BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF046J23

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAG50783.1|AC079027_6  hypothetical protein, 3' partial            95.1    3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009797126.1|  PREDICTED: uncharacterized protein LOC104243609  96.7    2e-20   Nicotiana sylvestris
ref|XP_009592787.1|  PREDICTED: uncharacterized protein LOC104089563  96.3    3e-20   Nicotiana tomentosiformis
ref|NP_175486.2|  uncharacterized protein                             95.9    4e-20   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51195.1|AC079279_16  unknown protein                            95.9    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461924.1|  PREDICTED: uncharacterized protein LOC104742601  95.9    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010500647.1|  PREDICTED: uncharacterized protein LOC104777995  95.9    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006305844.1|  hypothetical protein CARUB_v10010894mg           95.5    5e-20   Capsella rubella
ref|XP_002894271.1|  hypothetical protein ARALYDRAFT_474203           95.5    5e-20   
gb|KDP39134.1|  hypothetical protein JCGZ_00891                       95.5    5e-20   Jatropha curcas
ref|XP_009147810.1|  PREDICTED: uncharacterized protein LOC103871323  95.1    7e-20   Brassica rapa
emb|CDY22815.1|  BnaA06g02620D                                        95.1    7e-20   Brassica napus [oilseed rape]
emb|CDY37107.1|  BnaC06g03920D                                        95.1    7e-20   Brassica napus [oilseed rape]
ref|XP_006393115.1|  hypothetical protein EUTSA_v10011513mg           94.7    9e-20   Eutrema salsugineum [saltwater cress]
ref|XP_008447737.1|  PREDICTED: uncharacterized protein LOC103490141  93.6    3e-19   Cucumis melo [Oriental melon]
ref|XP_004251462.1|  PREDICTED: uncharacterized protein LOC101257536  93.2    4e-19   Solanum lycopersicum
gb|EPS64103.1|  hypothetical protein M569_10678                       91.7    5e-19   Genlisea aurea
ref|XP_010479537.1|  PREDICTED: uncharacterized protein LOC104758377  92.4    7e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010545512.1|  PREDICTED: uncharacterized protein LOC104817858  92.4    7e-19   Tarenaya hassleriana [spider flower]
gb|KFK35913.1|  hypothetical protein AALP_AA4G052600                  92.4    8e-19   Arabis alpina [alpine rockcress]
gb|KGN44163.1|  hypothetical protein Csa_7G210080                     92.0    1e-18   
ref|XP_004139788.1|  PREDICTED: uncharacterized protein LOC101203307  92.0    1e-18   
ref|XP_007020816.1|  HAUS augmin-like complex subunit 4 isoform 2     88.6    6e-18   
gb|KJB62819.1|  hypothetical protein B456_009G438400                  89.4    6e-18   Gossypium raimondii
ref|XP_007020817.1|  HAUS augmin-like complex subunit 4 isoform 3     88.6    7e-18   
ref|XP_011095401.1|  PREDICTED: uncharacterized protein LOC105174869  89.7    7e-18   Sesamum indicum [beniseed]
gb|KJB62817.1|  hypothetical protein B456_009G438400                  89.4    8e-18   Gossypium raimondii
ref|XP_002280015.1|  PREDICTED: uncharacterized protein LOC100253742  89.7    8e-18   Vitis vinifera
ref|XP_006365955.1|  PREDICTED: uncharacterized protein LOC102604282  89.7    8e-18   Solanum tuberosum [potatoes]
ref|XP_006452374.1|  hypothetical protein CICLE_v10008353mg           89.7    8e-18   Citrus clementina [clementine]
ref|XP_008228485.1|  PREDICTED: uncharacterized protein LOC103327892  89.7    9e-18   Prunus mume [ume]
ref|XP_007215411.1|  hypothetical protein PRUPE_ppa005986mg           89.4    1e-17   Prunus persica
ref|XP_006452375.1|  hypothetical protein CICLE_v10008353mg           89.0    1e-17   
gb|KHG14666.1|  HAUS augmin-like complex subunit 4                    88.6    1e-17   Gossypium arboreum [tree cotton]
gb|KJB62818.1|  hypothetical protein B456_009G438400                  89.4    1e-17   Gossypium raimondii
ref|XP_004302887.1|  PREDICTED: uncharacterized protein LOC101313133  88.6    2e-17   Fragaria vesca subsp. vesca
ref|XP_007020815.1|  HAUS augmin-like complex subunit 4 isoform 1     88.6    2e-17   Theobroma cacao [chocolate]
gb|KJB62821.1|  hypothetical protein B456_009G438500                  88.6    2e-17   Gossypium raimondii
emb|CDP04568.1|  unnamed protein product                              87.8    3e-17   Coffea canephora [robusta coffee]
emb|CDP05762.1|  unnamed protein product                              87.8    4e-17   Coffea canephora [robusta coffee]
ref|XP_010063011.1|  PREDICTED: uncharacterized protein LOC104450241  87.4    5e-17   Eucalyptus grandis [rose gum]
gb|KEH27911.1|  SKIP interacting protein                              84.3    1e-16   Medicago truncatula
gb|EYU27337.1|  hypothetical protein MIMGU_mgv1a006702mg              86.3    1e-16   Erythranthe guttata [common monkey flower]
gb|ACJ84282.1|  unknown                                               85.5    2e-16   Medicago truncatula
ref|XP_008226895.1|  PREDICTED: HAUS augmin-like complex subunit ...  85.5    2e-16   Prunus mume [ume]
ref|XP_008226894.1|  PREDICTED: HAUS augmin-like complex subunit ...  85.5    2e-16   Prunus mume [ume]
ref|XP_003600108.1|  HAUS augmin-like complex subunit                 85.5    2e-16   Medicago truncatula
ref|XP_008342667.1|  PREDICTED: uncharacterized protein LOC103405443  85.5    2e-16   Malus domestica [apple tree]
ref|XP_009338054.1|  PREDICTED: uncharacterized protein LOC103930437  85.5    3e-16   Pyrus x bretschneideri [bai li]
ref|XP_007213462.1|  hypothetical protein PRUPE_ppa024388mg           85.1    3e-16   Prunus persica
ref|XP_010670158.1|  PREDICTED: uncharacterized protein LOC104887254  84.7    4e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH27912.1|  SKIP interacting protein                              84.0    7e-16   Medicago truncatula
ref|XP_009353594.1|  PREDICTED: uncharacterized protein LOC103944...  84.0    9e-16   Pyrus x bretschneideri [bai li]
ref|XP_010278680.1|  PREDICTED: uncharacterized protein LOC104612800  84.0    9e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010097813.1|  hypothetical protein L484_000961                 83.2    1e-15   
ref|XP_002532562.1|  conserved hypothetical protein                   83.6    1e-15   Ricinus communis
ref|XP_011012481.1|  PREDICTED: uncharacterized protein LOC105116724  83.2    2e-15   Populus euphratica
ref|XP_004500070.1|  PREDICTED: uncharacterized protein LOC101512734  82.8    2e-15   Cicer arietinum [garbanzo]
ref|XP_003551881.1|  PREDICTED: uncharacterized protein LOC100790889  82.4    3e-15   Glycine max [soybeans]
ref|XP_008380933.1|  PREDICTED: uncharacterized protein LOC103443814  82.4    4e-15   
ref|XP_008781274.1|  PREDICTED: uncharacterized protein LOC103701...  81.3    8e-15   Phoenix dactylifera
ref|XP_008781277.1|  PREDICTED: uncharacterized protein LOC103701...  81.3    9e-15   Phoenix dactylifera
gb|KHM99560.1|  HAUS augmin-like complex subunit 4                    80.9    1e-14   Glycine soja [wild soybean]
ref|NP_001242486.1|  uncharacterized protein LOC100786070             80.5    1e-14   Glycine max [soybeans]
ref|XP_010935260.1|  PREDICTED: uncharacterized protein LOC105055...  79.3    3e-14   Elaeis guineensis
ref|XP_010935259.1|  PREDICTED: uncharacterized protein LOC105055...  79.3    4e-14   Elaeis guineensis
gb|ABK96275.1|  unknown                                               79.3    4e-14   Populus trichocarpa x Populus deltoides
ref|XP_009420825.1|  PREDICTED: uncharacterized protein LOC104000482  79.3    4e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009144940.1|  PREDICTED: uncharacterized protein LOC103868607  79.0    5e-14   
ref|XP_006858187.1|  hypothetical protein AMTR_s00062p00162950        77.4    2e-13   Amborella trichopoda
ref|XP_009360992.1|  PREDICTED: uncharacterized protein LOC103951...  77.0    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_008355341.1|  PREDICTED: uncharacterized protein LOC103418998  74.7    2e-13   
ref|XP_010276096.1|  PREDICTED: uncharacterized protein LOC104610933  77.0    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_007146480.1|  hypothetical protein PHAVU_006G044000g           74.7    1e-12   Phaseolus vulgaris [French bean]
ref|XP_008365005.1|  PREDICTED: HAUS augmin-like complex subunit 4    73.6    3e-12   
gb|KHG12191.1|  Macrophage receptor MARCO                             70.1    1e-11   Gossypium arboreum [tree cotton]
gb|KHG12190.1|  Paternally-expressed gene 3 protein                   69.7    2e-11   Gossypium arboreum [tree cotton]
ref|XP_004295822.1|  PREDICTED: uncharacterized protein LOC101299752  66.6    8e-10   Fragaria vesca subsp. vesca
ref|XP_001768748.1|  predicted protein                                64.7    4e-09   
ref|XP_002316767.2|  hypothetical protein POPTR_0011s09280g           62.0    2e-08   
ref|XP_002989789.1|  hypothetical protein SELMODRAFT_235871           58.9    3e-07   
ref|XP_002990133.1|  hypothetical protein SELMODRAFT_235950           58.5    3e-07   
ref|XP_003573417.1|  PREDICTED: uncharacterized protein LOC100821831  53.1    2e-05   
gb|EAZ21518.1|  hypothetical protein OsJ_05142                        52.4    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453194.1|  hypothetical protein SORBIDRAFT_04g001450        50.8    2e-04   Sorghum bicolor [broomcorn]
ref|XP_004952114.1|  PREDICTED: uncharacterized protein LOC101756520  50.4    2e-04   Setaria italica



