BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF046H19

Length=573
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009787672.1|  PREDICTED: BEL1-like homeodomain protein 1         109   5e-24   Nicotiana sylvestris
ref|XP_009628712.1|  PREDICTED: BEL1-like homeodomain protein 1         105   1e-22   Nicotiana tomentosiformis
emb|CDP10596.1|  unnamed protein product                              92.4    3e-18   Coffea canephora [robusta coffee]
gb|KEH41936.1|  BEL1-related homeotic protein                         90.5    2e-17   Medicago truncatula
ref|XP_003519115.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  88.6    7e-17   Glycine max [soybeans]
ref|XP_003535815.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  88.6    8e-17   Glycine max [soybeans]
ref|XP_011094236.1|  PREDICTED: BEL1-like homeodomain protein 1       87.4    2e-16   
ref|XP_006348466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  87.0    3e-16   Solanum tuberosum [potatoes]
ref|XP_004497655.1|  PREDICTED: BEL1-like homeodomain protein 1-like  84.0    3e-15   Cicer arietinum [garbanzo]
dbj|BAE71188.1|  BEL1-like homeodomain transcription factor           83.2    6e-15   Trifolium pratense [peavine clover]
ref|XP_010263012.1|  PREDICTED: BEL1-like homeodomain protein 1       82.0    1e-14   Nelumbo nucifera [Indian lotus]
ref|XP_010247184.1|  PREDICTED: BEL1-like homeodomain protein 1       78.6    2e-13   
ref|XP_004228612.1|  PREDICTED: BEL1-like homeodomain protein 1       77.4    4e-13   Solanum lycopersicum
ref|XP_009420594.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  75.1    2e-12   
ref|XP_008784116.1|  PREDICTED: BEL1-like homeodomain protein 1       75.1    3e-12   Phoenix dactylifera
gb|KDP36113.1|  hypothetical protein JCGZ_08757                       75.1    3e-12   Jatropha curcas
ref|XP_007162972.1|  hypothetical protein PHAVU_001G195800g           74.7    3e-12   Phaseolus vulgaris [French bean]
gb|EPS74374.1|  hypothetical protein M569_00381                       73.9    3e-12   Genlisea aurea
ref|XP_010912386.1|  PREDICTED: BEL1-like homeodomain protein 1       74.3    5e-12   
ref|XP_007027982.1|  BEL1-like homeodomain protein 1 isoform 1        74.3    5e-12   
ref|XP_003521496.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  72.4    2e-11   Glycine max [soybeans]
ref|XP_002266838.1|  PREDICTED: BEL1-like homeodomain protein 1       72.0    3e-11   Vitis vinifera
ref|XP_004494251.1|  PREDICTED: BEL1-like homeodomain protein 1-like  72.0    3e-11   Cicer arietinum [garbanzo]
ref|XP_009404911.1|  PREDICTED: BEL1-like homeodomain protein 1       72.0    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN63083.1|  hypothetical protein VITISV_015358                   72.0    3e-11   Vitis vinifera
ref|XP_008442920.1|  PREDICTED: BEL1-like homeodomain protein 1       71.6    4e-11   Cucumis melo [Oriental melon]
gb|KHN08605.1|  BEL1-like homeodomain protein 1                       69.3    2e-10   Glycine soja [wild soybean]
gb|KJB62029.1|  hypothetical protein B456_009G396900                  69.3    2e-10   Gossypium raimondii
ref|XP_003554466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  69.3    2e-10   Glycine max [soybeans]
ref|XP_007145789.1|  hypothetical protein PHAVU_007G267900g           68.6    4e-10   Phaseolus vulgaris [French bean]
emb|CBI24428.3|  unnamed protein product                              67.8    6e-10   Vitis vinifera
ref|XP_002275098.1|  PREDICTED: BEL1-like homeodomain protein 1       68.2    6e-10   Vitis vinifera
ref|XP_011467196.1|  PREDICTED: BEL1-like homeodomain protein 1       67.8    7e-10   Fragaria vesca subsp. vesca
emb|CAN69527.1|  hypothetical protein VITISV_027380                   67.8    8e-10   Vitis vinifera
ref|XP_004136516.1|  PREDICTED: BEL1-like homeodomain protein 1-like  66.6    2e-09   
ref|XP_004171976.1|  PREDICTED: BEL1-like homeodomain protein 1-like  66.6    2e-09   
ref|XP_010107002.1|  hypothetical protein L484_016932                 63.9    3e-09   
ref|XP_002524053.1|  bel1 homeotic protein, putative                  65.1    5e-09   Ricinus communis
gb|KHG11906.1|  BEL1-like homeodomain protein 1                       64.7    6e-09   Gossypium arboreum [tree cotton]
ref|XP_008449596.1|  PREDICTED: BEL1-like homeodomain protein 1       63.5    2e-08   
ref|XP_009403681.1|  PREDICTED: BEL1-like homeodomain protein 1       62.8    2e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG11905.1|  BEL1-like homeodomain protein 1                       62.8    2e-08   Gossypium arboreum [tree cotton]
gb|EYU25630.1|  hypothetical protein MIMGU_mgv11b017830mg             61.6    3e-08   Erythranthe guttata [common monkey flower]
ref|XP_010059079.1|  PREDICTED: BEL1-like homeodomain protein 1       61.2    8e-08   Eucalyptus grandis [rose gum]
gb|KJB36260.1|  hypothetical protein B456_006G149100                  61.2    9e-08   Gossypium raimondii
ref|XP_004140170.1|  PREDICTED: BEL1-like homeodomain protein 1-like  60.1    2e-07   
gb|KHG01894.1|  BEL1-like homeodomain protein 1                       60.1    2e-07   Gossypium arboreum [tree cotton]
ref|XP_011090301.1|  PREDICTED: BEL1-like homeodomain protein 1       59.3    3e-07   Sesamum indicum [beniseed]
gb|KHG12856.1|  BEL1-like homeodomain protein 1                       58.2    8e-07   Gossypium arboreum [tree cotton]
gb|KHG12855.1|  BEL1-like homeodomain protein 1                       58.2    8e-07   Gossypium arboreum [tree cotton]
ref|XP_008391977.1|  PREDICTED: BEL1-like homeodomain protein 1       58.2    9e-07   
ref|XP_008387112.1|  PREDICTED: BEL1-like homeodomain protein 1       58.2    1e-06   
gb|KJB55565.1|  hypothetical protein B456_009G082700                  57.8    1e-06   Gossypium raimondii
ref|XP_010031566.1|  PREDICTED: BEL1-like homeodomain protein 1       57.4    1e-06   Eucalyptus grandis [rose gum]
ref|XP_008360598.1|  PREDICTED: BEL1-like homeodomain protein 1       57.4    2e-06   
gb|KJB09137.1|  hypothetical protein B456_001G125400                  57.0    2e-06   Gossypium raimondii
ref|XP_008799712.1|  PREDICTED: BEL1-like homeodomain protein 1       57.0    2e-06   Phoenix dactylifera
ref|XP_007204250.1|  hypothetical protein PRUPE_ppa002158mg           57.0    2e-06   
ref|XP_008241058.1|  PREDICTED: BEL1-like homeodomain protein 1       55.8    5e-06   Prunus mume [ume]
ref|XP_007015671.1|  BEL1 homeodomain 1, putative                     55.5    6e-06   
gb|KJB35453.1|  hypothetical protein B456_006G115600                  55.5    7e-06   Gossypium raimondii
gb|KHF99976.1|  BEL1-like homeodomain protein 1                       55.1    8e-06   Gossypium arboreum [tree cotton]
ref|XP_009348973.1|  PREDICTED: BEL1-like homeodomain protein 1       54.7    1e-05   Pyrus x bretschneideri [bai li]
gb|KEH24245.1|  BEL1-related homeotic protein                         53.1    4e-05   Medicago truncatula
gb|KJB16539.1|  hypothetical protein B456_002G234900                  52.8    5e-05   Gossypium raimondii
ref|XP_009629592.1|  PREDICTED: BEL1-like homeodomain protein 1       52.4    7e-05   Nicotiana tomentosiformis
ref|XP_002450321.1|  hypothetical protein SORBIDRAFT_05g003750        51.2    2e-04   Sorghum bicolor [broomcorn]
emb|CDP15553.1|  unnamed protein product                              51.2    2e-04   Coffea canephora [robusta coffee]
ref|XP_002313498.2|  hypothetical protein POPTR_0009s02250g           51.2    2e-04   
ref|XP_004978737.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  50.8    2e-04   
ref|XP_009141535.1|  PREDICTED: BEL1-like homeodomain protein 1       50.4    3e-04   
gb|KDO70617.1|  hypothetical protein CISIN_1g005514mg                 50.4    3e-04   Citrus sinensis [apfelsine]
ref|XP_006481599.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  50.4    3e-04   Citrus sinensis [apfelsine]
ref|XP_006410764.1|  hypothetical protein EUTSA_v10016349mg           49.7    6e-04   
emb|CDX75085.1|  BnaA05g08310D                                        49.3    8e-04   
emb|CDX84585.1|  BnaA03g16450D                                        48.9    9e-04   
ref|XP_010931060.1|  PREDICTED: BEL1-like homeodomain protein 1       48.9    0.001   Elaeis guineensis



>ref|XP_009787672.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787673.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787674.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
Length=707

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 82/126 (65%), Gaps = 14/126 (11%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQ----PAAGTNFAFLNSITSGGN  367
            MA YF GNSEIQGG DGLQTLILMNPAGY  VGFS+TQ    PA G+N  F NS    GN
Sbjct  1    MAAYFPGNSEIQGGNDGLQTLILMNPAGY--VGFSETQHHQPPAGGSNLVFFNS-NPPGN  57

