGSKL  143

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            G  ++ + NFLF+   + L +GL +GV G+   G S ISLPS  A+ F
Sbjct  144  GKIVT-INNFLFTCGRTNLLKGLASGVKGMAGFGKSNISLPSLFASAF  190



>ref|XP_009342159.1| PREDICTED: LOW QUALITY PROTEIN: basic 7S globulin [Pyrus x bretschneideri]
Length=440

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 86/173 (50%), Gaps = 25/173 (14%)
 Frame = +2

Query  158  FPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQGSIPC  325
            + + +V+ V+KD  T QY+     G  L P+KL++D+ G +LW     D+ SS+  S  C
Sbjct  36   YQKPLVLPVAKDSSTLQYLTTFSQGTPLVPIKLIIDLSGQYLWVDCKKDYISSTYESACC  95

Query  326  GSLKSSMANPKG---CTS------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
             S + S++N K    C S      N IC L   N V++ + S  L ED +        N 
Sbjct  96   NSAQCSLSNSKAYVICYSSKPASYNNICHLSPNNIVTRTSTSSELGEDIVX------SNP  149

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISL-----PSQLANTF  622
            G  L +V N LF+   +FL + L + V G+ +LG  +I L     PSQ  + F
Sbjct  150  GR-LVYVANLLFTCGATFLLKYLASDVKGMASLGRDKIGLLKHXHPSQFTSAF  201



>dbj|BAE99306.1| conglutin gamma - like protein [Arabidopsis thaliana]
Length=386

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 89/174 (51%), Gaps = 21/174 (12%)
 Frame = +2

Query  134  ISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWAS---S  304
            IS +Q       +V  V KD PT QY+AQ+++G +  P+KLVVD+ G  LW D +S   S
Sbjct  20   ISKSQISDSVNGVVFPVVKDLPTGQYLAQIRLGDSPDPVKLVVDLAGSILWFDCSSRHVS  79

Query  305  SQGSIPCGS----LKSSMANPK-------GCTSNEICELQFENPVSKMAGSGVLKEDTIA  451
            S  ++  GS    LK+ + N +           N  CEL  +N    +   G L  D ++
Sbjct  80   SSRNLISGSSSGCLKAKVGNERVSSSSSSRKDQNADCELLVKNDAFGITARGELFSDVMS  139

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLA  613
            V  +  P          + LF+  P +L +GL +G  GV+ LG ++ISLPSQLA
Sbjct  140  VGSVTSPGT-------VDLLFACTPPWLLRGLASGAQGVMGLGRAQISLPSQLA  186



>ref|NP_197413.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAK74058.1| AT5g19120/T24G5_20 [Arabidopsis thaliana]
 gb|AAL06960.1| AT5g19120/T24G5_20 [Arabidopsis thaliana]
 gb|AED92655.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=386

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 89/174 (51%), Gaps = 21/174 (12%)
 Frame = +2

Query  134  ISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWAS---S  304
            IS +Q       +V  V KD PT QY+AQ+++G +  P+KLVVD+ G  LW D +S   S
Sbjct  20   ISKSQISDSVNGVVFPVVKDLPTGQYLAQIRLGDSPDPVKLVVDLAGSILWFDCSSRHVS  79

Query  305  SQGSIPCGS----LKSSMANPK-------GCTSNEICELQFENPVSKMAGSGVLKEDTIA  451
            S  ++  GS    LK+ + N +           N  CEL  +N    +   G L  D ++
Sbjct  80   SSRNLISGSSSGCLKAKVGNERVSSSSSSRKDQNADCELLVKNDAFGITARGELFSDVMS  139

Query  452  VELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLA  613
            V  +  P          + LF+  P +L +GL +G  GV+ LG ++ISLPSQLA
Sbjct  140  VGSVTSPGT-------VDLLFACTPPWLLRGLASGAQGVMGLGRAQISLPSQLA  186



>ref|XP_004494958.1| PREDICTED: basic 7S globulin 2-like [Cicer arietinum]
Length=440