>gb|AAG50783.1|AC079027_6 hypothetical protein, 3' partial [Arabidopsis thaliana]
Length=138

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   A NLPADV QLIDQLERHCLAPDGSL+++S Y DLQLAREEM++ER RYL
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSVYSDLQLAREEMSRERLRYL  58



>ref|XP_009797126.1| PREDICTED: uncharacterized protein LOC104243609 [Nicotiana sylvestris]
Length=433

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  GAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            G G+ NLPADVTQLIDQLERHCLAPDGSL+S+S Y D QLAREEM+KERQRYL
Sbjct  4    GVGSQNLPADVTQLIDQLERHCLAPDGSLVSKSAYFDRQLAREEMSKERQRYL  56



>ref|XP_009592787.1| PREDICTED: uncharacterized protein LOC104089563 [Nicotiana tomentosiformis]
Length=433

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  GAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            G G+ NL ADVTQLIDQLERHCLAPDGSLIS+S Y DLQLAREEM+KERQRYL
Sbjct  4    GVGSQNLAADVTQLIDQLERHCLAPDGSLISKSAYFDLQLAREEMSKERQRYL  56



>ref|NP_175486.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42179.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63929.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32582.1| uncharacterized protein AT1G50710 [Arabidopsis thaliana]
Length=423

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   A NLPADV QLIDQLERHCLAPDGSL+++S Y DLQLAREEM++ER RYL
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSVYSDLQLAREEMSRERLRYL  58