Query  368  AVTLSHAppppsqsqqFVGIPLATAA----GSHQEAHASAVHSQQHDITALHGFIRSQYN  535
            ++ LSHA  PPS  QQFVGIPLAT+A     S        VHS QHDI+ALHGF+   + 
Sbjct  58   SLNLSHA--PPSSQQQFVGIPLATSAFTAPSSQDGTTTPTVHS-QHDISALHGFLARSHE  114

Query  536  NNMYGP  553
               Y P
Sbjct  115  YGFYNP  120



>ref|XP_009628712.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628714.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628715.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=700

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 79/124 (64%), Gaps = 10/124 (8%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQ--PAAGTNFAFLNSITSGGNAV  373
            MA YF GNSEIQGG DGLQTLILMNPAGY  VGFS+TQ  PA G+N  F NS    GN++
Sbjct  1    MAAYFDGNSEIQGGNDGLQTLILMNPAGY--VGFSETQQPPAGGSNLVFFNS-NPLGNSL  57

Query  374  TLSHAppppsqsqqFVGIPLA----TAAGSHQEAHASAVHSQQHDITALHGFIRSQYNNN  541
             L HA  P SQ QQFVGIPLA    TA  S  +   +     QHDI+ALHGF+   +   
Sbjct  58   NLPHA-RPSSQQQQFVGIPLATSVFTAPSSFPDGTTTPTVHSQHDISALHGFLARSHEYG  116

Query  542  MYGP  553
             Y P
Sbjct  117  FYNP  120



>emb|CDP10596.1| unnamed protein product [Coffea canephora]
Length=680

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 90/140 (64%), Gaps = 29/140 (21%)
 Frame = +2

Query  200  MATYFHGNSEIQGGG--DGLQTLILMNPAGYVNVGFSDT---------QPAAGTNFAFLN  346
            MATYFHGNSEIQGGG   GLQTLILMN AGYV  G+SDT         Q    +NF FLN
Sbjct  1    MATYFHGNSEIQGGGGDHGLQTLILMNHAGYVG-GYSDTHQPPPHVQVQVQPPSNFVFLN  59

Query  347  SITS-------GGNAVTLSHAppppsqsqqFVGIPL-ATAAGSHQE--AHASAVHSQQHD  496
            S  +       G N++ + HAPPPPS +QQFVGIPL ATAA S Q+   HA++V     D
Sbjct  60   SSNTPGPSAAPGANSLNVHHAPPPPSPTQQFVGIPLTATAATSSQDHQPHAASV----QD  115

Query  497  ITALHGFI-RSQYNNNMYGP  553
            I+ALH F+ R QY  N+Y P
Sbjct  116  ISALHAFLPRLQY--NLYSP  133



>gb|KEH41936.1| BEL1-related homeotic protein [Medicago truncatula]
Length=649

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 68/121 (56%), Gaps = 14/121 (12%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFH NSEIQGG DGLQTLI MNP+GY+N   +   P    N  FLNS  +     +L
Sbjct  1    MATYFHNNSEIQGGSDGLQTLIFMNPSGYINYSDAPQPPPHAGNLVFLNSAANHPGNTSL  60

Query  380  SHAppppsqsq--qFVGIPLATAAGSHQEAHASAVHSQQHDITALHGF-IRSQYNNNMYG  550
             H           QFVG+PL+        A   +VH+  HD++ALHGF  R QY  NM+ 
Sbjct  61   HHQQQQSLSHAPPQFVGVPLS--------AEQQSVHA-HHDVSALHGFPPRMQY--NMWN  109

Query  551  P  553
            P
Sbjct  110  P  110



>ref|XP_003519115.1| PREDICTED: BEL1-like homeodomain protein 1-like isoformX1 [Glycine 
max]
 ref|XP_006575286.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006575287.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
Length=664

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 73/113 (65%), Gaps = 10/113 (9%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAA-GTNFAFLNSITSGGNAVT  376
            MATYFH NSEIQ G DGLQTL+LMNP GYV   +SDT P   G N  FLNS     +   
Sbjct  1    MATYFHSNSEIQAGADGLQTLVLMNP-GYVQ--YSDTPPPPHGGNLVFLNSAAGNASLQN  57

Query  377  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-RSQY  532
            LSHA  PP  +QQFVG+PL+ AA        +++H   HD++ALHGF+ R QY
Sbjct  58   LSHA--PPPHTQQFVGVPLSAAAAHEPPPPPASMH---HDVSALHGFLPRMQY  105



>ref|XP_003535815.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006588872.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=661

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 73/114 (64%), Gaps = 14/114 (12%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAA-GTNFAFLNSITSGGNAVT  376
            MATYFH NSEIQ G DGLQTL+LMNP GYV   +SDT P   G N  FLNS     +  +
Sbjct  1    MATYFHSNSEIQAGADGLQTLVLMNP-GYVQ--YSDTPPPPHGGNLVFLNSAAGNASLQS  57

Query  377  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYN  535
            L HA  PP  +QQFVG+PL+ AA    E  AS      HD++ALHGF+ R QYN
Sbjct  58   LPHA--PPPHTQQFVGVPLSAAA---HEPPASM----HHDVSALHGFLPRMQYN  102



>ref|XP_011094236.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
Length=710

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 78/120 (65%), Gaps = 13/120 (11%)
 Frame = +2

Query  200  MATYFHGNSEIQGGG-DGLQTLILMNPAGYVNVGFSDT---QPAAGTNFAFLNSITSGGN  367
            MATYFHGNSEIQGGG DGLQTLILMNPA    VG+SDT   QP   +NF FLNS +SG N
Sbjct  1    MATYFHGNSEIQGGGGDGLQTLILMNPA---YVGYSDTQQQQPPPSSNFVFLNSNSSGNN  57

Query  368  AVTLSHAppppsqsqqFVGIPL---ATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYN  535
               + HA  PP+Q+Q FVG PL    +A        A     QQ D++ALHGF+ R QYN
Sbjct  58   GHNIPHA--PPTQTQHFVGFPLQGTTSAPAPPPAPAAPPQDPQQQDVSALHGFLPRVQYN  115



>ref|XP_006348466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006348467.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Solanum 
tuberosum]
Length=704

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 79/127 (62%), Gaps = 14/127 (11%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQ------PAAGT--NFAFLNSIT  355
            MA+YFHGNSEIQ G DGLQTLILMNP GY  VGFS+TQ      P  G+  N  F NS  
Sbjct  1    MASYFHGNSEIQEGNDGLQTLILMNP-GY--VGFSETQHHHAPPPPGGSSNNIVFFNS-N  56

Query  356  SGGNAVTLSHAppppsqsqq-FVGIPLATAAGSHQEAHASAVHSQQHDITALHGFIRSQY  532
              GN++ LSHAPPPP   QQ FVGIPLATAA +   +  S  ++    I+ALHGF+    
Sbjct  57   PLGNSINLSHAPPPPPPPQQHFVGIPLATAAFT-APSQDSGNNNNNESISALHGFLARSS  115

Query  533  NNNMYGP  553
                Y P
Sbjct  116  QYGFYNP  122



>ref|XP_004497655.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=667

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 67/117 (57%), Gaps = 22/117 (19%)
 Frame = +2

Query  200  MATYFHGNSEIQGG-GDGLQTLILMNPAGYVNVGFSDTQPAAGT---NFAFLNSITSGGN  367
            MATYFH NSEIQGG  DGLQTLI MNP+GY+N  +SDT P       N  FLNS      
Sbjct  1    MATYFHNNSEIQGGSADGLQTLIFMNPSGYIN--YSDTPPQQSQHAGNLVFLNSA-----  53

Query  368  AVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGF-IRSQYN  535
            A T  H         QFVG+PL TA  S Q AH        HDI+ALHGF  R QYN
Sbjct  54   ANTSIHQQNLSHAPPQFVGVPL-TAEQSVQ-AH--------HDISALHGFPPRMQYN  100



>dbj|BAE71188.1| BEL1-like homeodomain transcription factor [Trifolium pratense]
Length=651

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 68/122 (56%), Gaps = 26/122 (21%)
 Frame = +2

Query  200  MATYFHGNSEIQGG-GDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNS-ITSGGNAV  373
            MATYFH NSEIQGG  DGLQTLI MNP+GY+N   +   P    N  FLNS  T  GN  
Sbjct  1    MATYFHNNSEIQGGSADGLQTLIFMNPSGYINYSDTPQPPPHAGNLVFLNSAATLAGNGN  60

Query  374  T-------LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGF-IRSQ  529
            T       LSHA        QFVG+PL  +A    +AH        HDI+ALHGF  R Q
Sbjct  61   TSIQQQHNLSHA------PPQFVGVPL--SAEQSVQAH--------HDISALHGFPPRMQ  104

Query  530  YN  535
            YN
Sbjct  105  YN  106



>ref|XP_010263012.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010263013.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=739

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 75/119 (63%), Gaps = 18/119 (15%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFHG SEIQ   DGLQTL LMNP GY  VG+SDTQP   +N  FLNS  +  N  +L
Sbjct  1    MATYFHGTSEIQ--ADGLQTLYLMNP-GY--VGYSDTQPP--SNMVFLNSAGNTLNPASL  53

Query  380  SHAppppsqsqqFVGIPL------ATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYN  535
            SHA      SQ  VGIPL      A AA + Q+ +  +VHSQQ D++ +HGF+ R  YN
Sbjct  54   SHA---AQTSQHLVGIPLQATAVAAGAAAASQDPNRPSVHSQQ-DMSTIHGFVPRVHYN  108



