BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF046H11

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010518437.1|  PREDICTED: probable glutamyl endopeptidase, ...    171   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010507894.1|  PREDICTED: probable glutamyl endopeptidase, ...    171   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010518438.1|  PREDICTED: probable glutamyl endopeptidase, ...    171   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002515283.1|  dipeptidyl-peptidase, putative                     170   3e-45   
ref|XP_004494424.1|  PREDICTED: probable glutamyl endopeptidase, ...    170   3e-45   Cicer arietinum [garbanzo]
ref|XP_006397934.1|  hypothetical protein EUTSA_v10001294mg             170   4e-45   Eutrema salsugineum [saltwater cress]
gb|AAM20412.1|  unknown protein                                         167   4e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010544966.1|  PREDICTED: probable glutamyl endopeptidase, ...    170   5e-45   Tarenaya hassleriana [spider flower]
ref|XP_010544967.1|  PREDICTED: probable glutamyl endopeptidase, ...    170   5e-45   Tarenaya hassleriana [spider flower]
ref|XP_006375436.1|  hypothetical protein POPTR_0014s11570g             169   6e-45   
ref|XP_006375435.1|  hypothetical protein POPTR_0014s11570g             169   6e-45   Populus trichocarpa [western balsam poplar]
ref|XP_002320974.2|  hypothetical protein POPTR_0014s11570g             169   6e-45   
ref|XP_009142540.1|  PREDICTED: probable glutamyl endopeptidase, ...    169   7e-45   Brassica rapa
ref|XP_009142541.1|  PREDICTED: probable glutamyl endopeptidase, ...    169   7e-45   Brassica rapa
emb|CDX80100.1|  BnaA05g00560D                                          169   7e-45   
gb|KDP28258.1|  hypothetical protein JCGZ_14029                         169   9e-45   Jatropha curcas
ref|XP_006293660.1|  hypothetical protein CARUB_v10022616mg             168   1e-44   
emb|CDY27492.1|  BnaC04g51330D                                          169   1e-44   Brassica napus [oilseed rape]
ref|XP_004229392.1|  PREDICTED: probable glutamyl endopeptidase, ...    169   1e-44   Solanum lycopersicum
ref|XP_002882118.1|  serine-type peptidase                              169   1e-44   
ref|XP_009604950.1|  PREDICTED: probable glutamyl endopeptidase, ...    168   2e-44   Nicotiana tomentosiformis
ref|XP_010506775.1|  PREDICTED: probable glutamyl endopeptidase, ...    168   2e-44   Camelina sativa [gold-of-pleasure]
emb|CDY55377.1|  BnaC04g51960D                                          168   2e-44   Brassica napus [oilseed rape]
ref|XP_009604951.1|  PREDICTED: probable glutamyl endopeptidase, ...    168   2e-44   Nicotiana tomentosiformis
gb|AAL57645.1|  At2g47390/T8I13.23                                      168   2e-44   Arabidopsis thaliana [mouse-ear cress]
sp|Q8VZF3.2|CGEP_ARATH  RecName: Full=Probable glutamyl endopepti...    168   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850473.1|  probable glutamyl endopeptidase                       168   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAB63841.1|  unknown protein                                         167   3e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004494425.1|  PREDICTED: probable glutamyl endopeptidase, ...    167   4e-44   Cicer arietinum [garbanzo]
ref|XP_004300449.2|  PREDICTED: probable glutamyl endopeptidase, ...    167   6e-44   Fragaria vesca subsp. vesca
ref|XP_010652241.1|  PREDICTED: probable glutamyl endopeptidase, ...    167   6e-44   Vitis vinifera
ref|XP_010652242.1|  PREDICTED: probable glutamyl endopeptidase, ...    166   7e-44   Vitis vinifera
emb|CBI36950.3|  unnamed protein product                                166   7e-44   Vitis vinifera
ref|XP_006349188.1|  PREDICTED: probable glutamyl endopeptidase, ...    166   7e-44   Solanum tuberosum [potatoes]
ref|XP_007200322.1|  hypothetical protein PRUPE_ppa000899mg             166   8e-44   Prunus persica
ref|XP_011041183.1|  PREDICTED: probable glutamyl endopeptidase, ...    166   1e-43   Populus euphratica
ref|XP_010259303.1|  PREDICTED: probable glutamyl endopeptidase, ...    166   1e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010259302.1|  PREDICTED: probable glutamyl endopeptidase, ...    166   1e-43   Nelumbo nucifera [Indian lotus]
ref|XP_008369041.1|  PREDICTED: probable glutamyl endopeptidase, ...    166   1e-43   
ref|XP_008369043.1|  PREDICTED: probable glutamyl endopeptidase, ...    166   1e-43   
gb|KCW58331.1|  hypothetical protein EUGRSUZ_H01015                     166   1e-43   Eucalyptus grandis [rose gum]
gb|KCW58332.1|  hypothetical protein EUGRSUZ_H01015                     166   1e-43   Eucalyptus grandis [rose gum]
ref|XP_010069839.1|  PREDICTED: probable glutamyl endopeptidase, ...    166   1e-43   Eucalyptus grandis [rose gum]
gb|KFK37479.1|  hypothetical protein AALP_AA4G262700                    166   2e-43   Arabis alpina [alpine rockcress]
ref|XP_008235148.1|  PREDICTED: probable glutamyl endopeptidase, ...    166   2e-43   Prunus mume [ume]
ref|XP_008235149.1|  PREDICTED: probable glutamyl endopeptidase, ...    165   2e-43   Prunus mume [ume]
gb|KEH24431.1|  glutamyl endopeptidase, putative                        165   2e-43   Medicago truncatula
ref|XP_003625970.1|  Acylamino-acid-releasing enzyme                    165   2e-43   Medicago truncatula
gb|KEH24430.1|  glutamyl endopeptidase, putative                        165   2e-43   Medicago truncatula
gb|KEH24432.1|  glutamyl endopeptidase, putative                        165   2e-43   Medicago truncatula
ref|XP_011465337.1|  PREDICTED: probable glutamyl endopeptidase, ...    165   3e-43   Fragaria vesca subsp. vesca
gb|KEH24433.1|  glutamyl endopeptidase, putative                        164   3e-43   Medicago truncatula
ref|XP_007051106.1|  Prolyl oligopeptidase family protein               164   7e-43   
ref|XP_007163177.1|  hypothetical protein PHAVU_001G213000g             162   2e-42   Phaseolus vulgaris [French bean]
gb|EYU46808.1|  hypothetical protein MIMGU_mgv1a000875mg                162   2e-42   Erythranthe guttata [common monkey flower]
ref|XP_007163178.1|  hypothetical protein PHAVU_001G213000g             162   2e-42   Phaseolus vulgaris [French bean]
gb|KJB49820.1|  hypothetical protein B456_008G139300                    162   2e-42   Gossypium raimondii
gb|KJB49821.1|  hypothetical protein B456_008G139300                    162   2e-42   Gossypium raimondii
gb|KJB49822.1|  hypothetical protein B456_008G139300                    162   2e-42   Gossypium raimondii
ref|XP_009774673.1|  PREDICTED: probable glutamyl endopeptidase, ...    162   3e-42   Nicotiana sylvestris