>gb|AAG51195.1|AC079279_16 unknown protein [Arabidopsis thaliana]
Length=420

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   A NLPADV QLIDQLERHCLAPDGSL+++S Y DLQLAREEM++ER RYL
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSVYSDLQLAREEMSRERLRYL  58



>ref|XP_010461924.1| PREDICTED: uncharacterized protein LOC104742601 [Camelina sativa]
Length=423

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   A NLPADV QLIDQLERHCLAPDGSL+++S Y DLQLAREEM++ER RYL
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYSDLQLAREEMSRERLRYL  58



>ref|XP_010500647.1| PREDICTED: uncharacterized protein LOC104777995 [Camelina sativa]
Length=423

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   A NLPADV QLIDQLERHCLAPDGSL+++S Y DLQLAREEM++ER RYL
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYSDLQLAREEMSRERLRYL  58



>ref|XP_006305844.1| hypothetical protein CARUB_v10010894mg [Capsella rubella]
 gb|EOA38742.1| hypothetical protein CARUB_v10010894mg [Capsella rubella]
Length=423

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   A NLPADV QLIDQLERHCLAPDGSL+++S Y DLQLAREEM++ER RYL
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYSDLQLAREEMSRERLRYL  58



>ref|XP_002894271.1| hypothetical protein ARALYDRAFT_474203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70530.1| hypothetical protein ARALYDRAFT_474203 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   A NLPADV QLIDQLERHCLAPDGSL+++S Y DLQLAREEM++ER RYL
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYSDLQLAREEMSRERLRYL  58



>gb|KDP39134.1| hypothetical protein JCGZ_00891 [Jatropha curcas]
Length=435

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK +  G  NLPADV Q+ DQLERHCLAPDGSLIS+S YCDLQ+AREEM++ER RYL
Sbjct  1    MVKGVQGGGQNLPADVIQVTDQLERHCLAPDGSLISKSAYCDLQIAREEMSRERLRYL  58



>ref|XP_009147810.1| PREDICTED: uncharacterized protein LOC103871323 [Brassica rapa]
Length=419

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   A NLPADV QLIDQLERHCLAPDGSL+++S Y DLQLAREEM++ER RYL
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYYDLQLAREEMSRERLRYL  58



>emb|CDY22815.1| BnaA06g02620D [Brassica napus]
Length=419

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   A NLPADV QLIDQLERHCLAPDGSL+++S Y DLQLAREEM++ER RYL
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYYDLQLAREEMSRERLRYL  58



>emb|CDY37107.1| BnaC06g03920D [Brassica napus]
Length=419

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   A NLPADV QLIDQLERHCLAPDGSL+++S Y DLQLAREEM++ER RYL
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYYDLQLAREEMSRERLRYL  58



>ref|XP_006393115.1| hypothetical protein EUTSA_v10011513mg [Eutrema salsugineum]
 gb|ESQ30401.1| hypothetical protein EUTSA_v10011513mg [Eutrema salsugineum]
Length=423

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   A NLPADV QLIDQLERHCLAPDGSL+++S Y DLQLAREEM++ER RYL
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDGSLVTKSAYYDLQLAREEMSRERLRYL  58



>ref|XP_008447737.1| PREDICTED: uncharacterized protein LOC103490141 [Cucumis melo]
Length=430

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L  G  NLPADVTQ+IDQLERHCLAPDGSL+S+  + DLQLAREEM++ER RYL
Sbjct  1    MVKSLQGGGQNLPADVTQVIDQLERHCLAPDGSLVSKPAHYDLQLAREEMSRERLRYL  58



>ref|XP_004251462.1| PREDICTED: uncharacterized protein LOC101257536 [Solanum lycopersicum]
Length=427

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  GAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            G G+ NLPADV QLIDQL+RHCLAPDGSLIS+S + DLQLAREEM+KERQRYL
Sbjct  4    GLGSQNLPADVAQLIDQLDRHCLAPDGSLISKSAHYDLQLAREEMSKERQRYL  56



>gb|EPS64103.1| hypothetical protein M569_10678, partial [Genlisea aurea]
Length=298

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 47/51 (92%), Gaps = 0/51 (0%)
 Frame = +2

Query  371  GAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
             AHNLPA+V+Q+++QLERHCLAPDGSLIS+S Y DLQLAREEM KERQRYL
Sbjct  6    AAHNLPAEVSQVVEQLERHCLAPDGSLISKSAYYDLQLAREEMCKERQRYL  56



>ref|XP_010479537.1| PREDICTED: uncharacterized protein LOC104758377 [Camelina sativa]
Length=423

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   A NLPADV QLIDQLERHCLAPD SL+++S Y DLQLAREEM++ER RYL
Sbjct  1    MVKALQGAAQNLPADVNQLIDQLERHCLAPDESLVTKSAYSDLQLAREEMSRERLRYL  58



>ref|XP_010545512.1| PREDICTED: uncharacterized protein LOC104817858 [Tarenaya hassleriana]
Length=427

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L     NLPADV+QLIDQLERHCLAPDGSL++++ Y DLQLAREEM++ER RYL
Sbjct  1    MVKALQGAGQNLPADVSQLIDQLERHCLAPDGSLVTKTAYYDLQLAREEMSRERLRYL  58



>gb|KFK35913.1| hypothetical protein AALP_AA4G052600 [Arabis alpina]
Length=421

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   A NLPADV  LIDQLERHCLAPDGSL+++S + DLQLAREEM++ER RYL
Sbjct  1    MVKTLQGAAQNLPADVNHLIDQLERHCLAPDGSLVTKSAFYDLQLAREEMSRERLRYL  58



>gb|KGN44163.1| hypothetical protein Csa_7G210080 [Cucumis sativus]
Length=430

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L  G  NLP DVTQ+IDQLERHCLAPDGSL+S+  + DLQLAREEM++ER RYL
Sbjct  1    MVKSLQGGGQNLPTDVTQVIDQLERHCLAPDGSLVSKPAHYDLQLAREEMSRERLRYL  58