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 84/171 (49%), Gaps = 16/171 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P  +V+ V +D  T  + A +     L  L +++D+ G  LW +    ++SS+  +  C 
Sbjct  40   PNLLVLPVQQDANTGLHWAYIHKRTPLMQLPVLIDLNGKHLWVNCEQHYSSSTYQAPFCH  99

Query  329  SLKSSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
            S + + AN   C +          N  C L   NPV++    G L +D  A+     P  
Sbjct  100  STQCARANTHTCHTCVSSFRPGCHNNTCGLMSANPVTQQTALGELAQDVFAIYTTRGPKL  159

Query  479  GSFLSHVPNFLFSFVPSFLFQglg-ngvngvlalgnSRISLPSQLANTFGI  628
            G  ++ VP FLFS  PSFL Q    N V GV  L +S ISLP+QL++ FG+
Sbjct  160  GPMVT-VPQFLFSCAPSFLAQKGLPNNVQGVAGLAHSPISLPNQLSSHFGL  209



>emb|CDX88901.1| BnaA03g07480D [Brassica napus]
Length=387

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 86/171 (50%), Gaps = 19/171 (11%)
 Frame = +2

Query  134  ISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQG  313
            I+ +Q  +    IV  V++D  T QYVA++++G +  P+KLVVD+ GP LW D +S    
Sbjct  21   ITKSQISYSVNGIVFPVTRDLLTGQYVAEIRLGDSSEPVKLVVDLAGPLLWFDCSSGHIS  80

Query  314  SIPCGS-------LKSSMANPKGCT---SNEICELQFENPVSKMAGSGVLKEDTIAVELI  463
            S            LK+   N +  T    N  C+L   N V  +   G L  D +++   
Sbjct  81   SSRSLISGSSSGCLKAKAGNDRALTRGDKNADCDLLVRNGVVGITARGELAADVLSL---  137

Query  464  DEPNAGSFLSH-VPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLA  613
                 GS  S    + LF+  P  L +GL +G  GV+ LG ++ISLPSQLA
Sbjct  138  -----GSVSSQGTVDLLFACAPPLLLRGLASGAQGVMGLGKAQISLPSQLA  183



>ref|XP_008222995.1| PREDICTED: basic 7S globulin-like [Prunus mume]
Length=457

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 93/179 (52%), Gaps = 20/179 (11%)
 Frame = +2

Query  152  PFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD-----WASSSQGS  316
            P  P+A+V+ ++KD  T QY+  ++       LKL VD+GG FLW D     + SS+   
Sbjct  31   PLKPKALVLPIAKDASTLQYITTIKQRTPPVTLKLTVDLGGQFLWVDCNEGEYISSTYKP  90

Query  317  IPCGSLKSSMANPKGCT-----------SNEICELQFENPVSKMA-GSGVLKEDTI-AVE  457
              C + + S+AN K C            +N  C L  +N V   A  +G + +D +  + 
Sbjct  91   AYCNATQCSIANSKECNWECFFPKRPGCNNRTCILFPDNTVIGYADNNGEVGQDILWGLH  150

Query  458  LIDEPNAGSFLSHVPNFLFSFVPSFLFQg--lgngvngvlalgnSRISLPSQLANTFGI  628
              D  ++G  +S++PNF+F+   +  +    L NGV G+  LG +RI+LP+Q A+ + +
Sbjct  151  STDGSHSGPKVSNIPNFIFACSSNTFYGVLGLANGVKGMAGLGRTRIALPTQFASAYKL  209



>ref|XP_004229564.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=445

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 81/172 (47%), Gaps = 21/172 (12%)
 Frame = +2

Query  176  IAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQGSIPCGSLKSS  343
            + V KD  T QYVAQ+     L P+ L VD+GG FLW     D+ SSS  ++PCGS    
Sbjct  35   LPVFKDEITQQYVAQIYQRTPLVPVNLTVDLGGRFLWMDCENDYISSSYKNVPCGSRPCK  94