ref|XP_009774672.1|  PREDICTED: probable glutamyl endopeptidase, ...    162   3e-42   Nicotiana sylvestris
emb|CDP17069.1|  unnamed protein product                                160   7e-42   Coffea canephora [robusta coffee]
gb|KHG24720.1|  putative glutamyl endopeptidase, chloroplastic -l...    160   8e-42   Gossypium arboreum [tree cotton]
ref|XP_009378723.1|  PREDICTED: probable glutamyl endopeptidase, ...    160   9e-42   Pyrus x bretschneideri [bai li]
ref|XP_009378724.1|  PREDICTED: probable glutamyl endopeptidase, ...    160   9e-42   Pyrus x bretschneideri [bai li]
ref|XP_006444495.1|  hypothetical protein CICLE_v10018738mg             159   1e-41   
ref|XP_006492336.1|  PREDICTED: probable glutamyl endopeptidase, ...    160   1e-41   
ref|XP_006444496.1|  hypothetical protein CICLE_v10018738mg             160   2e-41   Citrus clementina [clementine]
gb|KDO86997.1|  hypothetical protein CISIN_1g002164mg                   160   2e-41   Citrus sinensis [apfelsine]
gb|KDO86995.1|  hypothetical protein CISIN_1g002164mg                   159   2e-41   Citrus sinensis [apfelsine]
ref|XP_010087237.1|  putative glutamyl endopeptidase                    159   7e-41   
ref|XP_002301512.2|  hypothetical protein POPTR_0002s19700g             157   2e-40   
ref|XP_011079552.1|  PREDICTED: probable glutamyl endopeptidase, ...    157   2e-40   Sesamum indicum [beniseed]
ref|XP_011042249.1|  PREDICTED: probable glutamyl endopeptidase, ...    156   2e-40   Populus euphratica
gb|KHN19214.1|  Putative glutamyl endopeptidase, chloroplastic          156   4e-40   Glycine soja [wild soybean]
ref|XP_011041192.1|  PREDICTED: probable glutamyl endopeptidase, ...    155   5e-40   Populus euphratica
ref|XP_008386780.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    155   6e-40   
gb|KHN43458.1|  Putative glutamyl endopeptidase, chloroplastic          155   7e-40   Glycine soja [wild soybean]
ref|XP_006604741.1|  PREDICTED: probable glutamyl endopeptidase, ...    155   7e-40   Glycine max [soybeans]
ref|XP_006604740.1|  PREDICTED: probable glutamyl endopeptidase, ...    155   8e-40   Glycine max [soybeans]
ref|XP_008451481.1|  PREDICTED: probable glutamyl endopeptidase, ...    154   3e-39   Cucumis melo [Oriental melon]
ref|XP_010938262.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    153   4e-39   Elaeis guineensis
ref|XP_004135991.1|  PREDICTED: probable glutamyl endopeptidase, ...    152   7e-39   
ref|XP_004135992.1|  PREDICTED: probable glutamyl endopeptidase, ...    152   7e-39   Cucumis sativus [cucumbers]
ref|XP_006840458.1|  hypothetical protein AMTR_s00045p00176400          150   2e-38   
ref|XP_008813383.1|  PREDICTED: probable glutamyl endopeptidase, ...    150   3e-38   Phoenix dactylifera
ref|XP_008813381.1|  PREDICTED: probable glutamyl endopeptidase, ...    150   3e-38   
ref|XP_010679382.1|  PREDICTED: probable glutamyl endopeptidase, ...    150   3e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008813379.1|  PREDICTED: probable glutamyl endopeptidase, ...    150   3e-38   
ref|XP_008813382.1|  PREDICTED: probable glutamyl endopeptidase, ...    150   3e-38   
gb|EMS47754.1|  putative glutamyl endopeptidase, chloroplastic          149   5e-38   Triticum urartu
gb|EMT29865.1|  Dipeptidyl peptidase family member 6                    149   6e-38   
ref|XP_008813380.1|  PREDICTED: probable glutamyl endopeptidase, ...    149   1e-37   
ref|XP_006649964.1|  PREDICTED: probable glutamyl endopeptidase, ...    148   1e-37   
ref|XP_009414908.1|  PREDICTED: probable glutamyl endopeptidase, ...    149   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414913.1|  PREDICTED: probable glutamyl endopeptidase, ...    149   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414911.1|  PREDICTED: probable glutamyl endopeptidase, ...    149   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004984622.1|  PREDICTED: probable glutamyl endopeptidase, ...    148   2e-37   
ref|XP_004984623.1|  PREDICTED: probable glutamyl endopeptidase, ...    148   2e-37   Setaria italica
ref|XP_002467980.1|  hypothetical protein SORBIDRAFT_01g037483          148   2e-37   Sorghum bicolor [broomcorn]
ref|XP_010228712.1|  PREDICTED: probable glutamyl endopeptidase, ...    148   2e-37   Brachypodium distachyon [annual false brome]
ref|XP_003558080.1|  PREDICTED: probable glutamyl endopeptidase, ...    148   2e-37   Brachypodium distachyon [annual false brome]
ref|XP_010228711.1|  PREDICTED: probable glutamyl endopeptidase, ...    148   3e-37   Brachypodium distachyon [annual false brome]
gb|EEE58916.1|  hypothetical protein OsJ_10563                          147   3e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75088.1|  hypothetical protein OsI_11240                          147   4e-37   Oryza sativa Indica Group [Indian rice]
ref|NP_001049893.1|  Os03g0307100                                       147   4e-37   
gb|KCW58330.1|  hypothetical protein EUGRSUZ_H01014                     144   1e-36   Eucalyptus grandis [rose gum]
gb|KCW58328.1|  hypothetical protein EUGRSUZ_H01014                     145   2e-36   Eucalyptus grandis [rose gum]
ref|XP_010069840.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    145   2e-36   
ref|XP_008654901.1|  PREDICTED: probable glutamyl endopeptidase, ...    145   2e-36   
tpg|DAA45011.1|  TPA: hypothetical protein ZEAMMB73_493989              145   3e-36   
ref|XP_008654905.1|  PREDICTED: probable glutamyl endopeptidase, ...    145   3e-36   
ref|XP_008654909.1|  PREDICTED: probable glutamyl endopeptidase, ...    144   3e-36   
ref|XP_001754620.1|  predicted protein                                  128   1e-30   
ref|XP_006431496.1|  hypothetical protein CICLE_v10000356mg             128   1e-30   
ref|XP_001761707.1|  predicted protein                                  128   2e-30   
ref|XP_004958766.1|  PREDICTED: probable glutamyl endopeptidase, ...    127   3e-30   Setaria italica
gb|EPS59919.1|  hypothetical protein M569_14885                         118   2e-29   Genlisea aurea
ref|XP_002992516.1|  hypothetical protein SELMODRAFT_135368             124   5e-29   
dbj|BAK03859.1|  predicted protein                                      119   9e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006442098.1|  hypothetical protein CICLE_v10018865mg             122   1e-28   
ref|XP_006442097.1|  hypothetical protein CICLE_v10018865mg             122   1e-28   
ref|XP_002990171.1|  hypothetical protein SELMODRAFT_131182             123   1e-28   
ref|XP_006442099.1|  hypothetical protein CICLE_v10018865mg             122   2e-28   
ref|XP_001772878.1|  predicted protein                                  115   4e-26   