>ref|XP_004139788.1| PREDICTED: uncharacterized protein LOC101203307 [Cucumis sativus]
 ref|XP_004166476.1| PREDICTED: uncharacterized LOC101203307 [Cucumis sativus]
Length=438

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L  G  NLP DVTQ+IDQLERHCLAPDGSL+S+  + DLQLAREEM++ER RYL
Sbjct  1    MVKSLQGGGQNLPTDVTQVIDQLERHCLAPDGSLVSKPAHYDLQLAREEMSRERLRYL  58



>ref|XP_007020816.1| HAUS augmin-like complex subunit 4 isoform 2 [Theobroma cacao]
 gb|EOY12341.1| HAUS augmin-like complex subunit 4 isoform 2 [Theobroma cacao]
Length=296

 Score = 88.6 bits (218),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 4/58 (7%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK    G  NLPADV Q+IDQLERHCLAPDGSL+S+S Y DLQLAREEM++ER RYL
Sbjct  1    MVK----GGQNLPADVIQVIDQLERHCLAPDGSLVSKSAYYDLQLAREEMSRERLRYL  54



>gb|KJB62819.1| hypothetical protein B456_009G438400 [Gossypium raimondii]
Length=389

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 4/58 (7%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK    G  NLPADV QLIDQLERHCL+PDGSLIS+S Y DLQLAREEM++ER RYL
Sbjct  1    MVK----GGQNLPADVIQLIDQLERHCLSPDGSLISKSAYYDLQLAREEMSRERLRYL  54



>ref|XP_007020817.1| HAUS augmin-like complex subunit 4 isoform 3 [Theobroma cacao]
 gb|EOY12342.1| HAUS augmin-like complex subunit 4 isoform 3 [Theobroma cacao]
Length=313

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 4/58 (7%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK    G  NLPADV Q+IDQLERHCLAPDGSL+S+S Y DLQLAREEM++ER RYL
Sbjct  1    MVK----GGQNLPADVIQVIDQLERHCLAPDGSLVSKSAYYDLQLAREEMSRERLRYL  54



>ref|XP_011095401.1| PREDICTED: uncharacterized protein LOC105174869 [Sesamum indicum]
Length=433

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  371  GAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
             A NLPADV+Q++D LERHCLAPDGSLIS+STY DLQLAREEM KERQRYL
Sbjct  6    AAQNLPADVSQVMDLLERHCLAPDGSLISKSTYYDLQLAREEMCKERQRYL  56



>gb|KJB62817.1| hypothetical protein B456_009G438400 [Gossypium raimondii]
Length=402

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 4/58 (7%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK    G  NLPADV QLIDQLERHCL+PDGSLIS+S Y DLQLAREEM++ER RYL
Sbjct  1    MVK----GGQNLPADVIQLIDQLERHCLSPDGSLISKSAYYDLQLAREEMSRERLRYL  54



>ref|XP_002280015.1| PREDICTED: uncharacterized protein LOC100253742 [Vitis vinifera]
 emb|CBI26640.3| unnamed protein product [Vitis vinifera]
Length=437

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +2

Query  368  AGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            AG  NLPADVT LIDQLERHCLAPDGSL+S+S Y DLQLAREEM +ER RY 
Sbjct  9    AGGQNLPADVTALIDQLERHCLAPDGSLVSKSAYYDLQLAREEMARERLRYF  60



>ref|XP_006365955.1| PREDICTED: uncharacterized protein LOC102604282 [Solanum tuberosum]
Length=433

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  GAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            G G+ NLPADVTQLIDQL+RHCLA DGSLIS+S + DLQLARE+M+KERQRYL
Sbjct  4    GLGSQNLPADVTQLIDQLDRHCLAHDGSLISKSAHYDLQLAREDMSKERQRYL  56



>ref|XP_006452374.1| hypothetical protein CICLE_v10008353mg [Citrus clementina]
 ref|XP_006475067.1| PREDICTED: uncharacterized protein LOC102629463 [Citrus sinensis]
 gb|ESR65614.1| hypothetical protein CICLE_v10008353mg [Citrus clementina]
 gb|KDO62727.1| hypothetical protein CISIN_1g014093mg [Citrus sinensis]
Length=431

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L  G  NLPADV+Q+ID LERHCLAPDGSL+S+S + DLQLAREEM++ER RYL
Sbjct  1    MVKGLQGGDQNLPADVSQVIDLLERHCLAPDGSLVSKSAHYDLQLAREEMSRERLRYL  58



>ref|XP_008228485.1| PREDICTED: uncharacterized protein LOC103327892 [Prunus mume]
Length=433

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L     NLP D+TQ+IDQLERHCLAPDGSL+S+S Y DLQLAREEM++ER RYL
Sbjct  1    MVKGLQQQGQNLPPDLTQVIDQLERHCLAPDGSLVSKSAYFDLQLAREEMSRERLRYL  58



>ref|XP_007215411.1| hypothetical protein PRUPE_ppa005986mg [Prunus persica]
 gb|EMJ16610.1| hypothetical protein PRUPE_ppa005986mg [Prunus persica]
Length=433

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L     NLP D+TQ+IDQLERHCLAPDGSL+S+S Y DLQLAREEM++ER RYL
Sbjct  1    MVKGLQQQGQNLPPDLTQVIDQLERHCLAPDGSLVSKSAYFDLQLAREEMSRERLRYL  58



>ref|XP_006452375.1| hypothetical protein CICLE_v10008353mg [Citrus clementina]
 gb|ESR65615.1| hypothetical protein CICLE_v10008353mg [Citrus clementina]
Length=406

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L  G  NLPADV+Q+ID LERHCLAPDGSL+S+S + DLQLAREEM++ER RYL
Sbjct  1    MVKGLQGGDQNLPADVSQVIDLLERHCLAPDGSLVSKSAHYDLQLAREEMSRERLRYL  58