>ref|XP_010247184.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247191.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247201.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247208.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247219.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247226.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247233.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=729

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 77/120 (64%), Gaps = 19/120 (16%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFHG SEIQ   DGLQTL LMNP GY  VG++DTQP   +N  FLNS  +  N  +L
Sbjct  1    MATYFHGTSEIQ--ADGLQTLYLMNP-GY--VGYTDTQPP--SNMVFLNSTGNTLNPASL  53

Query  380  SHAppppsqsqqFVGIPL-------ATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYN  535
             +A   P Q+Q  VGIPL        +AA + Q+ +  +VH+QQ +++A+HGF+ R  YN
Sbjct  54   VNA---PQQNQHLVGIPLQAAAVPPGSAAAAAQDPNRPSVHNQQ-EMSAVHGFVPRVHYN  109



>ref|XP_004228612.1| PREDICTED: BEL1-like homeodomain protein 1 [Solanum lycopersicum]
Length=700

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 76/129 (59%), Gaps = 15/129 (12%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSD----------TQPAAGTNFAFLNS  349
            MA+YFHGNSEIQ G DGLQTLILMNP GY  VGFS+           Q   G+N  F NS
Sbjct  1    MASYFHGNSEIQEGNDGLQTLILMNP-GY--VGFSEAQHHHAPPPPPQGGGGSNIVFFNS  57

Query  350  ITSGGNAVTLSHA-ppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFIRS  526
                GN++ LSHA PPPPSQ QQFVGIPLATAA +     +   ++     + LHGF+  
Sbjct  58   -NPLGNSINLSHAPPPPPSQQQQFVGIPLATAAFTAPSQDSGNNNNNNESFSGLHGFLAR  116

Query  527  QYNNNMYGP  553
                  Y P
Sbjct  117  SSPYGFYNP  125



>ref|XP_009420594.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Musa acuminata subsp. malaccensis]
Length=669

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 66/113 (58%), Gaps = 13/113 (12%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFHG  EIQ   DGLQTL LMNP+    VG++D   AA  N  FLNS  +  N++ L
Sbjct  1    MATYFHGAPEIQ--PDGLQTLYLMNPS---YVGYTDA--AAPANMVFLNSTMNSVNSINL  53

Query  380  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYN  535
            +       Q Q FVGIPL +AA  H    +  +H+  HD+ A+ G + RS YN
Sbjct  54   AQT----GQQQHFVGIPLQSAAQPHDSHRSQPIHA-SHDVPAVQGLLPRSHYN  101



>ref|XP_008784116.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008784117.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008784118.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=660

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 68/122 (56%), Gaps = 14/122 (11%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFHG  EIQ   DGLQTL LMNP  YV  G+SDT  A G N   LNS+ S      +
Sbjct  1    MATYFHGAPEIQP--DGLQTLYLMNP-NYV--GYSDTAAAQG-NMVLLNSMNSLN---PM  51

Query  380  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFIRSQYNNNMYGPPP  559
            +H      Q Q FVGIPL     SH+      + +  HD++A+HG +  + + N++ P P
Sbjct  52   NH----HQQQQHFVGIPLQPTVASHESNRPQPIQAPAHDVSAIHGLV-PRLHCNLWSPTP  106

Query  560  SS  565
             S
Sbjct  107  PS  108



>gb|KDP36113.1| hypothetical protein JCGZ_08757 [Jatropha curcas]
Length=676

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 71/128 (55%), Gaps = 31/128 (24%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVT-  376
            MATYFHGN EIQ   +GLQTL+LMNP  YV   +SDT P    N  FLN   SG N ++ 
Sbjct  1    MATYFHGNPEIQASAEGLQTLVLMNPT-YVQ--YSDTPPPPSNNLVFLN---SGTNHLSP  54

Query  377  ---LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYNNNM  544
               LSHA   P  +QQFVGIPL     SH            HD +ALHG + R  Y  N+
Sbjct  55   PPHLSHA---PPNTQQFVGIPLDPT--SH------------HDASALHGLVPRIHY--NL  95

Query  545  YGP-PPSS  565
            Y P  PSS
Sbjct  96   YNPIDPSS  103



>ref|XP_007162972.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
 gb|ESW34966.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
Length=679

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 77/121 (64%), Gaps = 17/121 (14%)
 Frame = +2

Query  200  MATYFH-GNSEIQ-GGGDGLQTLILMNPAGYVNVGFSDTQP----AAGTNFAFLNS-ITS  358
            MATYFH GNSEIQ G  DGLQTL+LMNP GY++   + +QP    AAG N  FLNS   +
Sbjct  1    MATYFHHGNSEIQSGAADGLQTLVLMNP-GYIHYSDAPSQPPPSHAAG-NLVFLNSAAVA  58

Query  359  GGNAVTLSHAppppsqsqqFVGIPLATAAG-SHQEAHASAVHSQQHDITALHGFI-RSQY  532
            G N+    +   PPS +QQFVGIPL+ +   +H   HA       HD++ALHGF+ R QY
Sbjct  59   GTNSNNSFNPHAPPSHTQQFVGIPLSASQDLNHHSMHA------HHDVSALHGFLPRMQY  112

Query  533  N  535
            N
Sbjct  113  N  113



>gb|EPS74374.1| hypothetical protein M569_00381 [Genlisea aurea]
Length=404

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 67/115 (58%), Gaps = 21/115 (18%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQP-------AAGTNFAFLNS-IT  355
            M TY+HG+SEIQGGGDGLQTLILMNPA    VG+ D Q        A G NF FLNS   
Sbjct  1    MGTYYHGDSEIQGGGDGLQTLILMNPA---FVGYGDGQQAPPSGAVAQGNNFVFLNSGSA  57

Query  356  SGGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  520
            + G    LSH    P Q+Q FVGIPL      H+   +S       D++ALHGF+
Sbjct  58   AAGVGNNLSHG--APPQTQHFVGIPL------HRPPPSSPQQQ--QDVSALHGFM  102



>ref|XP_010912386.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
Length=663

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 68/122 (56%), Gaps = 15/122 (12%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFHG  EIQ   DGLQTL LMNP  Y  VG+SDT  AA  N   LNS+ S      +
Sbjct  1    MATYFHGTPEIQ--TDGLQTLYLMNP-NY--VGYSDTAAAAPANMVLLNSMNSLN---PI  52

Query  380  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFIRSQYNNNMYGPPP  559
            +H      Q Q FVGIPL     SH+ +    +    HD++ +HG +  + + N++ P P
Sbjct  53   NH-----QQQQHFVGIPLQPTVASHESSRPQPIEV-PHDVSTVHGLV-PRLHCNLWTPTP  105

Query  560  SS  565
            +S
Sbjct  106  AS  107



>ref|XP_007027982.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027983.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027984.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08484.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08485.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08486.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
Length=668

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 68/113 (60%), Gaps = 20/113 (18%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFHGN EIQ   DGLQTL+LMNPA YV   +SDT P    N  FLNS     N+++ 
Sbjct  1    MATYFHGNPEIQ-APDGLQTLVLMNPA-YVQ--YSDTAPPPANNLVFLNS-----NSLS-  50

Query  380  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYN  535
             HA  P   +QQFVGIPL   + ++Q+  +       HDI+ LHG + R  YN
Sbjct  51   PHA--PSPHTQQFVGIPLPATSSANQDPSS-------HDISPLHGLVQRVHYN  94



>ref|XP_003521496.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006577097.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006577098.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
 ref|XP_006577099.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Glycine 
max]
Length=679

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 77/124 (62%), Gaps = 23/124 (19%)
 Frame = +2

Query  200  MATYFH-GNSEIQ-GGGDGLQTLILMNPAGYVNVGFSDTQP------AAGTNFAFLN-SI  352
            MATYFH GNSEIQ GG DGLQTL+LMNP GY++  +SD  P          N  FLN + 
Sbjct  1    MATYFHHGNSEIQSGGADGLQTLVLMNP-GYIH--YSDAPPPQQQTSQTAGNLVFLNPAA  57

Query  353  TSGGNAVTLS-HAppppsqsqqFVGIPLATAAG-SHQEAHASAVHSQQHDITALHGFI-R  523
             +GGN  + + HA  PPS +QQFVGIPL  +   +H   HA       HD++ALHGF+ R
Sbjct  58   VAGGNNNSFNPHA--PPSHTQQFVGIPLPNSQDLNHHSMHA------HHDVSALHGFLPR  109

Query  524  SQYN  535
             QYN
Sbjct  110  MQYN  113



>ref|XP_002266838.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653287.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653288.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653289.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653290.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653292.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=696

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 71/116 (61%), Gaps = 12/116 (10%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGT--NFAFLNSITSGGNAV  373
            MATYFHGNSEIQ   DGLQTLILMNPA    VG+SD  P      NF FLNS  +     
Sbjct  1    MATYFHGNSEIQ--ADGLQTLILMNPA---YVGYSDAPPPPPLHPNFVFLNSAAASLAPS  55

Query  374  TLSHAppppsqsqqFVGIPL-ATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYN  535
             LSHA  PP Q+QQFV IPL ATA  +  +    +VH+  H+I  L GFI R  YN
Sbjct  56   NLSHA--PPPQTQQFVSIPLSATAPSASSDPSPPSVHA-HHEIPGLPGFIQRPHYN  108



>ref|XP_004494251.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=686

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 71/120 (59%), Gaps = 15/120 (13%)
 Frame = +2

Query  200  MATYFHGN--SEIQGGGDGLQTLILMNPAGYVNVGFSDTQP-----AAGTNFAFLNSITS  358
            MATYFHGN  S+  GG DGLQTL+LMNP  Y+    +  QP     ++  N  FLNS T+
Sbjct  1    MATYFHGNNNSDQSGGADGLQTLVLMNPT-YIQYSDTTQQPPPPSHSSTGNLVFLNSTTT  59