gb|EEE67855.1|  hypothetical protein OsJ_25660                          112   6e-25   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC21362.1|  aminoacyl peptidase-like                               112   7e-25   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060706.1|  Os07g0689400                                       112   7e-25   
gb|EEC82725.1|  hypothetical protein OsI_27416                          112   9e-25   Oryza sativa Indica Group [Indian rice]
gb|EMS61523.1|  putative glutamyl endopeptidase, chloroplastic          102   1e-21   Triticum urartu
gb|KJB49818.1|  hypothetical protein B456_008G139300                  96.7    2e-19   Gossypium raimondii
gb|EMT02117.1|  Dipeptidyl peptidase family member 6                  93.6    2e-18   
gb|KIY94927.1|  hypothetical protein MNEG_13035                       90.5    1e-17   Monoraphidium neglectum
ref|XP_005642798.1|  alpha/beta-hydrolase                             88.6    9e-17   Coccomyxa subellipsoidea C-169
ref|XP_002954276.1|  hypothetical protein VOLCADRAFT_106292           87.0    4e-16   Volvox carteri f. nagariensis
gb|KER10044.1|  aminoacyl peptidase                                   85.9    7e-16   Candidatus Thermochlorobacteriaceae bacterium GBChlB
ref|WP_035401763.1|  aminoacyl peptidase                              85.9    7e-16   
ref|XP_011401392.1|  putative glutamyl endopeptidase, chloroplastic   85.1    1e-15   Auxenochlorella protothecoides
ref|XP_002500610.1|  predicted protein                                80.5    5e-14   Micromonas commoda
ref|WP_007163371.1|  hypothetical protein                             79.3    1e-13   Erythrobacter sp. NAP1
ref|WP_040613448.1|  peptidase S9 prolyl oligopeptidase               76.3    1e-12   
ref|WP_011644979.1|  peptidase S9 prolyl oligopeptidase               75.9    1e-12   Maricaulis maris
gb|EAP89653.1|  hypothetical protein OA2633_10314                     75.9    2e-12   Oceanicaulis sp. HTCC2633
ref|WP_029952658.1|  MULTISPECIES: aminoacyl peptidase                75.1    3e-12   
ref|WP_029944702.1|  hypothetical protein                             74.7    4e-12   
ref|WP_022700787.1|  peptidase S9 prolyl oligopeptidase               74.7    4e-12   Oceanicaulis alexandrii
gb|ADV63172.1|  glutamyl peptidase                                    74.3    5e-12   Isosphaera pallida ATCC 43644
ref|WP_044255181.1|  aminoacyl peptidase                              74.3    6e-12   
gb|KDD76957.1|  hypothetical protein H632_c56p2                       73.6    1e-11   Helicosporidium sp. ATCC 50920
ref|WP_029496139.1|  aminoacyl peptidase                              73.2    1e-11   
ref|WP_014678753.1|  WD40-like beta propeller repeat protein,prol...  72.8    1e-11   Solitalea canadensis
ref|XP_003057252.1|  predicted protein                                72.4    2e-11   Micromonas pusilla CCMP1545
ref|WP_019923325.1|  hypothetical protein                             72.4    2e-11   Duganella zoogloeoides
ref|WP_026334910.1|  aminoacyl peptidase                              72.0    3e-11   Oxalobacteraceae bacterium AB_14
ref|WP_034753463.1|  aminoacyl peptidase                              72.0    3e-11   
ref|WP_034784341.1|  aminoacyl peptidase                              72.0    3e-11   
ref|WP_044201691.1|  aminoacyl peptidase                              71.6    4e-11   
ref|WP_035787784.1|  aminoacyl peptidase                              71.2    6e-11   Janthinobacterium sp. CG3
ref|WP_014101391.1|  glutamyl peptidase                               71.2    6e-11   Chloracidobacterium thermophilum
ref|WP_008444659.1|  peptidase S9 prolyl oligopeptidase catalytic...  70.9    8e-11   Janthinobacterium sp. HH01
ref|WP_038496716.1|  aminoacyl peptidase                              70.1    1e-10   Janthinobacterium agaricidamnosum
emb|CDG85386.1|  prolyl oligopeptidase family protein                 70.1    1e-10   Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628
gb|KJF45023.1|  aminoacyl peptidase                                   68.9    3e-10   Draconibacterium sediminis
ref|XP_007510843.1|  predicted protein                                68.9    3e-10   Bathycoccus prasinos
ref|WP_043629145.1|  aminoacyl peptidase                              68.6    4e-10   Chromobacterium piscinae
ref|WP_026069661.1|  aminoacyl peptidase                              68.6    4e-10   Stenotrophomonas maltophilia
ref|WP_043572150.1|  aminoacyl peptidase                              67.8    8e-10   Chromobacterium
ref|WP_007653415.1|  peptidase S9 prolyl oligopeptidase active si...  67.4    1e-09   Pontibacter sp. BAB1700
ref|WP_019595958.1|  glutamyl peptidase                               67.4    1e-09   Rhodonellum
ref|WP_021476771.1|  glutamyl peptidase                               67.4    1e-09   Pseudogulbenkiania ferrooxidans
ref|WP_020607102.1|  hypothetical protein                             67.0    1e-09   Spirosoma spitsbergense
ref|WP_029164535.1|  hypothetical protein                             67.0    1e-09   
ref|WP_026897909.1|  aminoacyl peptidase                              67.0    1e-09   Pedobacter oryzae
ref|WP_043929166.1|  hypothetical protein                             62.8    1e-09   
ref|WP_020258490.1|  hypothetical protein                             66.6    2e-09   
ref|WP_042837639.1|  hypothetical protein                             62.8    2e-09   
ref|WP_040145576.1|  hypothetical protein                             62.4    2e-09   
ref|WP_044100488.1|  hypothetical protein                             62.4    2e-09   
ref|WP_042830602.1|  hypothetical protein                             62.4    3e-09   
ref|WP_018479746.1|  glutamyl peptidase                               65.9    3e-09   Pontibacter roseus
ref|WP_033011098.1|  aminoacyl peptidase                              62.4    3e-09   
gb|KGR65661.1|  aminoacyl peptidase                                   62.8    3e-09   
ref|WP_031329863.1|  aminoacyl peptidase                              63.2    3e-09   
ref|WP_029945099.1|  hypothetical protein                             63.5    3e-09   
ref|WP_036148309.1|  aminoacyl peptidase                              65.9    3e-09   
ref|WP_039449234.1|  aminoacyl peptidase                              62.4    4e-09   
ref|WP_009838053.1|  glutamyl endopeptidase                           65.5    4e-09   Pseudoalteromonas tunicata
ref|WP_026008314.1|  hypothetical protein                             62.8    4e-09   
gb|ABZ10203.1|  hypothetical protein ALOHA_HF4000APKG10H12ctg3g18     65.5    4e-09   uncultured marine microorganism HF4000_APKG10H12