>gb|KHG14666.1| HAUS augmin-like complex subunit 4 [Gossypium arboreum]
Length=360

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 4/58 (7%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK    G  NLPADV Q+IDQLERHCL+PDGSLIS+S Y DLQLAREEM++ER RYL
Sbjct  1    MVK----GVQNLPADVIQVIDQLERHCLSPDGSLISKSAYYDLQLAREEMSRERLRYL  54



>gb|KJB62818.1| hypothetical protein B456_009G438400 [Gossypium raimondii]
Length=425

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 4/58 (7%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK    G  NLPADV QLIDQLERHCL+PDGSLIS+S Y DLQLAREEM++ER RYL
Sbjct  1    MVK----GGQNLPADVIQLIDQLERHCLSPDGSLISKSAYYDLQLAREEMSRERLRYL  54



>ref|XP_004302887.1| PREDICTED: uncharacterized protein LOC101313133 [Fragaria vesca 
subsp. vesca]
Length=434

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK     A NLPAD+TQ+IDQLERHCLAPD SL+S+S Y DLQLAREEM+KER RYL
Sbjct  1    MVKGGVQQAQNLPADLTQVIDQLERHCLAPDASLVSKSAYYDLQLAREEMSKERLRYL  58



>ref|XP_007020815.1| HAUS augmin-like complex subunit 4 isoform 1 [Theobroma cacao]
 gb|EOY12340.1| HAUS augmin-like complex subunit 4 isoform 1 [Theobroma cacao]
Length=420

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 4/58 (7%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK    G  NLPADV Q+IDQLERHCLAPDGSL+S+S Y DLQLAREEM++ER RYL
Sbjct  1    MVK----GGQNLPADVIQVIDQLERHCLAPDGSLVSKSAYYDLQLAREEMSRERLRYL  54



>gb|KJB62821.1| hypothetical protein B456_009G438500 [Gossypium raimondii]
Length=418

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 48/58 (83%), Gaps = 4/58 (7%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK    G  NLPADV Q+IDQLERHCL+PDGSLIS+S Y DLQLAREEM++ER RYL
Sbjct  1    MVK----GGQNLPADVIQIIDQLERHCLSPDGSLISKSAYYDLQLAREEMSRERLRYL  54



>emb|CDP04568.1| unnamed protein product [Coffea canephora]
Length=427

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  GAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            G GA NL AD  QL DQLERHCLAPDGSLIS+ST+ DLQLAREEM KERQRYL
Sbjct  4    GIGAQNLGADAIQLSDQLERHCLAPDGSLISKSTHYDLQLAREEMCKERQRYL  56



>emb|CDP05762.1| unnamed protein product [Coffea canephora]
Length=427

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  GAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            G  A NL ADV QL+DQLERHCLAPDGSLI++ST+ DLQLAREEM KERQRYL
Sbjct  4    GIAAQNLGADVIQLLDQLERHCLAPDGSLIAKSTHYDLQLAREEMCKERQRYL  56



>ref|XP_010063011.1| PREDICTED: uncharacterized protein LOC104450241 [Eucalyptus grandis]
 gb|KCW70186.1| hypothetical protein EUGRSUZ_F03470 [Eucalyptus grandis]
Length=436

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  380  NLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            NLPADV+QL+DQLERHCLAPDGSL+S+S Y DLQLAREEM++ER RYL
Sbjct  13   NLPADVSQLVDQLERHCLAPDGSLVSKSAYYDLQLAREEMSRERLRYL  60



>gb|KEH27911.1| SKIP interacting protein [Medicago truncatula]
Length=223

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK  G  + NLP DV+QLIDQLERHCLAPDGSLIS+  Y DLQLAREEM +E+ RYL
Sbjct  1    MVK--GLHSQNLPTDVSQLIDQLERHCLAPDGSLISKPLYNDLQLAREEMCREKLRYL  56



>gb|EYU27337.1| hypothetical protein MIMGU_mgv1a006702mg [Erythranthe guttata]
Length=434

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  371  GAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
               NLPADV+ ++DQLERHCLAPDGSLIS+S Y DLQLAREEM KERQRYL
Sbjct  6    ATQNLPADVSLVMDQLERHCLAPDGSLISKSAYYDLQLAREEMCKERQRYL  56



>gb|ACJ84282.1| unknown [Medicago truncatula]
Length=393

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK  G  + NLP DV+QLIDQLERHCLAPDGSLIS+  Y DLQLAREEM +ER RYL
Sbjct  1    MVK--GLHSQNLPTDVSQLIDQLERHCLAPDGSLISKPLYNDLQLAREEMCRERLRYL  56



>ref|XP_008226895.1| PREDICTED: HAUS augmin-like complex subunit 4 isoform X2 [Prunus 
mume]
Length=414

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +2

Query  350  MVKELG-AGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   G  NLP DVT LIDQLERHCLAPD SL+S+S Y DLQLAREEM+ ER RYL
Sbjct  1    MVKGLQLPGQQNLPPDVTHLIDQLERHCLAPDASLVSKSAYFDLQLAREEMSNERLRYL  59



>ref|XP_008226894.1| PREDICTED: HAUS augmin-like complex subunit 4 isoform X1 [Prunus 
mume]
Length=415

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +2

Query  350  MVKELG-AGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   G  NLP DVT LIDQLERHCLAPD SL+S+S Y DLQLAREEM+ ER RYL
Sbjct  1    MVKGLQLPGQQNLPPDVTHLIDQLERHCLAPDASLVSKSAYFDLQLAREEMSNERLRYL  59



>ref|XP_003600108.1| HAUS augmin-like complex subunit [Medicago truncatula]
 gb|AES70359.1| SKIP interacting protein [Medicago truncatula]
Length=424

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK  G  + NLP DV+QLIDQLERHCLAPDGSLIS+  Y DLQLAREEM +ER RYL
Sbjct  1    MVK--GLHSQNLPTDVSQLIDQLERHCLAPDGSLISKPLYNDLQLAREEMCRERLRYL  56