Query  344  MANPKGC------------TSNEICELQFENPVSKMAGSGVLKEDTIAV-ELIDEPNAGS  484
            ++  +GC             +N  C     NP+ + +  G L +D +A+  +    N  +
Sbjct  95   LSGSQGCYGSSCPVPPRPGCNNYTCSHIPYNPIKRSSTDGELAQDVVALWSITTTTNRNN  154

Query  485  ----FLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
                 LS     +F+    FL + L NGV G+  LG     LPSQLA  F +
Sbjct  155  VSKMILSSTSGVMFNCPGDFLLEKLANGVKGMAGLGIGYTGLPSQLARAFHL  206



>ref|XP_006400469.1| hypothetical protein EUTSA_v10013774mg [Eutrema salsugineum]
 gb|ESQ41922.1| hypothetical protein EUTSA_v10013774mg [Eutrema salsugineum]
Length=388

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 87/170 (51%), Gaps = 17/170 (10%)
 Frame = +2

Query  134  ISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQG  313
            IS +Q       +V  V +D PT QYVAQ+++G +  P+KLV+D+ GP LW D +S    
Sbjct  20   ISESQISHSLNGVVFPVIRDIPTGQYVAQIRLGDSSEPVKLVLDLSGPLLWFDCSSGHIS  79

Query  314  SIPCGS-------LKSSMANPKGCTSNEI---CELQFENPVSKMAGSGVLKEDTIAVELI  463
            S             K+ + N +  +  +    C+L  +N V ++A  G L  D ++   +
Sbjct  80   SSRSLISGSSSGCFKAKVGNDRVSSRGDHPADCDLLVKNDVVEIAARGELARDVVSFGSV  139

Query  464  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLA  613
              P          + LF+  P +L +GL +G  GV+ LG ++ISLPSQLA
Sbjct  140  SSPGT-------VDLLFACAPPWLLRGLASGAQGVMGLGRAQISLPSQLA  182



>ref|XP_010546839.1| PREDICTED: basic 7S globulin [Tarenaya hassleriana]
Length=382

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 83/159 (52%), Gaps = 13/159 (8%)
 Frame = +2

Query  167  AIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWAS--------SSQGSIP  322
            A+V  VS+D PT QYVAQ+++G +  P+KLVVD+ G  LW D +S        +S  S  
Sbjct  25   AVVFPVSRDLPTGQYVAQIRLGESPEPVKLVVDLSGTILWFDCSSSSSSSRNLTSGNSSD  84

Query  323  CGSLKSSMANPKGCTSNE-ICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHV  499
            C   ++          ++ +C+L   N V   +  G L  D +AV      ++ +     
Sbjct  85   CARARAGAHRVSSSRGDDSVCQLLIRNGVMGFSARGELAGDFLAV----GSDSSATSPGA  140

Query  500  PNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLAN  616
             + LF+  P +L +GL    +GVL LG ++ISLPSQL +
Sbjct  141  VDLLFACAPRWLLRGLAGEAHGVLGLGRAQISLPSQLVS  179



>gb|KCW45639.1| hypothetical protein EUGRSUZ_L005901, partial [Eucalyptus grandis]
Length=183

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 63/139 (45%), Gaps = 16/139 (12%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGS  316
            +LA   F P+A+V  V+KD  T QY  Q++    L P+KL +DVGG F   +W +   G 
Sbjct  21   TLATTSFQPKALVFPVTKDSSTLQYTTQIKQRTPLVPVKLTIDVGGNF---EWVNCDGGP  77

Query  317  IPCGSLKSSMANPKGCTS-----------NEICELQFENPVSKMA-GSGVLKEDTIAVEL  460
            +PC S     +    C +           N  C    +NP S +  G G +  DT  ++ 
Sbjct  78   VPCDSPICKASGSAACETECLAPPGPGCYNNTCSHIPDNPYSSIGIGGGEMASDTTVIQS  137