Query  359  GGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYN  535
              N+ +  HA  PPS +QQFVGIPL T +      H+   H   HD+ +LHGF+   QYN
Sbjct  60   NNNSYS-PHA--PPSHTQQFVGIPLTTNSQDINNQHSIHAH---HDVPSLHGFLPHMQYN  113



>ref|XP_009404911.1| PREDICTED: BEL1-like homeodomain protein 1 [Musa acuminata subsp. 
malaccensis]
Length=674

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 72/125 (58%), Gaps = 13/125 (10%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFHG  EIQ   DGLQTL LMNP+    VG+SD   AA  N   LNS  +  N + L
Sbjct  1    MATYFHGAPEIQP--DGLQTLYLMNPS---YVGYSDA--AAPANMVLLNSTLNSMNPINL  53

Query  380  SHApppps-qsqqFVGIPLATAAGSHQEAHASAVHSQQHDIT-ALHGFI-RSQYNNNMYG  550
            + A  P   Q QQFVGIPL TAA  H+      +H+  HD++ A+ G I R  Y  N++ 
Sbjct  54   AQASQPNHHQQQQFVGIPLQTAAQPHESYRPPPIHA-PHDLSAAVQGLIPRLHY--NLWT  110

Query  551  PPPSS  565
            P  SS
Sbjct  111  PATSS  115



>emb|CAN63083.1| hypothetical protein VITISV_015358 [Vitis vinifera]
Length=709

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 71/116 (61%), Gaps = 12/116 (10%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGT--NFAFLNSITSGGNAV  373
            MATYFHGNSEIQ   DGLQTLILMNPA    VG+SD  P      NF FLNS  +     
Sbjct  1    MATYFHGNSEIQ--ADGLQTLILMNPA---YVGYSDAPPPPPLHPNFVFLNSAAASLAPS  55

Query  374  TLSHAppppsqsqqFVGIPL-ATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYN  535
             LSHA  PP Q+QQFV IPL ATA  +  +    +VH+  H+I  L GFI R  YN
Sbjct  56   NLSHA--PPPQTQQFVSIPLSATAPSASSDPSPPSVHA-HHEIPGLPGFIQRPHYN  108



>ref|XP_008442920.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=713

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 68/121 (56%), Gaps = 12/121 (10%)
 Frame = +2

Query  200  MATYFHGNSE-IQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGT-----NFAFLNSITSG  361
            MATY HGNS+  Q    GLQTL+LMNP  YV   FSDT P         N  F NS TS 
Sbjct  1    MATYLHGNSDQFQSSDGGLQTLVLMNPT-YVQ--FSDTPPPPPPPPSHPNLVFFNSPTSA  57

Query  362  GNAVTLSHAppppsqsqqFVGIPLAT--AAGSHQEAHASAVHSQQHDITALHGFI-RSQY  532
             N  T     PP S +QQFVGIPL T  AA    + H S   +  HDI+ALHGF+ R Q+
Sbjct  58   ANTFTALTQAPPSSHTQQFVGIPLQTTSAASPTSQDHNSHPLNPHHDISALHGFVPRLQH  117

Query  533  N  535
            N
Sbjct  118  N  118



>gb|KHN08605.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=679

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 83/137 (61%), Gaps = 24/137 (18%)
 Frame = +2

Query  200  MATYFH-GNSEIQ-GGGDGLQTLILMNPAGYVNVGFSDT------QPAAGTNFAFLN-SI  352
            MATYFH GNSEIQ GG DGLQTL+LMNP GY++  +SD          A  N  FLN + 
Sbjct  1    MATYFHHGNSEIQSGGADGLQTLVLMNP-GYIH--YSDAPQQQQQSSLAAGNLVFLNPAA  57

Query  353  TSGGNAVTLS-HAppppsqsqqFVGIPLATAAG-SHQEAHASAVHSQQHDITALHGFI-R  523
             +GGN  + + HA  PPS +QQFVG+PL  +   +H   HA       HD++ALHGF+ R
Sbjct  58   VAGGNNNSFNPHA--PPSHTQQFVGVPLPNSQDLNHHSMHA------HHDVSALHGFLPR  109

Query  524  SQYNN-NMYGPPPSSVE  571
             QYN  N + P  ++ E
Sbjct  110  MQYNPWNAFDPTSAARE  126



>gb|KJB62029.1| hypothetical protein B456_009G396900 [Gossypium raimondii]
Length=653

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 65/119 (55%), Gaps = 24/119 (20%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSGGNAVT  376
            MATYFHGN EIQ   DGLQTL+LMNPA YV   +SDT  P   +N  F N      N+++
Sbjct  1    MATYFHGNPEIQASTDGLQTLVLMNPA-YVQ--YSDTPPPPQASNLLFFNP-----NSLS  52

Query  377  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFIRSQYNNNMYGP  553
                       QQ VGIPL   + ++Q   +       HDI+ LHG ++ + + NMY P
Sbjct  53   PPQT-------QQLVGIPLPATSAANQGPTS-------HDISPLHGLVQ-RVHYNMYNP  96



>ref|XP_003554466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006604654.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=680

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 86/139 (62%), Gaps = 27/139 (19%)
 Frame = +2

Query  200  MATYFH-GNSEIQ-GGGDGLQTLILMNPAGYVNVGFSD--------TQPAAGTNFAFLN-  346
            MATYFH GNSEIQ GG DGLQTL+LMNP GY++  +SD        +  AAG N  FLN 
Sbjct  1    MATYFHHGNSEIQSGGADGLQTLVLMNP-GYIH--YSDAPQQQQQQSSLAAG-NLVFLNP  56

Query  347  SITSGGNAVTLS-HAppppsqsqqFVGIPLATAAG-SHQEAHASAVHSQQHDITALHGFI  520
            +  +GGN  + + HA  PPS +QQFVG+PL  +   +H   HA       HD++ALHGF+
Sbjct  57   AAVAGGNNNSFNPHA--PPSHTQQFVGVPLPNSQDLNHHSMHA------HHDVSALHGFL  108

Query  521  -RSQYNN-NMYGPPPSSVE  571
             R QYN  N + P  ++ E
Sbjct  109  PRMQYNPWNAFDPTSAARE  127



>ref|XP_007145789.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
 gb|ESW17783.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
Length=649

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 65/115 (57%), Gaps = 13/115 (11%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPA-AGTNFAFLNS-ITSGGNAV  373
            MATYF  N +IQ G DGLQTL+LMN + YV   +SD  P   G N  FLNS  T   N  
Sbjct  1    MATYFQSNPKIQSGADGLQTLVLMN-SDYVQ--YSDAPPPHHGGNHLFLNSAATVANNTS  57

Query  374  TLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYN  535
             L+    P   +QQFVG+PL+  A   QE          HD++ALHGF+ R QYN
Sbjct  58   LLNLPHAPSPHTQQFVGVPLSATA---QEPPPPMP----HDVSALHGFLPRMQYN  105



>emb|CBI24428.3| unnamed protein product [Vitis vinifera]
Length=573

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 73/118 (62%), Gaps = 11/118 (9%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFHG+SEIQ   DGLQTL LMNP  Y  +G+SDTQ  +  N  FLN+  +  N   L
Sbjct  1    MATYFHGSSEIQ--ADGLQTLYLMNP-NY--IGYSDTQQPSAANMLFLNATPNSLNPTNL  55

Query  380  SHAppppsqsqqFVGIPLAT-AAGSHQEAHASAVHSQQHDITALHGFIRSQYNNNMYG  550
             +      Q+Q FVGIPL    + +  + + S++H+ Q ++++L G +  +++ N++G
Sbjct  56   PN---MSLQNQHFVGIPLPNMGSANSDDQNRSSLHA-QPEMSSLQGIV-PRFHYNLWG  108



>ref|XP_002275098.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=728

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 73/118 (62%), Gaps = 11/118 (9%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFHG+SEIQ   DGLQTL LMNP  Y  +G+SDTQ  +  N  FLN+  +  N   L
Sbjct  1    MATYFHGSSEIQ--ADGLQTLYLMNP-NY--IGYSDTQQPSAANMLFLNATPNSLNPTNL  55

Query  380  SHAppppsqsqqFVGIPLAT-AAGSHQEAHASAVHSQQHDITALHGFIRSQYNNNMYG  550
             +      Q+Q FVGIPL    + +  + + S++H+ Q ++++L G +  +++ N++G
Sbjct  56   PN---MSLQNQHFVGIPLPNMGSANSDDQNRSSLHA-QPEMSSLQGIV-PRFHYNLWG  108



>ref|XP_011467196.1| PREDICTED: BEL1-like homeodomain protein 1 [Fragaria vesca subsp. 
vesca]
Length=704

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 74/125 (59%), Gaps = 20/125 (16%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQ----PAAGTN--FAFLNSITSG  361
            MATY+HGNSEIQ    GLQTL+LMN  GYV    +  Q     AA TN    FLNS  +G
Sbjct  1    MATYYHGNSEIQSPDGGLQTLVLMNHGGYVPYSDATQQQHSPSAAATNQQLVFLNS--AG  58

Query  362  GN-----AVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGF---  517
             N     A TL HA  PPS +QQFVGIPL T + +   +++  +H   HD+ ALH F   
Sbjct  59   ANNQLAQASTLPHA--PPSHTQQFVGIPLPTVS-TQDPSNSQGMHP-HHDMAALHAFMPR  114