>ref|XP_008342667.1| PREDICTED: uncharacterized protein LOC103405443 [Malus domestica]
Length=430

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  380  NLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            NLP+D+TQ+IDQLERHCLAPDGSL+S+S Y DLQLAREEM++ER RYL
Sbjct  12   NLPSDLTQVIDQLERHCLAPDGSLVSKSAYFDLQLAREEMSRERLRYL  59



>ref|XP_009338054.1| PREDICTED: uncharacterized protein LOC103930437 [Pyrus x bretschneideri]
 ref|XP_009338055.1| PREDICTED: uncharacterized protein LOC103930438 [Pyrus x bretschneideri]
Length=430

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +2

Query  380  NLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            NLP+D+TQ+IDQLERHCLAPDGSL+S+S Y DLQLAREEM++ER RYL
Sbjct  12   NLPSDLTQVIDQLERHCLAPDGSLVSKSAYFDLQLAREEMSRERLRYL  59



>ref|XP_007213462.1| hypothetical protein PRUPE_ppa024388mg [Prunus persica]
 gb|EMJ14661.1| hypothetical protein PRUPE_ppa024388mg [Prunus persica]
Length=414

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +2

Query  350  MVKELG-AGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   G  NLP DVT LIDQLERHCLAPD SL+S+S Y DLQLAREEM+ ER RYL
Sbjct  1    MVKGLQLPGQQNLPPDVTHLIDQLERHCLAPDASLVSKSAYFDLQLAREEMSNERLRYL  59



>ref|XP_010670158.1| PREDICTED: uncharacterized protein LOC104887254 [Beta vulgaris 
subsp. vulgaris]
Length=430

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK  G    NLPADVTQL++QLERHCLA DGSL+S+S Y DLQLAREEM +ER RYL
Sbjct  1    MVK--GLQQQNLPADVTQLVEQLERHCLASDGSLVSKSAYSDLQLAREEMCRERLRYL  56



>gb|KEH27912.1| SKIP interacting protein [Medicago truncatula]
Length=424

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 47/58 (81%), Gaps = 2/58 (3%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK  G  + NLP DV+QLIDQLERHCLAPDGSLIS+  Y DLQLAREEM +E+ RYL
Sbjct  1    MVK--GLHSQNLPTDVSQLIDQLERHCLAPDGSLISKPLYNDLQLAREEMCREKLRYL  56



>ref|XP_009353594.1| PREDICTED: uncharacterized protein LOC103944849 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009353595.1| PREDICTED: uncharacterized protein LOC103944849 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009353596.1| PREDICTED: uncharacterized protein LOC103944849 isoform X1 [Pyrus 
x bretschneideri]
Length=435

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  380  NLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            NLP+D+TQ+IDQLERHCLAPDGSL+S+S Y DLQL REEM++ER RYL
Sbjct  12   NLPSDLTQVIDQLERHCLAPDGSLVSKSAYLDLQLGREEMSRERLRYL  59



>ref|XP_010278680.1| PREDICTED: uncharacterized protein LOC104612800 [Nelumbo nucifera]
 ref|XP_010278681.1| PREDICTED: uncharacterized protein LOC104612800 [Nelumbo nucifera]
Length=434

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  GAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            G     LPADVTQLI+QLERHCLAPDGS++S+S Y DLQLAREE+++ER RYL
Sbjct  4    GLQVQGLPADVTQLIEQLERHCLAPDGSMVSKSAYYDLQLAREELSRERLRYL  56



>ref|XP_010097813.1| hypothetical protein L484_000961 [Morus notabilis]
 gb|EXB72071.1| hypothetical protein L484_000961 [Morus notabilis]
Length=408

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L  G  NLPADVTQ+I+QLERHCLA DGSL+S+S + DLQLAREEM +ER RYL
Sbjct  1    MVKGLQQG-QNLPADVTQVIEQLERHCLAADGSLVSKSAHYDLQLAREEMARERLRYL  57



>ref|XP_002532562.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29823.1| conserved hypothetical protein [Ricinus communis]
Length=432

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 3/58 (5%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK  G     +PADV Q+IDQLERHCLAPDGSLIS+S Y DLQLAREEM +ER RYL
Sbjct  1    MVKGTG---QTMPADVAQVIDQLERHCLAPDGSLISKSAYYDLQLAREEMCRERLRYL  55



>ref|XP_011012481.1| PREDICTED: uncharacterized protein LOC105116724 [Populus euphratica]
Length=430

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK  G     L ADV+Q+IDQLERHCLAPDGSL+S+S + DLQLAREEM++ER RYL
Sbjct  1    MVKGGGLQNPGLAADVSQVIDQLERHCLAPDGSLVSKSAFSDLQLAREEMSRERLRYL  58



>ref|XP_004500070.1| PREDICTED: uncharacterized protein LOC101512734 [Cicer arietinum]
Length=431

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK  G    NLP DV Q++DQLERHCLAPDGSLIS+  Y DLQLAREEM +ER RYL
Sbjct  1    MVK--GLHGQNLPTDVAQVVDQLERHCLAPDGSLISKPLYNDLQLAREEMCRERLRYL  56



>ref|XP_003551881.1| PREDICTED: uncharacterized protein LOC100790889 [Glycine max]
 gb|KHN02840.1| HAUS augmin-like complex subunit 4 [Glycine soja]
Length=425

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 45/58 (78%), Gaps = 2/58 (3%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK  G    NLPADV Q++DQLERHC APDGSLIS+  + DLQLAREEM +ER RYL
Sbjct  1    MVK--GLHGQNLPADVAQVVDQLERHCFAPDGSLISRPLFNDLQLAREEMCRERLRYL  56



>ref|XP_008380933.1| PREDICTED: uncharacterized protein LOC103443814 [Malus domestica]
Length=455