Query  461  IDEPNAGSFLSHVPNFLFS  517
             D    G  +  VP  +F+
Sbjct  138  TDGRTVGKAVV-VPRVVFT  155



>ref|XP_008458562.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=417

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 78/156 (50%), Gaps = 8/156 (5%)
 Frame = +2

Query  167  AIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQGSIPCGSLKSSM  346
            ++VI ++KD  T+QY+A +  G  + P+ L VD+GG  LW     SS            +
Sbjct  28   SLVIPLTKDSLTNQYLATVFHGSPIKPVHLAVDLGGRSLWMACGGSSSSRSIPSRSIQCI  87

Query  347  ANPKGCTSNEI---CELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVPNFLFS  517
            A   G  S  +   C +  ENP   + G  +L EDT+AV  +    A   ++     L S
Sbjct  88   AATAGGRSGSVGGACNVIAENPFGDLEGKAILVEDTVAVGSLGRSTAAVIVA-----LHS  142

Query  518  FVPSFLFQglgngvngvlalgnSRISLPSQLANTFG  625
              P FL QGL   V GVL LG ++ISLP+Q+A   G
Sbjct  143  CAPRFLLQGLAKSVKGVLGLGRNQISLPAQIATELG  178



>gb|AGT17598.1| xyloglucan-specific endoglucanase inhibitor 11 [Solanum tuberosum]
Length=446

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 67/157 (43%), Gaps = 24/157 (15%)
 Frame = +2

Query  140  LAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQG--  313
            LAQ  F P+   +AV +D  T QY+ ++Q    L P+KL V VGG  LW D  +  +   
Sbjct  38   LAQTNFHPKTFFLAVKQDPSTLQYITEIQQRTPLVPVKLAVHVGGENLWVDCKTGFKSST  97

Query  314  ---------------SIPCGSLKSSMANPKGCTSNEICELQFENPV--SKMAGSGVLKED  442
                           S  CG  K+      GC +N  C     NP   +       + ED
Sbjct  98   YKPARCNSRQCTLARSTSCGDCKTKNKTRPGCNNNA-CYNIVSNPALNNTFYSGAEIAED  156

Query  443  TIAVELIDEPNAGSF----LSHVPNFLFSFVPSFLFQ  541
             + ++ I+  N G      +  +P F+FS  PSFL Q
Sbjct  157  VLTIQSINGSNTGPESRGPVVTIPKFIFSCSPSFLTQ  193



>ref|XP_004233956.1| PREDICTED: basic 7S globulin-like [Solanum lycopersicum]
Length=436

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 92/183 (50%), Gaps = 25/183 (14%)
 Frame = +2

Query  137  SLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASS  304
            +LA+  F P+ + +AV KD  + Q+++++Q    L PLKL + + G  +W D    + SS
Sbjct  25   TLAKTTFHPKTLFLAVKKDPISLQHISEIQQRTPLVPLKLSIHLAGDSVWVDCEKGYNSS  84

Query  305  SQGSIPCGSLKSSMANPKGC-------------TSNEICELQFENPVSKMAGSGVLKEDT  445
            S  +  C S +  +A+   C              + + C    ENP+ ++   G +  D 
Sbjct  85   SYKAAHCKSSQCKLASTTLCGDCLVGLVERGPGCNKDGCYNTIENPLVQILTRGEIARDV  144

Query  446  IAVELIDEPNAGSF---LSHVPNFLFSFVPSFLFQglgngvngvla-lgnSRISLPSQLA  613
            + ++ I    +GSF   ++ +PN++FS   S++ Q LG  V G +     S +SLP QLA
Sbjct  145  LTIKSI----SGSFVGPVATIPNYIFSCAGSYVTQDLGKDVKGTIGFGHQSAVSLPVQLA  200

Query  614  NTF  622
            + F
Sbjct  201  SAF  203



>ref|XP_006418255.1| hypothetical protein EUTSA_v10007672mg [Eutrema salsugineum]
 gb|ESQ36608.1| hypothetical protein EUTSA_v10007672mg [Eutrema salsugineum]
Length=437