Query  518  IRSQY  532
            I++QY
Sbjct  115  IQTQY  119



>emb|CAN69527.1| hypothetical protein VITISV_027380 [Vitis vinifera]
Length=728

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 68/117 (58%), Gaps = 9/117 (8%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFHG+SEIQ   DGLQTL LMNP  Y  +G+SDTQ  +  N  FLN+  +  N   L
Sbjct  1    MATYFHGSSEIQ--ADGLQTLYLMNP-NY--IGYSDTQQPSAANMLFLNATPNSLNPTNL  55

Query  380  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFIRSQYNNNMYG  550
             +      Q+Q FVGIPL     ++ +    +    Q ++++L G +  +++ N++G
Sbjct  56   PN---MXLQNQHFVGIPLPNMGSANSDDQNRSXLHAQPEMSSLQGIV-PRFHYNLWG  108



>ref|XP_004136516.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
Length=716

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 68/121 (56%), Gaps = 12/121 (10%)
 Frame = +2

Query  200  MATYFHGNSE-IQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGT-----NFAFLNSITSG  361
            MATY HGNS+  Q    GLQTL+LMNP  YV   FSDT P         N  F NS +S 
Sbjct  1    MATYLHGNSDQFQSSDGGLQTLVLMNPT-YVQ--FSDTTPPPPPPPSHPNLLFFNSPSST  57

Query  362  GNAVTLSHAppppsqsqqFVGIPLAT--AAGSHQEAHASAVHSQQHDITALHGFI-RSQY  532
             N  T    PPP S +QQFVGIPL T  AA    + H S   +  HDI+ LHGF+ R Q+
Sbjct  58   ANTFTTLVQPPPSSHTQQFVGIPLQTTSAASPTSQDHNSHPLNPHHDISPLHGFVPRLQH  117

Query  533  N  535
            N
Sbjct  118  N  118



>ref|XP_004171976.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN59214.1| hypothetical protein Csa_3G782620 [Cucumis sativus]
Length=716

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 68/121 (56%), Gaps = 12/121 (10%)
 Frame = +2

Query  200  MATYFHGNSE-IQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGT-----NFAFLNSITSG  361
            MATY HGNS+  Q    GLQTL+LMNP  YV   FSDT P         N  F NS +S 
Sbjct  1    MATYLHGNSDQFQSSDGGLQTLVLMNPT-YVQ--FSDTTPPPPPPPSHPNLLFFNSPSST  57

Query  362  GNAVTLSHAppppsqsqqFVGIPLAT--AAGSHQEAHASAVHSQQHDITALHGFI-RSQY  532
             N  T    PPP S +QQFVGIPL T  AA    + H S   +  HDI+ LHGF+ R Q+
Sbjct  58   ANTFTTLVQPPPSSHTQQFVGIPLQTTSAASPTSQDHNSHPLNPHHDISPLHGFVPRLQH  117

Query  533  N  535
            N
Sbjct  118  N  118



>ref|XP_010107002.1| hypothetical protein L484_016932 [Morus notabilis]
 gb|EXC13000.1| hypothetical protein L484_016932 [Morus notabilis]
Length=241

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 65/132 (49%), Gaps = 30/132 (23%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGD-GLQTLILMNPAGYVNVGFSDTQP-----AAGTNFAFLNSITSG  361
            MATYFHGNSEIQ   D GLQTL+LMNP GY+   +SD+ P     AA  N  FLNS  + 
Sbjct  1    MATYFHGNSEIQAATDGGLQTLVLMNPTGYIP--YSDSPPPPHSAAAQGNLFFLNSAAAA  58

Query  362  GNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI---RSQY  532
                        P Q+ Q   +P A                  +D++ALHGFI   R QY
Sbjct  59   LAHHHAPPQQQQPQQATQHF-VPAA------------------NDLSALHGFIQPPRVQY  99

Query  533  NNNMYGPPPSSV  568
            N     P PS+V
Sbjct  100  NLWKPSPDPSAV  111



>ref|XP_002524053.1| bel1 homeotic protein, putative [Ricinus communis]
 gb|EEF38263.1| bel1 homeotic protein, putative [Ricinus communis]
Length=679

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 62/121 (51%), Gaps = 25/121 (21%)
 Frame = +2

Query  200  MATYFHGNSEIQ-GGGDGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSGGNAV  373
            MATYFHGN EIQ    +GLQTL+LMNP  YV   +SDT  P   +N  FLNS  S  N  
Sbjct  1    MATYFHGNPEIQAAAAEGLQTLVLMNPT-YVQ--YSDTPPPQPSSNLVFLNSAAS--NLT  55

Query  374  TLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYNNNMYG  550
               H    P  +QQFVGIPL   +               HD + LHG + R  Y  N+Y 
Sbjct  56   PPPHFSHAPPSTQQFVGIPLDPNS---------------HDTSTLHGLVPRIHY--NLYN  98

Query  551  P  553
            P
Sbjct  99   P  99



>gb|KHG11906.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=680

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 66/126 (52%), Gaps = 29/126 (23%)
 Frame = +2

Query  191  QRK---MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITS  358
            QRK   M+TYFHGN EIQ   DGLQTL+LMNPA YV   +SDT  P    N  F N    
Sbjct  22   QRKQHPMSTYFHGNPEIQASTDGLQTLVLMNPA-YVQ--YSDTPPPPPANNLLFFNP---  75

Query  359  GGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYN  535
              N+++           QQ VGIPL   + ++Q   +       HDI+ LHG + R  Y 
Sbjct  76   --NSLSPPQT-------QQLVGIPLPATSAANQGPTS-------HDISPLHGLVQRVHY-  118

Query  536  NNMYGP  553
             N+Y P
Sbjct  119  -NLYNP  123



>ref|XP_008449596.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
 ref|XP_008449597.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=693

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 60/119 (50%), Gaps = 19/119 (16%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLN-SITSGGNAVT  376
            MATYFHG SEIQ   DG+ TL LMNP  Y  V +SDT   +  N  FLN S T   N  T
Sbjct  1    MATYFHGGSEIQTNSDGIHTLYLMNP-NY--VPYSDTHSQSSHNMLFLNPSSTHALNPST  57

Query  377  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFIRSQYNNNMYGP  553
            L HA   P  +  FVGIPL T   S             H+I+ LH   R  Y  N++ P
Sbjct  58   LPHA---PPSNNHFVGIPLPTTDSSRPSF---------HEISTLHPH-RLHY--NLWAP  101



>ref|XP_009403681.1| PREDICTED: BEL1-like homeodomain protein 1 [Musa acuminata subsp. 
malaccensis]
Length=540

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 65/124 (52%), Gaps = 17/124 (14%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNP--AGYVNVGFSDTQPAAGTNFAFLNSITSGGNAV  373
            MAT+ HG  E+Q   DGLQTL LMNP  AGY++        AA  N   LNS  +  N +
Sbjct  1    MATFIHGAPEVQP--DGLQTLFLMNPGYAGYMDA-------AAPANMVLLNSTMNSLNPI  51

Query  374  TLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFIRSQYNNNMYGP  553
             L+ A  P  Q Q FVGIPL  AA          +H+  HD + L     ++ ++N++ P
Sbjct  52   ILAQAGQPNQQQQDFVGIPLQPAARLRDSDRPLPIHA-SHDASVL-----TRLHHNLWTP  105

Query  554  PPSS  565
             P+S
Sbjct  106  TPTS  109



>gb|KHG11905.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=653

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 63/120 (53%), Gaps = 26/120 (22%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSGGNAVT  376
            M+TYFHGN EIQ   DGLQTL+LMNPA YV   +SDT  P    N  F N      N+++
Sbjct  1    MSTYFHGNPEIQASTDGLQTLVLMNPA-YVQ--YSDTPPPPPANNLLFFNP-----NSLS  52

Query  377  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYNNNMYGP  553
                       QQ VGIPL   + ++Q   +       HDI+ LHG + R  Y  N+Y P
Sbjct  53   PPQT-------QQLVGIPLPATSAANQGPTS-------HDISPLHGLVQRVHY--NLYNP  96



>gb|EYU25630.1| hypothetical protein MIMGU_mgv11b017830mg, partial [Erythranthe 
guttata]
Length=295

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 73/124 (59%), Gaps = 20/124 (16%)
 Frame = +2

Query  200  MATYFHGNSEIQ-----GGGDGLQTLILMNPAGYVNVGFSD---TQPAAGTNFAFLNSIT  355
            MATYFHGNSE Q     GGGDGLQTLILMNP GYV  G+SD    Q    +NF FLNS  
Sbjct  1    MATYFHGNSENQGGGGGGGGDGLQTLILMNP-GYVG-GYSDNNNNQHPPNSNFVFLNSNN  58

Query  356  SGGNAVTLSH---AppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-R  523
              GN    SH     PP SQ+Q FVGIPL   A       AS    QQ D++ALHGF+ R
Sbjct  59   ISGNNNNSSHHLPHAPPSSQTQHFVGIPLQGTAS------ASGQDPQQQDVSALHGFLPR  112

Query  524  SQYN  535
              YN
Sbjct  113  VHYN  116



>ref|XP_010059079.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW90459.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
 gb|KCW90460.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
Length=703

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 63/114 (55%), Gaps = 20/114 (18%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFA-FLNSITSGGNAVT  376
            MATY+H +S    G   LQTL+LMNPA YV+  +SD  P      A FLNS T+G  A  
Sbjct  1    MATYYHQSSSDPDGA--LQTLVLMNPASYVH--YSDAPPPHQQPSAIFLNSSTAGPPASQ  56