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  380  NLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            NLP+D+TQ+IDQLERHCLA DGSL+S+S Y DLQLAREEM++ER RYL
Sbjct  12   NLPSDLTQVIDQLERHCLASDGSLVSKSAYLDLQLAREEMSRERLRYL  59



>ref|XP_008781274.1| PREDICTED: uncharacterized protein LOC103701092 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008781275.1| PREDICTED: uncharacterized protein LOC103701092 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008781276.1| PREDICTED: uncharacterized protein LOC103701092 isoform X1 [Phoenix 
dactylifera]
Length=434

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  GAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
             A + +LPADVT LIDQLERHCLAPDGS +S+S + DLQLARE+M +ER RYL
Sbjct  4    NAQSQSLPADVTHLIDQLERHCLAPDGSYVSKSAHADLQLAREDMARERTRYL  56



>ref|XP_008781277.1| PREDICTED: uncharacterized protein LOC103701092 isoform X2 [Phoenix 
dactylifera]
Length=433

 Score = 81.3 bits (199),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  GAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
             A + +LPADVT LIDQLERHCLAPDGS +S+S + DLQLARE+M +ER RYL
Sbjct  4    NAQSQSLPADVTHLIDQLERHCLAPDGSYVSKSAHADLQLAREDMARERTRYL  56



>gb|KHM99560.1| HAUS augmin-like complex subunit 4 [Glycine soja]
Length=425

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 44/58 (76%), Gaps = 2/58 (3%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK  G    NLPA V QL+DQLERHC APDGSLIS+  + DLQLAREEM +ER RYL
Sbjct  1    MVK--GLHGQNLPAHVAQLVDQLERHCFAPDGSLISKPLFNDLQLAREEMCRERLRYL  56



>ref|NP_001242486.1| uncharacterized protein LOC100786070 [Glycine max]
 gb|ACU20702.1| unknown [Glycine max]
Length=425

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 44/58 (76%), Gaps = 2/58 (3%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK  G    NLPA V QL+DQLERHC APDGSLIS+  + DLQLAREEM +ER RYL
Sbjct  1    MVK--GLHGQNLPAHVAQLVDQLERHCFAPDGSLISKPLFNDLQLAREEMCRERLRYL  56



>ref|XP_010935260.1| PREDICTED: uncharacterized protein LOC105055203 isoform X2 [Elaeis 
guineensis]
Length=435

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  GAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
             A + +LPADVT LIDQLERH LAPDGS +S+S + DLQLAREEM +ER RYL
Sbjct  4    NAQSQSLPADVTHLIDQLERHSLAPDGSYVSKSAHADLQLAREEMARERTRYL  56



>ref|XP_010935259.1| PREDICTED: uncharacterized protein LOC105055203 isoform X1 [Elaeis 
guineensis]
Length=436

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  GAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
             A + +LPADVT LIDQLERH LAPDGS +S+S + DLQLAREEM +ER RYL
Sbjct  4    NAQSQSLPADVTHLIDQLERHSLAPDGSYVSKSAHADLQLAREEMARERTRYL  56



>gb|ABK96275.1| unknown [Populus trichocarpa x Populus deltoides]
Length=429

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK  G     L ADV+Q+IDQLERHCLAPDGSL+S+S + DLQLARE+M++ER RYL
Sbjct  1    MVKG-GVQNPGLAADVSQVIDQLERHCLAPDGSLVSKSAFSDLQLAREDMSRERLRYL  57



>ref|XP_009420825.1| PREDICTED: uncharacterized protein LOC104000482 [Musa acuminata 
subsp. malaccensis]
Length=434

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  380  NLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            NLP DV  L+DQLERHCLAPDGS +S++ + DLQLAREEM++ER RYL
Sbjct  9    NLPVDVAHLVDQLERHCLAPDGSHVSKAAFSDLQLAREEMSRERMRYL  56



>ref|XP_009144940.1| PREDICTED: uncharacterized protein LOC103868607 [Brassica rapa]
 emb|CDY29600.1| BnaA05g15700D [Brassica napus]
Length=406

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 45/58 (78%), Gaps = 5/58 (9%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK L   A     DV QL+DQLERHCLAPDGSL+++S Y DLQLAREEM++ER RYL
Sbjct  1    MVKALQGAA-----DVNQLMDQLERHCLAPDGSLVTKSAYYDLQLAREEMSRERLRYL  53



>ref|XP_006858187.1| hypothetical protein AMTR_s00062p00162950 [Amborella trichopoda]
 gb|ERN19654.1| hypothetical protein AMTR_s00062p00162950 [Amborella trichopoda]
Length=435

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            M K +  G  +LP+D++QLI+QLERHCLAPDGS   +S+Y DLQLAREEM++ER  YL
Sbjct  1    MAKPVILGQQSLPSDISQLIEQLERHCLAPDGSGTCKSSYYDLQLAREEMSRERLYYL  58



>ref|XP_009360992.1| PREDICTED: uncharacterized protein LOC103951362 isoform X1 [Pyrus 
x bretschneideri]
Length=409

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +2

Query  374  AHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
              NLP DV  ++DQLERHCLAPDGSL S+S Y DLQLAREEM +ER RYL
Sbjct  10   GQNLPPDVAHVVDQLERHCLAPDGSLGSKSAYYDLQLAREEMCRERIRYL  59



>ref|XP_008355341.1| PREDICTED: uncharacterized protein LOC103418998 [Malus domestica]
Length=195

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  374  AHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
              NLP DV  ++DQLERHCLAPDGSL S+S Y DLQLARE M  ER RYL
Sbjct  10   GQNLPPDVAHVVDQLERHCLAPDGSLGSKSAYYDLQLAREAMCGERIRYL  59



>ref|XP_010276096.1| PREDICTED: uncharacterized protein LOC104610933 [Nelumbo nucifera]
Length=430