ref|WP_009197199.1|  Poly(3-hydroxybutyrate) depolymerase             65.1    5e-09   Cesiribacter andamanensis
gb|KFA32366.1|  aminoacyl peptidase                                   62.0    5e-09   Xanthomonas campestris pv. musacearum NCPPB 4384
ref|WP_015265145.1|  prolyl oligopeptidase family protein             65.1    5e-09   Echinicola vietnamensis
ref|WP_042821301.1|  aminoacyl peptidase                              65.1    6e-09   
ref|WP_028788724.1|  peptidase S9                                     65.1    6e-09   Terrimonas ferruginea
ref|WP_042826867.1|  aminoacyl peptidase                              62.0    7e-09   
ref|WP_038894267.1|  aminoacyl peptidase                              62.0    7e-09   
ref|WP_014771634.1|  prolyl oligopeptidase family protein             64.3    8e-09   Belliella baltica
ref|WP_024891486.1|  aminoacyl peptidase                              64.3    9e-09   Luteimonas huabeiensis
ref|WP_035322400.1|  aminoacyl peptidase                              64.3    1e-08   Dyella
ref|WP_039718325.1|  peptidase S9 prolyl oligopeptidase               63.9    1e-08   
ref|WP_043614381.1|  aminoacyl peptidase                              63.9    1e-08   Chromobacterium violaceum
ref|WP_011135850.1|  hypothetical protein                             63.9    1e-08   Chromobacterium violaceum
ref|WP_020264176.1|  MULTISPECIES: hypothetical protein               63.5    2e-08   
ref|WP_043085508.1|  aminoacyl peptidase                              60.5    2e-08   
ref|WP_008628244.1|  hypothetical protein                             63.5    2e-08   Mariniradius saccharolyticus
ref|WP_038690478.1|  aminoacyl peptidase                              63.2    2e-08   Stenotrophomonas rhizophila
gb|EYR68524.1|  glutamyl peptidase                                    63.2    2e-08   
ref|WP_017165787.1|  hypothetical protein                             62.0    3e-08   
gb|KGK58640.1|  aminoacyl peptidase                                   62.8    3e-08   Xanthomonas cannabis pv. phaseoli
ref|WP_036107173.1|  aminoacyl peptidase                              62.8    3e-08   
ref|WP_028374744.1|  aminoacyl peptidase                              62.8    3e-08   Leeuwenhoekiella sp. MAR_2009_132
ref|WP_033370130.1|  aminoacyl peptidase                              62.8    3e-08   Hymenobacter norwichensis
ref|WP_026007267.1|  aminoacyl peptidase                              62.8    3e-08   
gb|EWC51200.1|  hypothetical protein XAR_2184                         62.8    3e-08   Xanthomonas citri pv. glycines str. 8ra
gb|KIS37473.1|  glutamyl endopeptidase, chloroplastic                 62.4    4e-08   Stenotrophomonas maltophilia WJ66
ref|WP_043035372.1|  aminoacyl peptidase                              62.4    4e-08   Stenotrophomonas maltophilia
ref|WP_033834450.1|  aminoacyl peptidase                              62.4    4e-08   Stenotrophomonas maltophilia
ref|WP_012479169.1|  dipeptidyl aminopeptidase                        62.4    4e-08   Stenotrophomonas maltophilia
ref|WP_039426111.1|  aminoacyl peptidase                              62.4    4e-08   Xanthomonas vesicatoria
ref|WP_043397996.1|  aminoacyl peptidase                              62.4    4e-08   Stenotrophomonas maltophilia
ref|WP_042827901.1|  aminoacyl peptidase                              62.4    4e-08   Xanthomonas vesicatoria
gb|EGD09851.1|  glutamyl peptidase                                    62.4    4e-08   Xanthomonas vesicatoria ATCC 35937
ref|WP_032952310.1|  aminoacyl peptidase [                            62.4    4e-08   [Pseudomonas] geniculata
ref|WP_032129696.1|  aminoacyl peptidase                              62.4    4e-08   Stenotrophomonas maltophilia
ref|WP_021203441.1|  dipeptidyl aminopeptidase                        62.4    4e-08   Stenotrophomonas maltophilia
ref|WP_012925251.1|  peptidase S9 prolyl oligopeptidase active si...  62.4    4e-08   
ref|WP_040016621.1|  aminoacyl peptidase                              60.8    5e-08   
gb|EIM77055.1|  peptidase S9 prolyl oligopeptidase active site do...  62.0    5e-08   Nitritalea halalkaliphila LW7
ref|WP_014036004.1|  dipeptidyl aminopeptidase                        62.0    5e-08   Stenotrophomonas maltophilia
ref|WP_039404178.1|  aminoacyl peptidase                              62.0    5e-08   
ref|WP_027069324.1|  aminoacyl peptidase                              62.0    5e-08   
ref|WP_019338085.1|  dipeptidyl aminopeptidase                        62.0    5e-08   Stenotrophomonas maltophilia
gb|KGT53107.1|  aminoacyl peptidase                                   62.0    5e-08   
gb|EMI51368.1|  hypothetical protein C405_01692                       62.0    5e-08   Stenotrophomonas maltophilia AU12-09
ref|WP_039569474.1|  aminoacyl peptidase                              62.0    5e-08   
ref|WP_032953936.1|  aminoacyl peptidase                              62.0    5e-08   Stenotrophomonas
ref|WP_017172335.1|  glutamyl peptidase                               62.0    5e-08   
ref|WP_017167519.1|  glutamyl peptidase                               62.0    5e-08   
ref|WP_040345786.1|  aminoacyl peptidase                              61.2    6e-08   
ref|WP_017169515.1|  glutamyl peptidase                               62.0    6e-08   
ref|WP_017158615.1|  glutamyl peptidase                               62.0    6e-08   
ref|WP_017160286.1|  glutamyl peptidase                               62.0    6e-08   
ref|WP_033830372.1|  aminoacyl peptidase                              61.6    6e-08   Stenotrophomonas maltophilia
emb|CCH00873.1|  peptidase S9 prolyl oligopeptidase active site d...  61.6    6e-08   Fibrella aestuarina BUZ 2
ref|WP_041258970.1|  aminoacyl peptidase                              61.6    6e-08   
ref|WP_025876539.1|  MULTISPECIES: aminoacyl peptidase                61.6    6e-08   Stenotrophomonas
gb|EZP47495.1|  Peptidase S9 prolyl oligopeptidase active site do...  61.6    6e-08   Stenotrophomonas sp. RIT309
ref|WP_011270002.1|  hypothetical protein                             61.6    6e-08   Xanthomonas campestris
gb|AIL06870.1|  X-Pro dipeptidyl-peptidase family protein             61.6    6e-08   Stenotrophomonas maltophilia
ref|WP_024957292.1|  aminoacyl peptidase                              61.6    6e-08   Stenotrophomonas maltophilia
ref|WP_017733953.1|  hypothetical protein                             61.6    7e-08   Nafulsella turpanensis
ref|WP_017172982.1|  glutamyl peptidase                               61.6    7e-08   
ref|WP_044014202.1|  aminoacyl peptidase                              61.6    7e-08   Hymenobacter sp. APR13
ref|WP_009280632.1|  peptidase S9 prolyl oligopeptidase active si...  61.6    8e-08   Fibrisoma limi