Query  377  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYN  535
                         FVGIPL    GS  ++  S++H   HD++++HGF+ R QYN
Sbjct  57   TQQ----------FVGIPL---PGSAADSQPSSMHV-NHDLSSMHGFMPRVQYN  96



>gb|KJB36260.1| hypothetical protein B456_006G149100 [Gossypium raimondii]
Length=644

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 66/120 (55%), Gaps = 27/120 (23%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFHGN EIQ   D LQTL+LMNPA YV+   +   P    N  F+NS++    +   
Sbjct  1    MATYFHGNPEIQ-AADDLQTLVLMNPA-YVHYSNTPPPPPPSNNLVFVNSLSPNAPS---  55

Query  380  SHAppppsqsqqFVGIPL-ATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYNNNMYGP  553
            SH+       QQ VGIPL A  +GS+Q+A           I++LHG + R  YN+  Y P
Sbjct  56   SHS-------QQLVGIPLPAVTSGSNQDA-----------ISSLHGLVQRLHYNS--YNP  95



>ref|XP_004140170.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 ref|XP_004156066.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN48050.1| hypothetical protein Csa_6G426360 [Cucumis sativus]
Length=698

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLN-SITSGGNAVT  376
            MATYFHG SEIQ   DG+ TL LMNP  Y  V +SDT   +  N  FLN S T   N  T
Sbjct  1    MATYFHGGSEIQNNSDGIHTLYLMNP-NY--VPYSDTHSQSSHNMLFLNPSSTHALNPST  57

Query  377  LSHAppppsqsqqFVGIPLAT  439
            L H    P  +  FVGIPL T
Sbjct  58   LPHP---PPSNNHFVGIPLPT  75



>gb|KHG01894.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=634

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 64/119 (54%), Gaps = 28/119 (24%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFHGN EIQ   DGLQTL+LMNPA YV   +SDT P    N               L
Sbjct  1    MATYFHGNPEIQ-APDGLQTLVLMNPA-YVQ--YSDTTPPPQPN--------------NL  42

Query  380  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYNNNMYGP  553
                PPP  +QQFVG+PL   + ++Q+  +       H+I+ LHG + R  Y  N+Y P
Sbjct  43   VFHAPPPPHTQQFVGVPLTATSTANQDPPS-------HEISPLHGLVQRVHY--NLYNP  92



>ref|XP_011090301.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
 ref|XP_011090302.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
Length=629

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 62/114 (54%), Gaps = 17/114 (15%)
 Frame = +2

Query  209  YFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGG----NAVT  376
            YF G+SEIQ   D LQTL LMNP  Y  VG+SD       N  F NS T+      N   
Sbjct  2    YFQGSSEIQA--DALQTLYLMNP-NY--VGYSDNHHQPQPNILFSNSATAATVQALNPAL  56

Query  377  LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYN  535
            + HA  PP+Q+Q FVGIPL     SH  +  S+V  QQ DI A H  I R QYN
Sbjct  57   MHHA--PPAQAQHFVGIPL-----SHDPSRPSSVLGQQEDIQATHSTIPRFQYN  103



>gb|KHG12856.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=763

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 64/120 (53%), Gaps = 27/120 (23%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MA YFHGN EIQ   D LQTL+LMNPA YV+   +   P    N  FLNS++    +   
Sbjct  120  MAAYFHGNPEIQ-AADDLQTLVLMNPA-YVHYSNTPPPPPPSNNLVFLNSLSPNAPS---  174

Query  380  SHAppppsqsqqFVGIPL-ATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYNNNMYGP  553
            SH+       QQ VGIPL A  + S+Q+A           I++LHG + R  YN+  Y P
Sbjct  175  SHS-------QQLVGIPLPAVTSRSNQDA-----------ISSLHGLVQRLHYNS--YNP  214



>gb|KHG12855.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=644

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 64/120 (53%), Gaps = 27/120 (23%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MA YFHGN EIQ   D LQTL+LMNPA YV+   +   P    N  FLNS++    +   
Sbjct  1    MAAYFHGNPEIQ-AADDLQTLVLMNPA-YVHYSNTPPPPPPSNNLVFLNSLSPNAPS---  55

Query  380  SHAppppsqsqqFVGIPL-ATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYNNNMYGP  553
            SH+       QQ VGIPL A  + S+Q+A           I++LHG + R  YN+  Y P
Sbjct  56   SHS-------QQLVGIPLPAVTSRSNQDA-----------ISSLHGLVQRLHYNS--YNP  95



>ref|XP_008391977.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008391978.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=708

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 72/133 (54%), Gaps = 30/133 (23%)
 Frame = +2

Query  200  MATYFH---GNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDTQP------------AAGT  328
            MA YFH   GNS EIQ   DG LQTL+LMNP GYV   +SDT P            +A T
Sbjct  1    MAAYFHHHGGNSSEIQASSDGALQTLVLMNP-GYVQ--YSDTPPPPQQQQQQPQPPSAAT  57

Query  329  NFAFLNSITSG--GNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDIT  502
            N  FLNS  +    +  TLSHAPP   Q   F+GIPL      +    + ++H   HDI+
Sbjct  58   NLVFLNSAPNSLTHHPSTLSHAPPSHHQQ--FLGIPLTQDPNGNS---SLSMHHPHHDIS  112

Query  503  ALHGF---IRSQY  532
            ALH F   I++QY
Sbjct  113  ALHAFMPRIQTQY  125



>ref|XP_008387112.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387113.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387114.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=703

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 72/135 (53%), Gaps = 35/135 (26%)
 Frame = +2

Query  200  MATYFH---GNS-EIQGGGD-GLQTLILMNPAGYVNVGFSDTQPA-----------AGTN  331
            MATYFH   GNS EIQ   D  LQTL+LMNP+    V +SDT P            A TN
Sbjct  1    MATYFHHHRGNSSEIQASSDSALQTLVLMNPS---YVPYSDTPPPPQQQQQPQTPPAATN  57

Query  332  FAFLNSITSGGNAVT-----LSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHD  496
              FLNS     N++T     LSHAPP   Q   FVGIPLA    S+    + ++H   HD
Sbjct  58   LVFLNS---AANSLTHHPSTLSHAPPSHHQQ--FVGIPLAQDPNSNS---SQSMHHPHHD  109

Query  497  ITALHGF---IRSQY  532
            I+ LH F   I++QY
Sbjct  110  ISTLHAFMPRIQTQY  124



>gb|KJB55565.1| hypothetical protein B456_009G082700 [Gossypium raimondii]
 gb|KJB55566.1| hypothetical protein B456_009G082700 [Gossypium raimondii]
Length=721

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 51/84 (61%), Gaps = 9/84 (11%)
 Frame = +2

Query  200  MATYFHGNSEIQGG---GDGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSGGN  367
            MATY HG+SE Q      DG+QTL LMNP  YV   +SDT QPA  TN  FLN   +  N
Sbjct  1    MATYIHGSSEFQAAPAASDGMQTLYLMNP-NYV--PYSDTHQPATATNMFFLNPAGNSLN  57

Query  368  AVTLSHAppppsqsqqFVGIPLAT  439
             ++L HA  PPS    F+G+PL +
Sbjct  58   PISLPHA--PPSNYNHFLGLPLPS  79



>ref|XP_010031566.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW50924.1| hypothetical protein EUGRSUZ_J00574 [Eucalyptus grandis]
Length=693

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 63/127 (50%), Gaps = 19/127 (15%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNP--AGYVNVGFSDTQPAAGTNFAFLN---SITSGG  364
            MATYFHG+SEI+   DGLQTL ++NP    Y N     T P    N  FLN   S T   
Sbjct  1    MATYFHGSSEIE-ATDGLQTLYILNPNFIPYSNAAHDATAP----NTLFLNPMGSATQPA  55

Query  365  NAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFIRSQYNNNM  544
             +  L+H          FVGIPL+  A     A AS VH  +H+I +LH        N+ 
Sbjct  56   PSPQLNH--------NHFVGIPLSGPAAPFGPA-ASDVHPNRHEIPSLHSVAPRFRLNHP  106

Query  545  YGPPPSS  565
            +G P +S
Sbjct  107  WGQPDTS  113



>ref|XP_008360598.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008360599.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=710

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 72/135 (53%), Gaps = 32/135 (24%)
 Frame = +2

Query  200  MATYFH---GNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDTQP--------------AA  322
            MA YFH   GNS EIQ   DG LQTL+LMNP GYV   +SDT P              +A
Sbjct  1    MAAYFHHHGGNSSEIQASSDGALQTLVLMNP-GYVQ--YSDTPPPPQQQQQQQQPQPPSA  57

Query  323  GTNFAFLNSITSG--GNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHD  496
             TN  FLNS  +    +  TLSHAPP   Q   F+GIPL      +    + ++H   HD
Sbjct  58   ATNLVFLNSAPNSLTHHPSTLSHAPPSHHQQ--FLGIPLTQDPNGNS---SLSMHHPHHD  112

Query  497  ITALHGF---IRSQY  532
            I+ALH F   I++QY
Sbjct  113  ISALHAFMPRIQTQY  127



>gb|KJB09137.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
 gb|KJB09138.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
 gb|KJB09139.1| hypothetical protein B456_001G125400 [Gossypium raimondii]
Length=693

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 59/112 (53%), Gaps = 14/112 (13%)
 Frame = +2

Query  200  MATYFHGNSEIQGGG----DGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSGG  364
            MATYFHG+SE Q       DG+QTL LMNP  Y  + +SDT QP A TN  FLN   +  
Sbjct  1    MATYFHGSSEFQAASVASPDGMQTLYLMNP-NY--IPYSDTNQPFAATNLFFLNPAGNAL  57