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 79/170 (46%), Gaps = 15/170 (9%)
 Frame = +2

Query  155  FFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIP  322
            F P+A+++ V+KD  T QY   +     L    +V D+GG  LW D    + SS+  S  
Sbjct  30   FRPKALLLPVTKDKSTLQYTTVINQRTPLVAASVVFDLGGRELWVDCDKGYVSSTYSSPR  89

Query  323  CGSLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEP  472
            C S   S A    C           SN  C    +N V+  A SG    D ++++  +  
Sbjct  90   CRSAVCSRAGSNSCGICFSPPRPGCSNNTCGSIPDNTVTGTATSGEYAIDVVSIQSTNGS  149

Query  473  NAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            N G  +  +PNF+FS   +FL +GL  G  G+  +G   + LPSQ A  F
Sbjct  150  NPGRVV-KIPNFVFSCGSTFLLKGLARGTVGMAGMGRHNVGLPSQFAAAF  198



>ref|XP_010693887.1| PREDICTED: basic 7S globulin-like [Beta vulgaris subsp. vulgaris]
Length=395

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 65/122 (53%), Gaps = 7/122 (6%)
 Frame = +2

Query  185  SKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWASSSQ--GSIPCGSLKSSMANPK  358
            +KD  T+QY+ ++  G    P  L++D+  PFLW D +SS +   ++ C S++ + A P 
Sbjct  27   TKDPSTNQYLTRIHHGSAQLPTSLIIDLNSPFLWLDCSSSPKPITAVHCRSIQCTSAAPN  86

Query  359  GC-----TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGSFLSHVPNFLFSFV  523
             C     ++ + C +  +NP +K++ +G L E T++      P     LS  P+ L S +
Sbjct  87   PCPSSLSSNQQACSVLLQNPTTKVSATGELVETTVSFHDQISPVDSFLLSCAPSILLSGL  146

Query  524  PS  529
            PS
Sbjct  147  PS  148



>ref|XP_003550008.2| PREDICTED: basic 7S globulin 2-like [Glycine max]
Length=432

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 104/201 (52%), Gaps = 23/201 (11%)
 Frame = +2

Query  74   SSMAYNPsllslfslvflATISLAQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLK  253
            ++MAY+ +++  F L  ++T+S +  P +    +I V+KD  T QY+  L  G  L P K
Sbjct  6    ATMAYSFAMIISFLLCLMSTLSHSLSPVW---FLIPVTKDASTLQYITTLSYGTPLLPTK  62

Query  254  LVVDVGGPFLWADWA-----SSSQGSIPCGSLKSSMANPKGCTS-------NEI-----C  382
            LV+D+GGPFLW   A     SSS  + P  SL+   A     T+       +E+     C
Sbjct  63   LVLDLGGPFLWLHCASRNTPSSSSLTTPHRSLQCFTAKTHKSTNSFLSSPVDEVHQYHPC  122

Query  383  ELQFENPVS-KMAGSGVLKEDTIAVELIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngv  559
            ++  EN ++  +A  G L ED +A++   E   G  + H    LF+  P+ L  GL  G 
Sbjct  123  QVFPENSITGTVASEGELVEDLMALQSPQEEEGGQLVEH--QSLFTCSPTTLLNGLARGA  180

Query  560  ngvlalgnSRISLPSQLANTF  622
             G+L LG SR S PSQ+ + F
Sbjct  181  RGMLGLGRSRSSFPSQVFDNF  201



>gb|KHN03449.1| Basic 7S globulin [Glycine soja]
Length=410

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 85/168 (51%), Gaps = 20/168 (12%)
 Frame = +2

Query  173  VIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWADWA-----SSSQGSIPCGSLK  337
            +I V+KD  T QY+  L  G  L P KLV+D+GGPFLW   A     SSS  + P  SL+
Sbjct  14   LIPVTKDASTLQYITTLSYGTPLLPTKLVLDLGGPFLWLHCASRNTPSSSSLTTPHRSLQ  73