ref|WP_033370232.1|  aminoacyl peptidase                              61.2    8e-08   
ref|WP_031340205.1|  aminoacyl peptidase                              61.2    9e-08   Xanthomonas maliensis
ref|WP_039436940.1|  aminoacyl peptidase                              61.2    9e-08   
ref|WP_026112336.1|  aminoacyl peptidase                              61.2    9e-08   
ref|WP_039440851.1|  aminoacyl peptidase                              61.2    9e-08   
ref|WP_026113306.1|  aminoacyl peptidase                              61.2    9e-08   
ref|WP_010367568.1|  putative secreted protein                        61.2    9e-08   
ref|WP_020606187.1|  glutamyl peptidase                               61.2    1e-07   Spirosoma spitsbergense
ref|WP_040230180.1|  aminoacyl peptidase                              61.2    1e-07   
ref|WP_040107731.1|  aminoacyl peptidase                              61.2    1e-07   
ref|WP_018621090.1|  glutamyl peptidase                               60.8    1e-07   Spirosoma luteum
ref|WP_019538970.1|  hypothetical protein                             60.8    1e-07   Proteiniphilum acetatigenes
ref|WP_040237610.1|  aminoacyl peptidase                              60.8    1e-07   
ref|WP_038614998.1|  aminoacyl peptidase                              60.8    1e-07   
gb|AGH76347.1|  hypothetical protein XAC29_04105                      60.8    1e-07   Xanthomonas axonopodis Xac29-1
ref|WP_011050546.1|  hypothetical protein                             60.8    1e-07   Xanthomonas
emb|CEH87928.1|  putative glutamyl endopeptidase, chloroplastic       60.8    1e-07   Xanthomonas citri pv. citri
gb|AGI09540.1|  Dipeptidyl aminopeptidase                             60.8    1e-07   Xanthomonas citri subsp. citri Aw12879
ref|WP_040280806.1|  aminoacyl peptidase                              60.8    1e-07   
emb|CEI14372.1|  putative glutamyl endopeptidase, chloroplastic       60.8    1e-07   Xanthomonas citri pv. citri
ref|WP_039727415.1|  hypothetical protein                             60.8    1e-07   
ref|WP_017355273.1|  dipeptidyl aminopeptidase                        60.8    1e-07   Stenotrophomonas maltophilia
ref|WP_036135718.1|  aminoacyl peptidase                              60.8    1e-07   
ref|WP_033482487.1|  aminoacyl peptidase                              60.8    1e-07   
emb|CEF98925.1|  Peptidase S9, prolyl oligopeptidase, catalytic d...  60.8    1e-07   Ostreococcus tauri
ref|WP_033480922.1|  MULTISPECIES: aminoacyl peptidase                60.8    1e-07   
emb|CCG36710.1|  prolyl oligopeptidase family protein                 60.5    1e-07   
ref|WP_033480056.1|  aminoacyl peptidase                              60.5    1e-07   
ref|WP_035302640.1|  aminoacyl peptidase                              60.5    1e-07   
ref|WP_033481444.1|  MULTISPECIES: aminoacyl peptidase                60.5    1e-07   
ref|WP_042805880.1|  aminoacyl peptidase                              60.5    1e-07   
ref|WP_012439199.1|  peptide hydrolase                                60.5    1e-07   
ref|WP_004144050.1|  dipeptidyl aminopeptidase                        60.5    1e-07   
ref|WP_022558322.1|  putative peptidase                               60.5    1e-07   
ref|WP_033479439.1|  aminoacyl peptidase                              60.5    2e-07   
gb|KGU48021.1|  aminoacyl peptidase                                   60.5    2e-07   
gb|EKQ61538.1|  hypothetical protein WS7_08598                        60.5    2e-07   
ref|WP_007968738.1|  hypothetical protein                             60.5    2e-07   
ref|WP_011035989.1|  hypothetical protein                             60.5    2e-07   
emb|CCF67823.1|  prolyl oligopeptidase family protein                 60.5    2e-07   
gb|EKQ66410.1|  hypothetical protein MOU_00315                        60.5    2e-07   
gb|EFF47220.1|  conserved hypothetical protein                        60.5    2e-07   
ref|WP_032966434.1|  aminoacyl peptidase                              60.5    2e-07   
gb|EMF62653.1|  Dipeptidyl aminopeptidase                             60.5    2e-07   
gb|AEL05845.1|  hypothetical protein XCR_0928                         60.5    2e-07   
gb|EJP78273.1|  hypothetical protein A1OC_00641                       60.1    2e-07   
emb|CEI05241.1|  conserved exported hypothetical protein              60.5    2e-07   
ref|WP_026952618.1|  aminoacyl peptidase                              60.1    2e-07   
ref|WP_043921614.1|  aminoacyl peptidase                              60.5    2e-07   
ref|WP_024353256.1|  aminoacyl peptidase                              60.1    2e-07   
ref|WP_014645961.1|  dipeptidyl aminopeptidase                        60.1    2e-07   
ref|WP_042596862.1|  aminoacyl peptidase                              60.1    2e-07   
gb|EDX79763.1|  peptidase, S9A/B/C family, catalytic domain protein   60.1    2e-07   
ref|WP_023903032.1|  hypothetical protein                             60.1    2e-07   
ref|WP_003170123.1|  peptidase, S9A/B/C family, catalytic domain ...  60.1    2e-07   
ref|WP_017912482.1|  glutamyl peptidase                               60.1    2e-07   
ref|WP_034921484.1|  aminoacyl peptidase                              60.1    2e-07   
ref|WP_019661088.1|  dipeptidyl aminopeptidase                        60.1    2e-07   
ref|WP_040349911.1|  aminoacyl peptidase                              60.1    2e-07   
ref|WP_009036124.1|  prolyl oligopeptidase family protein             60.1    2e-07   
emb|CDN18092.1|  exported peptide hydrolase domain protein            59.7    2e-07   
ref|WP_035562151.1|  aminoacyl peptidase                              59.7    2e-07   
ref|WP_035084383.1|  aminoacyl peptidase                              59.7    3e-07   
ref|WP_009780757.1|  hypothetical protein                             59.7    3e-07   
ref|WP_029416371.1|  aminoacyl peptidase                              59.7    3e-07   
ref|WP_026839309.1|  aminoacyl peptidase                              59.3    4e-07   
ref|WP_036194337.1|  aminoacyl peptidase                              59.3    4e-07   
ref|WP_035309413.1|  aminoacyl peptidase                              59.3    4e-07   
ref|WP_039515871.1|  aminoacyl peptidase                              59.3    4e-07   
ref|WP_039418000.1|  aminoacyl peptidase                              59.3    4e-07   
emb|CAJ22488.1|  putative secreted protein                            59.3    4e-07   
ref|WP_006450141.1|  glutamyl peptidase                               58.9    4e-07   
ref|WP_026451707.1|  aminoacyl peptidase                              58.9    5e-07   