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  365  GAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            G     L ADVTQLI+QLERHCLAPDGS+ S+S Y DLQLAREEM +ER  YL
Sbjct  4    GLQTEGLAADVTQLIEQLERHCLAPDGSMTSKSAYYDLQLAREEMLRERLHYL  56



>ref|XP_007146480.1| hypothetical protein PHAVU_006G044000g [Phaseolus vulgaris]
 gb|ESW18474.1| hypothetical protein PHAVU_006G044000g [Phaseolus vulgaris]
Length=425

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 43/58 (74%), Gaps = 2/58 (3%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK  G    +LPADV Q++D LERHC A DGSLIS+  + DLQLAREEM +ER RYL
Sbjct  1    MVK--GLHGQSLPADVAQVVDHLERHCFASDGSLISKPLFNDLQLAREEMCRERLRYL  56



>ref|XP_008365005.1| PREDICTED: HAUS augmin-like complex subunit 4 [Malus domestica]
Length=409

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  380  NLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            NLP DV  ++DQLERHCLAPDGSL S+S Y DLQLARE M  ER RYL
Sbjct  12   NLPPDVAHVVDQLERHCLAPDGSLGSKSAYYDLQLAREAMCGERIRYL  59



>gb|KHG12191.1| Macrophage receptor MARCO [Gossypium arboreum]
Length=213

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 4/46 (9%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLA  487
            MVK    G  NLPAD+ Q+IDQLERHCL+PDGSLIS+S Y DLQLA
Sbjct  1    MVK----GGQNLPADIIQVIDQLERHCLSPDGSLISKSAYYDLQLA  42



>gb|KHG12190.1| Paternally-expressed gene 3 protein [Gossypium arboreum]
Length=242

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 4/46 (9%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLA  487
            MVK    G  NLPAD+ Q+IDQLERHCL+PDGSLIS+S Y DLQLA
Sbjct  1    MVK----GGQNLPADIIQVIDQLERHCLSPDGSLISKSAYYDLQLA  42



>ref|XP_004295822.1| PREDICTED: uncharacterized protein LOC101299752 [Fragaria vesca 
subsp. vesca]
Length=409

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +2

Query  392  DVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            D++Q+ID L RHC APD SL+S+STY +LQLAREEM +ER RYL
Sbjct  15   DLSQVIDHLARHCFAPDDSLVSKSTYYNLQLAREEMCRERLRYL  58



>ref|XP_001768748.1| predicted protein [Physcomitrella patens]
 gb|EDQ66480.1| predicted protein [Physcomitrella patens]
Length=433

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +2

Query  350  MVKE--LGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            MVK   L A A  L   V+ L+DQLERHCLAPD SL+S+  Y DL  AREEM +ER RYL
Sbjct  1    MVKAMLLPAPATALGQGVSALLDQLERHCLAPDASLVSKPAYLDLLQAREEMARERLRYL  60



>ref|XP_002316767.2| hypothetical protein POPTR_0011s09280g [Populus trichocarpa]
 gb|EEE97379.2| hypothetical protein POPTR_0011s09280g [Populus trichocarpa]
Length=376

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +2

Query  350  MVKELGAGAHNLPADVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEM  499
            MVK  G     L ADV+Q+IDQLERHCLAPDGSL+S+S + DLQL  E +
Sbjct  1    MVKG-GVQNPGLAADVSQVIDQLERHCLAPDGSLVSKSAFSDLQLVYETL  49



>ref|XP_002989789.1| hypothetical protein SELMODRAFT_235871 [Selaginella moellendorffii]
 gb|EFJ09056.1| hypothetical protein SELMODRAFT_235871 [Selaginella moellendorffii]
Length=392

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  395  VTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            + QL++QL RHCLAPDGS ++++ Y DL  AREEM +ER R+L
Sbjct  6    LAQLVEQLNRHCLAPDGSYVAKAAYYDLVQAREEMGRERLRFL  48



>ref|XP_002990133.1| hypothetical protein SELMODRAFT_235950 [Selaginella moellendorffii]
 gb|EFJ08850.1| hypothetical protein SELMODRAFT_235950 [Selaginella moellendorffii]
Length=401

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  395  VTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            + QL++QL RHCLAPDGS ++++ Y DL  AREEM +ER R+L
Sbjct  6    LAQLVEQLNRHCLAPDGSYVAKAAYYDLVQAREEMGRERLRFL  48



>ref|XP_003573417.1| PREDICTED: uncharacterized protein LOC100821831 [Brachypodium 
distachyon]
Length=419

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  392  DVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            +V  L++QL+RH LAPD SL+S S + DL  AREE+  ER RYL
Sbjct  16   EVAHLVEQLQRHHLAPDASLLSTSAHSDLLQAREEVAAERARYL  59



>gb|EAZ21518.1| hypothetical protein OsJ_05142 [Oryza sativa Japonica Group]
Length=428

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  392  DVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            +V  L+DQL+RH LAPD SL+S   + DL  AREE+  ER RYL
Sbjct  16   EVAHLVDQLQRHHLAPDASLLSSCAHSDLLQAREEVASERARYL  59



>ref|XP_002453194.1| hypothetical protein SORBIDRAFT_04g001450 [Sorghum bicolor]
 gb|EES06170.1| hypothetical protein SORBIDRAFT_04g001450 [Sorghum bicolor]
Length=424

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  392  DVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            +V  L++QL+RH LAPD SL+S S + DL  AREE+  ER  YL
Sbjct  15   EVAHLVEQLQRHHLAPDASLLSNSAHSDLLQAREEVAAERALYL  58



>ref|XP_004952114.1| PREDICTED: uncharacterized protein LOC101756520 [Setaria italica]
Length=425

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  392  DVTQLIDQLERHCLAPDGSLISQSTYCDLQLAREEMTKERQRYL  523
            +V  L++QL+RH LAPD SL+S S + DL  AREE+  ER  YL
Sbjct  16   EVAHLVEQLQRHHLAPDASLLSNSAHSDLLQAREEVAAERALYL  59



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600