Query  365  NAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  520
            N  +  H   PP      +G+PL T   S   A+++  H      ++LHG +
Sbjct  58   NPSSFPHT--PPPNYHHLLGLPLPTPTASIVPANSNETHRP----SSLHGIV  103



>ref|XP_008799712.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008799713.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=673

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 56/105 (53%), Gaps = 10/105 (10%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFHG  E Q   DGLQTL LMNP  Y  VG+SDT  AA  N   LNS  +  N V L
Sbjct  1    MATYFHGAPEFQ--ADGLQTLYLMNP-NY--VGYSDT--AAPANMILLNSAMNSLNPVNL  53

Query  380  SH--AppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITAL  508
             H  A   P+Q Q   GIP      SH+    S + +  HD +A+
Sbjct  54   GHCAAMAQPNQQQHLAGIPPQPTVASHESNRLSFIQA-SHDGSAI  97



>ref|XP_007204250.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 ref|XP_007204251.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05449.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05450.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
Length=707

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 77/129 (60%), Gaps = 26/129 (20%)
 Frame = +2

Query  200  MATYFH-GNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDT----------QPAAGTNFAF  340
            MATYFH GNS EIQ   DG LQTL+LMNP GYV   +SDT          QP +  N  F
Sbjct  1    MATYFHHGNSSEIQASSDGALQTLVLMNP-GYVQ--YSDTPPPPPHPQPHQPPSAGNLVF  57

Query  341  LNSITSG--GNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHG  514
            LNS T+    +  TLSHA  PPS  QQFVGIPL+    ++   ++ ++H    D+++LH 
Sbjct  58   LNSPTNSLPHHPSTLSHA--PPSHPQQFVGIPLSHDPNNN---NSPSMHQAHPDLSSLHA  112

Query  515  F---IRSQY  532
            F   I++QY
Sbjct  113  FMPRIQTQY  121



>ref|XP_008241058.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241059.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241060.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241062.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
Length=710

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 78/132 (59%), Gaps = 29/132 (22%)
 Frame = +2

Query  200  MATYFH-GNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDT-------------QPAAGTN  331
            MATYFH GNS EIQ   DG LQTL+LMNP GYV   +SDT             QP +  N
Sbjct  1    MATYFHHGNSSEIQASSDGALQTLVLMNP-GYVQ--YSDTPPPPPHQQQQQPHQPPSAGN  57

Query  332  FAFLNSITSG--GNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITA  505
              FLNS T+    +  TLSHA  PPS +QQFVGIPL+    ++   ++ ++H    D+++
Sbjct  58   LVFLNSPTNSLPHHPSTLSHA--PPSHAQQFVGIPLSHDPNNN---NSPSMHQAHPDLSS  112

Query  506  LHGF---IRSQY  532
            LH F   I++QY
Sbjct  113  LHAFMPRIQTQY  124



>ref|XP_007015671.1| BEL1 homeodomain 1, putative [Theobroma cacao]
 gb|EOY33290.1| BEL1 homeodomain 1, putative [Theobroma cacao]
Length=732

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 66/124 (53%), Gaps = 17/124 (14%)
 Frame = +2

Query  200  MATYFHGNSEIQGGG----DG-LQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSG  361
            MATYFHG+SE Q       DG +QTL LMNP  YV   +SDT QPAA TN  FLN   + 
Sbjct  1    MATYFHGSSEFQAASAAAPDGTMQTLYLMNP-NYV--PYSDTHQPAAATNMFFLNPAGNA  57

Query  362  GNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFIRSQYNNN  541
             N  +L HA  PP      +G+PL T A S     +   H       +LHG + S  + N
Sbjct  58   LNPTSLHHA--PPPNHHHLLGLPLPTPAASIGPGSSDDPHR-----PSLHGIV-SGVHYN  109

Query  542  MYGP  553
            ++GP
Sbjct  110  LWGP  113



>gb|KJB35453.1| hypothetical protein B456_006G115600 [Gossypium raimondii]
Length=717

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 49/85 (58%), Gaps = 10/85 (12%)
 Frame = +2

Query  200  MATYFHGNSEIQGG-GDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVT  376
            MATYFHG+S+ Q    DGLQTL LMNP  YV    +  QP+A TN  FLN  TS   A  
Sbjct  1    MATYFHGSSDFQAASADGLQTLYLMNP-NYVPYADTHQQPSAATNMFFLNP-TSLPQAPP  58

Query  377  LSHAppppsqsqqFVGIPLATAAGS  451
             +H        Q+F+G+PL T + S
Sbjct  59   PNH-------HQRFLGLPLPTPSTS  76



>gb|KHF99976.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=693

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 58/112 (52%), Gaps = 14/112 (13%)
 Frame = +2

Query  200  MATYFHGNSEIQGGG----DGLQTLILMNPAGYVNVGFSDT-QPAAGTNFAFLNSITSGG  364
            MATY HG+SE Q       DG+QTL LMNP  Y+   +SDT QP A TN  FLN   +  
Sbjct  1    MATYSHGSSEFQAASVAAPDGMQTLYLMNP-NYI--PYSDTNQPVAATNLLFLNPAGNAL  57

Query  365  NAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI  520
            N  +  H   PP      +G+PL T   S   A+++  H      ++LHG +
Sbjct  58   NPSSFPHT--PPPNYHHLLGLPLPTPTASIVPANSNETHRP----SSLHGIV  103



>ref|XP_009348973.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
 ref|XP_009348980.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
 ref|XP_009348985.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
Length=710

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 74/135 (55%), Gaps = 32/135 (24%)
 Frame = +2

Query  200  MATYFH---GNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDT--------------QPAA  322
            MA YFH   GNS EIQ   DG LQTL+LMNP GYV   +SDT               P+A
Sbjct  1    MAAYFHHHGGNSSEIQASSDGALQTLVLMNP-GYVQ--YSDTPPPPQQQQQQQQPQPPSA  57

Query  323  GTNFAFLNSITSG--GNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHD  496
             TN  FLNS  +    +  TLSHA  PPS  QQF+GIPL      +    + ++H   +D
Sbjct  58   ATNLVFLNSAPNSLTHHPSTLSHA--PPSHHQQFLGIPLTQDPNGNS---SLSMHHPHND  112

Query  497  ITALHGF---IRSQY  532
            I+ALH F   I++QY
Sbjct  113  ISALHAFMPRIQTQY  127



>gb|KEH24245.1| BEL1-related homeotic protein [Medicago truncatula]
Length=660

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 59/92 (64%), Gaps = 20/92 (22%)
 Frame = +2

Query  200  MATYFHG-NSEIQ----GGGDGLQTLILMNPAGYVNVGFSD-------TQPAAGT--NFA  337
            MATY+HG NSEIQ    GG DGLQTL+LMNP+ Y+   +SD        QP+  T  N+ 
Sbjct  1    MATYYHGGNSEIQSSGGGGADGLQTLVLMNPS-YIQ--YSDASQQQQAQQPSHATAGNYV  57

Query  338  FLNSITSGGNAVTLSHAppppsqsqqFVGIPL  433
            FLNS  +  N+ +  HA  PPS +QQFVGIPL
Sbjct  58   FLNSTAAENNSFS-PHA--PPSNTQQFVGIPL  86



>gb|KJB16539.1| hypothetical protein B456_002G234900 [Gossypium raimondii]
 gb|KJB16540.1| hypothetical protein B456_002G234900 [Gossypium raimondii]
Length=634

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 62/119 (52%), Gaps = 28/119 (24%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVTL  379
            MATYFHGN EIQ   DGLQTL+LMNPA YV   +SDT P    N           +A   
Sbjct  1    MATYFHGNPEIQ-APDGLQTLVLMNPA-YVQ--YSDTTPPPPPNNLVF-------HAPPP  49

Query  380  SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-RSQYNNNMYGP  553
             H        QQFVG+PL   + ++Q+  +       H+I+ LHG + R  Y  N+Y P
Sbjct  50   PHT-------QQFVGVPLTATSTANQDPPS-------HEISPLHGLVQRVHY--NLYNP  92



>ref|XP_009629592.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009629593.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=730

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 64/119 (54%), Gaps = 17/119 (14%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNP--AGYVNVGFSDTQPAAGTNFAFLNSITSGGNAV  373
            MA Y+ G+SEIQ   DGLQTL LMNP   GY +      Q     N  FLNS T+G    
Sbjct  1    MAMYYQGSSEIQ--ADGLQTLYLMNPNYIGYTDTQQQQQQHLQQANMFFLNSATAGN---  55

Query  374  TLSHAppppsq-sqqFVGIPLATAAGSHQEAHASAVHSQQHDITAL-HGFIRSQYNNNM  544
             L+H P P    +Q FVG+PL T+   H  +  S      HD++A  HG ++  +++++
Sbjct  56   -LAHGPLPSQAHTQHFVGVPLPTSF--HDPSRPSV-----HDVSASHHGLLQRLWSSDV  106



>ref|XP_002450321.1| hypothetical protein SORBIDRAFT_05g003750 [Sorghum bicolor]
 gb|EES09309.1| hypothetical protein SORBIDRAFT_05g003750 [Sorghum bicolor]
Length=690

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 47/91 (52%), Gaps = 14/91 (15%)
 Frame = +2

Query  200  MATYFHGN--SEIQGGGDGLQTLILMNP--AGYVNVGFSDTQPAAGTNFAFLNSITSGGN  367
            MA Y+HG   ++IQ   DGLQTL LMNP  AGY + G + T P A TN   LNS  +   
Sbjct  1    MAAYYHGGAGTDIQASTDGLQTLYLMNPSYAGYADDGGASTAPGA-TNMMLLNSAVTTMT  59