gb|AIY40376.1|  Dipeptidyl aminopeptidase/acylaminoacyl-peptidase     58.9    5e-07   
ref|WP_038495225.1|  aminoacyl peptidase                              58.9    5e-07   
ref|WP_029818695.1|  aminoacyl peptidase                              58.9    5e-07   
ref|WP_014089408.1|  dipeptidyl aminopeptidase/acylaminoacyl-pept...  58.9    5e-07   
ref|XP_001419477.1|  predicted protein                                58.9    5e-07   
ref|WP_031421137.1|  aminoacyl peptidase                              58.9    5e-07   
ref|WP_008573535.1|  glutamyl peptidase                               58.9    6e-07   
ref|WP_019101413.1|  hypothetical protein                             58.5    6e-07   
ref|WP_020595622.1|  glutamyl peptidase                               58.5    6e-07   
ref|WP_039475116.1|  peptidase S9                                     58.5    6e-07   
gb|AFU70114.1|  dipeptidyl aminopeptidase/acylaminoacyl-peptidase...  58.5    6e-07   
ref|WP_043095243.1|  hypothetical protein                             58.5    7e-07   
ref|WP_010049670.1|  peptidase S9, prolyl oligopeptidase active s...  56.2    7e-07   
ref|WP_026064250.1|  aminoacyl peptidase                              58.5    7e-07   
ref|WP_039244479.1|  aminoacyl peptidase                              58.5    7e-07   
ref|WP_029282738.1|  peptidase S9                                     58.2    8e-07   
ref|WP_026108609.1|  aminoacyl peptidase                              58.2    9e-07   
ref|WP_024938317.1|  aminoacyl peptidase                              58.2    1e-06   
ref|WP_010602229.1|  peptidase S9                                     57.8    1e-06   
ref|WP_043641829.1|  aminoacyl peptidase                              57.8    1e-06   
ref|WP_032956704.1|  aminoacyl peptidase                              57.8    1e-06   
ref|WP_043593618.1|  aminoacyl peptidase                              57.4    1e-06   
ref|WP_043959716.1|  hypothetical protein                             53.9    1e-06   
ref|WP_042613666.1|  aminoacyl peptidase                              57.4    1e-06   
ref|WP_035727191.1|  aminoacyl peptidase                              57.4    2e-06   
dbj|GAE60313.1|  dipeptidyl aminopeptidase/acylaminoacyl-peptidase    57.4    2e-06   
ref|WP_019466298.1|  hypothetical protein                             57.4    2e-06   
ref|WP_043088118.1|  aminoacyl peptidase                              57.0    2e-06   
ref|WP_040555677.1|  aminoacyl peptidase                              57.0    2e-06   
ref|WP_015755577.1|  hypothetical protein                             57.0    2e-06   
ref|WP_028890983.1|  aminoacyl peptidase                              57.0    2e-06   
gb|EMY82435.1|  dipeptidyl aminopeptidase/acylaminoacyl-peptidase...  56.6    3e-06   
ref|WP_009184839.1|  Prolyl oligopeptidase family protein             56.6    3e-06   
ref|WP_044151818.1|  aminoacyl peptidase                              56.6    3e-06   
ref|WP_008265992.1|  dipeptidyl aminopeptidase                        56.6    3e-06   
ref|WP_008197892.1|  putative secreted protein                        56.6    3e-06   
ref|WP_035074703.1|  aminoacyl peptidase                              56.6    3e-06   
ref|WP_039524067.1|  aminoacyl peptidase                              56.6    3e-06   
ref|WP_028295855.1|  aminoacyl peptidase                              56.6    3e-06   
ref|WP_044129974.1|  aminoacyl peptidase                              56.6    3e-06   
ref|WP_025145192.1|  peptidase S9                                     56.2    4e-06   
ref|WP_039531539.1|  aminoacyl peptidase                              56.2    4e-06   
ref|WP_033425637.1|  aminoacyl peptidase                              56.2    4e-06   
ref|WP_019991150.1|  hypothetical protein                             56.2    4e-06   
ref|WP_034259045.1|  aminoacyl peptidase                              55.8    5e-06   
ref|WP_010519922.1|  hypothetical protein                             55.8    5e-06   
ref|WP_026955831.1|  aminoacyl peptidase                              55.8    5e-06   
ref|WP_026948044.1|  aminoacyl peptidase                              55.8    5e-06   
ref|WP_025607761.1|  aminoacyl peptidase                              55.8    5e-06   
dbj|BAL54632.1|  glutamyl peptidase                                   55.8    6e-06   
ref|WP_026763394.1|  peptidase S9                                     55.5    6e-06   
ref|WP_017258469.1|  hypothetical protein                             55.5    6e-06   
ref|WP_006456119.1|  peptidase, S9A/B/C family, catalytic domain ...  55.5    6e-06   
ref|WP_019038477.1|  hypothetical protein                             55.5    7e-06   
ref|WP_017742555.1|  hypothetical protein                             55.1    8e-06   
ref|XP_005534945.1|  probable dipeptidyl aminopeptidase               55.1    9e-06   
ref|WP_040135984.1|  glutamyl endopeptidase                           55.1    9e-06   
ref|XP_005706636.1|  serine-type peptidase                            55.1    9e-06   
ref|WP_007094759.1|  50S ribosomal protein L33                        55.1    9e-06   
ref|WP_044227088.1|  aminoacyl peptidase                              54.7    1e-05   
gb|ADG66759.1|  peptidase S9 prolyl oligopeptidase active site do...  54.7    1e-05   
ref|WP_012915087.1|  peptidase                                        54.7    1e-05   
gb|KIE09620.1|  peptidase S9                                          54.3    1e-05   
ref|WP_013453011.1|  glutamyl peptidase                               54.7    1e-05   
ref|WP_040643226.1|  glutamyl endopeptidase                           54.7    1e-05   
ref|WP_039007478.1|  peptidase                                        54.7    1e-05   
ref|WP_013409281.1|  hypothetical protein                             54.3    2e-05   
ref|WP_018127907.1|  hypothetical protein                             54.3    2e-05   
ref|WP_016868342.1|  hypothetical protein                             54.3    2e-05   
ref|WP_029038563.1|  aminoacyl peptidase                              54.3    2e-05   
ref|WP_044399417.1|  aminoacyl peptidase                              54.3    2e-05   
ref|WP_013070685.1|  prolyl oligopeptidase                            53.9    2e-05   
ref|WP_026351320.1|  hypothetical protein                             53.9    2e-05   
emb|CCP41412.1|  hypothetical protein BN444_03136                     53.9    2e-05   
ref|WP_038233872.1|  peptidase                                        53.9    2e-05   
ref|WP_041402974.1|  hypothetical protein                             53.9    2e-05   
ref|WP_035044916.1|  aminoacyl peptidase                              53.9    2e-05   