Query  338  SSMANPKGCTS-------NEI-----CELQFENPVS-KMAGSGVLKEDTIAVELIDEPNA  478
               A     T+       +E+     C++  EN ++  +A  G L ED +A++   E   
Sbjct  74   CFTAKTHKSTNSFLSSPVDEVHQYHPCQVFPENSITGTVASEGELVEDLMALQSPQEEEG  133

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            G  + H    LF+  P+ L  GL  G  G+L LG SR S PSQ+ + F
Sbjct  134  GQLVEH--QSLFTCSPTTLLNGLARGARGMLGLGRSRSSFPSQVFDNF  179



>ref|XP_008438718.1| PREDICTED: basic 7S globulin-like [Cucumis melo]
Length=436

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 92/175 (53%), Gaps = 17/175 (10%)
 Frame = +2

Query  143  AQRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWA----DWASSSQ  310
            A   F P+++V+ V+K  P+ QY+ ++     L P+KL VD+GG F+W     D+ SSS 
Sbjct  23   AATSFRPKSLVLPVTKH-PSLQYITEVHQRTPLVPVKLTVDLGGQFMWVDCDRDYVSSSY  81

Query  311  GSIPCGSLKSSMAN-----------PKGCTSNEICELQFENPVSKMAGSGVLKEDTIAVE  457
                C S + S+A+           P+   +N+ C L   N + +++ SG +  D ++V 
Sbjct  82   KPARCRSAQCSLASKSSSCGQCFSPPRPGCNNDTCGLFPSNTIIRLSTSGEVASDVVSVS  141

Query  458  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
              +  N    +S +PNFLF    +FL +GL  GV G+   G + ISLPSQ A  F
Sbjct  142  STNGFNPTRAVS-IPNFLFVCGSTFLLEGLAPGVTGMAGFGRNGISLPSQFAAAF  195



>ref|XP_010481702.1| PREDICTED: basic 7S globulin-like [Camelina sativa]
Length=438

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 77/168 (46%), Gaps = 15/168 (9%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCG  328
            P+A+++ V+KD  T QY   +     L P  LV D+GG  LW D    + S++  S  C 
Sbjct  33   PKALILPVTKDRSTLQYKTVINQRTPLVPASLVFDLGGRELWVDCDKGYVSTTYRSPRCH  92

Query  329  SLKSSMANPKGC----------TSNEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNA  478
            S   S A    C           SN  C    +N VS  A SG    D ++++  +  N 
Sbjct  93   SAVCSRAGSTSCGTCFSPPSPGCSNNTCGAIPDNSVSGWAASGEFAIDVVSIQSTNGSNP  152

Query  479  GSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTF  622
            G F+  +PN +F    + L +GL  G  G+  +G   I LPSQ A  F
Sbjct  153  GPFV-KIPNLIFGCGSTSLLKGLAKGAVGMAGMGRHNIGLPSQFAAAF  199



>gb|EYU20618.1| hypothetical protein MIMGU_mgv1a018279mg [Erythranthe guttata]
Length=444

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 82/175 (47%), Gaps = 22/175 (13%)
 Frame = +2

Query  161  PRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW---ADW--ASSSQGSIPC  325
            P++ +  + KD  T+QY   +Q+G     L +V+D+GG FL+    D+  A+SS   IPC
Sbjct  32   PQSFIFPIKKDAKTNQYYTTIQIGSKATTLDVVIDLGGKFLYFYSGDYSNATSSYRPIPC  91

Query  326  GSLK-SSMANPKGCT-------------SNEICELQFENPVSKMAGSGVLKEDTIAVELI  463
            G+ K  ++ +  GC              +N  C     NP +   G   L ED + V   
Sbjct  92   GTRKCRTVVDTDGCVVFCNTSPGPAPGCTNNTCADYALNPFTGTQGYNGLGEDALRVR--  149