Query  368  AVTLSH---------AppppsqsqqFVGIPL  433
              + +H         +     Q Q FVGIPL
Sbjct  60   PASFAHHHQQQQSPSSAAHHQQQQHFVGIPL  90



>emb|CDP15553.1| unnamed protein product [Coffea canephora]
Length=725

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 58/107 (54%), Gaps = 21/107 (20%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNP--AGYVNVGFSDT--QPAAGTNFAFLNSITSGGN  367
            MA Y+ G SEIQ   DGLQTL LMNP  AG    G+SD   QPA   N   LN  T  GN
Sbjct  1    MAMYYQGGSEIQA--DGLQTLYLMNPNYAG----GYSDAQQQPA---NMVILNYAT--GN  49

Query  368  AVTL-SHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITA  505
             V L S A     Q+Q  VG+PL  + GS     A+  H  +H+++A
Sbjct  50   TVNLASLASNQQPQTQHLVGVPLQGSLGS-----AANSHELKHEVSA  91



>ref|XP_002313498.2| hypothetical protein POPTR_0009s02250g [Populus trichocarpa]
 gb|EEE87453.2| hypothetical protein POPTR_0009s02250g [Populus trichocarpa]
Length=662

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 66/127 (52%), Gaps = 17/127 (13%)
 Frame = +2

Query  200  MATYFHGNSEIQGGG---DGLQTLILMNPAGYVNVGFSDTQPAAGT----NFAFLN---S  349
            MATYFHG+SEIQ      DG+QTL LMNP  Y++  +SD+          N  F N   S
Sbjct  1    MATYFHGSSEIQAAAAPSDGIQTLYLMNP-NYLS-SYSDSTQQQHQQQPPNMIFFNPSSS  58

Query  350  ITSGGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFIRSQ  529
              +  N +   + P  P Q+  FVGIPLA  +     ++ +++    H   +LHG + S 
Sbjct  59   TAASNNGLHTGNLPHGPPQNHHFVGIPLAAPS-----SNITSLTPDSHSRPSLHGVVPSH  113

Query  530  YNNNMYG  550
             + N++G
Sbjct  114  VHYNIWG  120



>ref|XP_004978737.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Setaria 
italica]
 ref|XP_004978738.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Setaria 
italica]
 ref|XP_004978739.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Setaria 
italica]
 ref|XP_004978740.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Setaria 
italica]
 ref|XP_004978741.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X5 [Setaria 
italica]
 ref|XP_004978742.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X6 [Setaria 
italica]
 ref|XP_004978743.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X7 [Setaria 
italica]
 ref|XP_004978744.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X8 [Setaria 
italica]
Length=662

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 44/84 (52%), Gaps = 9/84 (11%)
 Frame = +2

Query  200  MATYFHGN--SEIQGGGDGLQTLILMNP---AGYVNVGFSDTQPAAGTNFAFLNSITSGG  364
            MA Y+HG   ++IQ   DGLQTL LMNP   AGY + G S   PA   N   LNS  S  
Sbjct  1    MAAYYHGGAGTDIQASTDGLQTLYLMNPSYTAGYADAGASPPGPA---NMMLLNSAVSTM  57

Query  365  NAVTLS-HAppppsqsqqFVGIPL  433
               +   H   P +  Q FVGIPL
Sbjct  58   TPASFGHHQQSPSAAQQHFVGIPL  81



>ref|XP_009141535.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
 ref|XP_009141536.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
 ref|XP_009141537.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
Length=675

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 57/124 (46%), Gaps = 33/124 (27%)
 Frame = +2

Query  200  MATYFHGN-SEIQGGGDG-LQTLILMNPAGYVNVGFSDTQ----------PAAGTNFAFL  343
            MA YFHGN SEI  G DG LQTLILMNP  YV     D                 +F FL
Sbjct  1    MAAYFHGNPSEISAGPDGGLQTLILMNPTTYVQYTQQDDDSNNNNNSNNNANNNNSFVFL  60

Query  344  NSITSGGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGF-I  520
            +S     NA            SQQFVGIPL+         H +A  +   +I+ LHG+  
Sbjct  61   DSHAPPQNA------------SQQFVGIPLS--------GHEAASITAADNISVLHGYPP  100

Query  521  RSQY  532
            R QY
Sbjct  101  RVQY  104



>gb|KDO70617.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70618.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70619.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70620.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
Length=693

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 65/135 (48%), Gaps = 34/135 (25%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYV------NVGFSDTQ----PAAGTN-FAFLN  346
            MATYFHGN       DGLQTL+LMNP  YV      +  FSDT     PA   N   FLN
Sbjct  1    MATYFHGNPAEFQAPDGLQTLVLMNPTTYVQQQQQQHQQFSDTNHPPAPAPAHNSLIFLN  60

Query  347  SITSGGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-R  523
            S      +    HAPPPPS +Q FVGIP          AH      Q   I+ LHG + R
Sbjct  61   S------SAISPHAPPPPSHTQHFVGIPTT--------AH------QDDSISPLHGLLPR  100

Query  524  SQYN--NNMYGPPPS  562
              YN  N  Y  PP+
Sbjct  101  VHYNLYNPNYPSPPA  115



>ref|XP_006481599.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006481600.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Citrus 
sinensis]
Length=693

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 65/135 (48%), Gaps = 34/135 (25%)
 Frame = +2

Query  200  MATYFHGNSEIQGGGDGLQTLILMNPAGYV------NVGFSDTQ----PAAGTN-FAFLN  346
            MATYFHGN       DGLQTL+LMNP  YV      +  FSDT     PA   N   FLN
Sbjct  1    MATYFHGNPAEFQAPDGLQTLVLMNPTTYVQQQQQQHQQFSDTNHPPAPAPAHNSLIFLN  60

Query  347  SITSGGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGFI-R  523
            S      +    HAPPPPS +Q FVGIP          AH      Q   I+ LHG + R
Sbjct  61   S------SAISPHAPPPPSHTQHFVGIPTT--------AH------QDDSISPLHGLLPR  100

Query  524  SQYN--NNMYGPPPS  562
              YN  N  Y  PP+
Sbjct  101  VHYNLYNPNYPSPPA  115



>ref|XP_006410764.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 ref|XP_006410765.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 ref|XP_006410766.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52217.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52218.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52219.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
Length=677

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 59/115 (51%), Gaps = 11/115 (10%)
 Frame = +2

Query  200  MATYFHGNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAV  373
            MA YFHGN  EI  G DG LQTLILMNP  YV     D       N    N+  +  + V
Sbjct  1    MAAYFHGNPPEISAGSDGGLQTLILMNPTTYVQYTQQDNDSNNNINNNSNNNTNNNNSFV  60

Query  374  TLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGF-IRSQYN  535
             L    PP + SQQFVGIPL+         H +A  +   +I+ LHG+  R QY+
Sbjct  61   FLDSHAPPQNTSQQFVGIPLS--------GHEAASITAADNISVLHGYPPRVQYS  107



>emb|CDX75085.1| BnaA05g08310D [Brassica napus]
Length=628

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 57/124 (46%), Gaps = 32/124 (26%)
 Frame = +2

Query  200  MATYFHGNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDTQ---------PAAGTNFAFLN  346
            MA YFHGN  EI  G DG LQTLILMNP  YV     D             +  +F FL+
Sbjct  1    MAAYFHGNPPEISAGSDGSLQTLILMNPTTYVQYTQQDDDSNNNNSNKTNISNNSFVFLD  60

Query  347  SITSGGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGF-IR  523
            S     NA            SQQF+GIPL+         H +A  +   +I+ L G+  R
Sbjct  61   SHAPPQNA------------SQQFIGIPLS--------GHEAASITSADNISVLQGYPPR  100

Query  524  SQYN  535
             QYN
Sbjct  101  VQYN  104



>emb|CDX84585.1| BnaA03g16450D [Brassica napus]
Length=671

 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 60/129 (47%), Gaps = 34/129 (26%)
 Frame = +2

Query  200  MATYFHGNS-EIQGGGDG-LQTLILMNPAGYVNVGFSDTQ---------PAAGTNFAFLN  346
            MA YFHGN  EI  G DG LQTLILMNP  YV     D                NF FL+
Sbjct  1    MAAYFHGNPPEISAGTDGGLQTLILMNPTTYVPYTQQDDDSNNSNNNNNNTNNNNFVFLD  60

Query  347  SITSGGNAVTLSHAppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITALHGF-IR  523
            S     NA            +QQFVGIPL+         H +A  +   +I+ LHG+  R
Sbjct  61   SRAPPQNA------------NQQFVGIPLS--------GHEAASITAADNISVLHGYPPR  100

Query  524  SQYNNNMYG  550
             QY  ++YG
Sbjct  101  VQY--SLYG  107



>ref|XP_010931060.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
 ref|XP_010931061.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
Length=621

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 55/105 (52%), Gaps = 12/105 (11%)
 Frame = +2

Query  200  MATYFHGN-SEIQGGGDGLQTLILMNPAGYVNVGFSDTQPAAGTNFAFLNSITSGGNAVT  376
            MATYFHG  +E Q   DGLQTL LMNP  Y    +SDT  A   N   LNS+ S  N   
Sbjct  1    MATYFHGAPAEFQA--DGLQTLYLMNP-NY--AAYSDT--AVPANMILLNSVNS-LNPTN  52

Query  377  LSH--AppppsqsqqFVGIPLATAAGSHQEAHASAVHSQQHDITA  505
            L H  A   P+Q Q F GIPL     +H+     ++    HD++A
Sbjct  53   LGHCAATAQPNQHQHFAGIPLQPPVAAHESNRLPSIQP-SHDVSA  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750