ref|WP_003470610.1|  hypothetical protein                             53.9    2e-05   
ref|WP_026752002.1|  peptidase S9                                     53.9    2e-05   
ref|WP_027077948.1|  aminoacyl peptidase                              53.5    2e-05   
ref|WP_034775121.1|  aminoacyl peptidase                              53.5    3e-05   
ref|WP_021696634.1|  dipeptidyl aminopeptidases/acylaminoacyl-pep...  53.5    3e-05   
ref|WP_014978909.1|  glutamyl peptidase                               53.5    3e-05   
ref|WP_010559326.1|  glutamyl endopeptidase                           53.5    3e-05   
ref|WP_034733426.1|  aminoacyl peptidase                              53.5    3e-05   
ref|WP_039814032.1|  peptidase                                        53.1    4e-05   
ref|WP_013665039.1|  hypothetical protein                             53.1    4e-05   
ref|WP_044000965.1|  aminoacyl peptidase                              53.1    4e-05   
ref|WP_026628138.1|  aminoacyl peptidase                              52.8    5e-05   
ref|WP_029034950.1|  aminoacyl peptidase                              52.8    5e-05   
ref|WP_009607500.1|  exported peptide hydrolase                       52.8    6e-05   
gb|AAW77609.1|  Dipeptidyl aminopeptidases/acylaminoacyl-peptidases   52.8    6e-05   
ref|WP_026915443.1|  aminoacyl peptidase                              52.4    6e-05   
ref|WP_025254805.1|  aminoacyl peptidase                              52.4    6e-05   
ref|WP_028526669.1|  aminoacyl peptidase                              52.4    6e-05   
ref|WP_029661158.1|  aminoacyl peptidase                              52.4    7e-05   
ref|WP_011260655.1|  peptidase                                        52.4    7e-05   
ref|WP_037319528.1|  aminoacyl peptidase                              52.4    7e-05   
ref|WP_024711878.1|  peptidase                                        52.4    7e-05   
ref|WP_013764632.1|  peptidase S9                                     52.4    7e-05   
ref|WP_006987956.1|  hypothetical protein                             52.4    7e-05   
ref|WP_039230204.1|  aminoacyl peptidase                              52.4    7e-05   
ref|WP_013534184.1|  hypothetical protein                             52.4    8e-05   
ref|WP_020570470.1|  hypothetical protein                             52.4    8e-05   
ref|WP_039440077.1|  peptidase                                        52.0    8e-05   
gb|KGP58252.1|  peptidase                                             52.0    8e-05   
ref|WP_010370355.1|  peptidase                                        52.0    8e-05   
gb|KFA01536.1|  peptidase                                             52.0    8e-05   
ref|WP_017116881.1|  peptidase                                        52.0    8e-05   
ref|WP_017113260.1|  glutamyl peptidase                               52.0    8e-05   
gb|AEQ98445.1|  prolyl oligopeptidase-like protein                    52.0    8e-05   
ref|WP_039436910.1|  peptidase                                        52.0    8e-05   
ref|WP_041659027.1|  aminoacyl peptidase                              52.0    8e-05   
gb|ADU12961.1|  aminoacyl peptidase                                   52.0    8e-05   
ref|WP_041183833.1|  peptidase                                        52.0    9e-05   
ref|WP_010340470.1|  peptidase                                        52.0    1e-04   
ref|WP_026861220.1|  aminoacyl peptidase                              51.6    1e-04   
ref|WP_017117720.1|  peptidase                                        51.6    1e-04   
ref|WP_013578758.1|  peptidase S9                                     51.6    1e-04   
ref|WP_014997997.1|  glutamyl peptidase                               51.6    1e-04   
ref|WP_043093014.1|  peptidase                                        51.6    1e-04   
ref|WP_017913601.1|  peptidase                                        51.6    1e-04   
ref|WP_026317608.1|  glutamyl endopeptidase                           51.6    1e-04   
ref|WP_026933879.1|  aminoacyl peptidase                              51.2    1e-04   
ref|WP_026325866.1|  aminoacyl peptidase                              51.2    2e-04   
ref|WP_042824497.1|  peptidase                                        51.2    2e-04   
ref|WP_005491700.1|  conserved protein of unknown function            51.2    2e-04   
ref|WP_017121860.1|  peptidase                                        51.2    2e-04   
ref|WP_037442702.1|  peptidase S9                                     50.8    2e-04   
ref|WP_023461582.1|  aminoacyl peptidase                              50.8    2e-04   
ref|XP_002292970.1|  predicted protein                                50.8    2e-04   
ref|WP_011710208.1|  hypothetical protein                             50.8    2e-04   
ref|WP_035465258.1|  peptidase S9                                     50.8    2e-04   
ref|WP_039411984.1|  peptidase                                        50.4    3e-04   
ref|WP_039566102.1|  peptidase                                        50.4    3e-04   
ref|WP_009581987.1|  hypothetical protein                             50.4    3e-04   
dbj|GAK96962.1|  hypothetical protein JCM19294_468                    50.4    3e-04   
ref|WP_021987401.1|  peptidase S9 prolyl oligopeptidase active si...  50.1    4e-04   
dbj|GAE53155.1|  prolyl oligopeptidase-like protein                   49.7    5e-04   
ref|WP_043888844.1|  peptidase                                        49.7    6e-04   
ref|WP_006974037.1|  peptidase S9, prolyl oligopeptidase active s...  49.7    6e-04   
ref|WP_026717986.1|  aminoacyl peptidase                              49.7    6e-04   
gb|KIJ83390.1|  peptidase S9                                          49.3    7e-04   
ref|WP_040277661.1|  hypothetical protein                             46.2    8e-04   
gb|AGY52813.1|  putative peptidase yuxL                               48.9    8e-04   
ref|WP_038460301.1|  aminoacyl peptidase                              48.9    9e-04   
gb|EKD80955.1|  peptidase S9 prolyl oligopeptidase active site pr...  48.9    9e-04   
ref|WP_007419109.1|  dipeptidyl aminopeptidase                        48.9    9e-04   
ref|WP_024742959.1|  peptidase                                        48.9    0.001   
ref|WP_004621156.1|  glutamyl peptidase                               48.9    0.001   
ref|WP_040150691.1|  hypothetical protein                             46.2    0.001   
ref|WP_008984857.1|  dipeptidyl aminopeptidase                        48.9    0.001   
ref|WP_015121038.1|  dipeptidyl aminopeptidase/acylaminoacyl pept...  48.9    0.001   
ref|WP_020715592.1|  peptidase S9                                     48.9    0.001   