Query  464  DEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
                       V NF F +    L   L +  +GV+ LG S+ISLP+QL++ F I
Sbjct  150  -STRGSRRYYTVNNFPFQYSDPVLKDELASSTSGVIGLGRSKISLPAQLSSAFKI  203



>gb|AAB03390.1| 7S seed globulin precursor [Glycine max]
Length=427

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 81/170 (48%), Gaps = 18/170 (11%)
 Frame = +2

Query  170  IVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLWAD----WASSSQGSIPCGSLK  337
            +V+ V  D  T  + A LQ    L  + ++VD+ G  LW +    ++S +  +  C S +
Sbjct  34   VVLPVQNDGSTGLHSANLQKRTPLMQVPVLVDLNGNHLWVNCEQQYSSKTYQAPFCHSTQ  93

Query  338  SSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELID--EPNAG  481
             S AN   C S             C L   NP+++  G G L ED +A+          G
Sbjct  94   CSRANTHQCLSCPAASRPGCHKNTCGLMSTNPITQQTGLGELGEDVLAIHATQGSTQQLG  153

Query  482  SFLSHVPNFLFSFVPSFLFQglg-ngvngvlalgnSRISLPSQLANTFGI  628
              ++ VP FLFS  PSFL Q        GV  LG++ ISLP+QLA+ FG+
Sbjct  154  PLVT-VPQFLFSCAPSFLVQKGLPRNTQGVAGLGHAPISLPNQLASHFGL  202



>ref|XP_011099700.1| PREDICTED: basic 7S globulin-like [Sesamum indicum]
Length=433

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 83/177 (47%), Gaps = 21/177 (12%)
 Frame = +2

Query  146  QRPFFPRAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW---ADW--ASSSQ  310
            Q P  P+A +  + KD  T+QY   +Q+G +     +V+D+GG FLW    D+  A+SS 
Sbjct  23   QSPPKPQAFIFPIKKDVTTNQYYTTIQIGSSATTFNVVIDLGGKFLWFNSLDYFNAASSY  82

Query  311  GSIPCGSLKSSMANPKGCT-----------SNEICELQFENPVSKMAGSGVLKEDTIAVE  457
              I CG+ +  +AN  GC            +N  C     NP +   G   L +D + V 
Sbjct  83   RPILCGTQQCRIANGVGCVFCFLSPPVPGCTNNTCSDYALNPFTGTQGYSGLGQDVLRVY  142

Query  458  LIDEPNAGSFLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
                         V +F F F    L +GL +   G++ LG +RISL +QLA+ F I
Sbjct  143  STRGDQY-----RVNDFPFQFSDPVLREGLASPTAGLIGLGRTRISLQAQLASAFKI  194



>ref|XP_011091047.1| PREDICTED: basic 7S globulin 2-like [Sesamum indicum]
Length=407

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 74/168 (44%), Gaps = 22/168 (13%)
 Frame = +2

Query  164  RAIVIAVSKDFPTSQYVAQLQMGYNLAPLKLVVDVGGPFLW---ADWASSSQGSIPCGSL  334
              +V+ + KD  TSQ+ A +QMG N   +  V+D+G  FLW    D+AS++   IPCGS 
Sbjct  22   HGLVLPIQKDAKTSQFYATIQMGSNRTKINTVIDLGAQFLWFACNDYASTTYAPIPCGSS  81

Query  335  KSSMANPKGCTS----------NEICELQFENPVSKMAGSGVLKEDTIAVELIDEPNAGS  484
            K   A   GC S          N+ C     NP      +    EDT+  +         
Sbjct  82   KCETARGMGCVSCNLPPRPGCTNDTCASPAYNPFQDALVAEGFAEDTLYSK---------  132

Query  485  FLSHVPNFLFSFVPSFLFQglgngvngvlalgnSRISLPSQLANTFGI  628
                VP FLFS + S   +GL  G  G+L L  + IS   Q+     +
Sbjct  133  NQVAVPQFLFSCMDSGYLEGLATGATGLLGLARTEISFHKQVTGKLNL  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250