>ref|XP_010518437.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Camelina sativa]
Length=960

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRR+LPPL+DLARPE KLA
Sbjct  100  DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRALPPLADLARPEEKLA  159

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  160  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  193



>ref|XP_010507894.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Camelina 
sativa]
Length=959

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRR+LPPL+DLARPE KLA
Sbjct  99   DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRALPPLADLARPEEKLA  158

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  159  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  192



>ref|XP_010518438.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Camelina sativa]
Length=960

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRR+LPPL+DLARPE KLA
Sbjct  100  DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRALPPLADLARPEEKLA  159

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  160  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  193



>ref|XP_002515283.1| dipeptidyl-peptidase, putative [Ricinus communis]
 gb|EEF47267.1| dipeptidyl-peptidase, putative [Ricinus communis]
Length=926

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            +DDEALG +Y+LPPPEIRDIVDAPP+PALSFSPQRDKILFLKRR+LPPL++LARPE KLA
Sbjct  94   EDDEALGGKYQLPPPEIRDIVDAPPLPALSFSPQRDKILFLKRRALPPLAELARPEEKLA  153

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDGKCN+RSRMSFYTGI IHQL+ DGTL PE
Sbjct  154  GMRIDGKCNTRSRMSFYTGINIHQLMPDGTLGPE  187



>ref|XP_004494424.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=960

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 103/134 (77%), Gaps = 4/134 (3%)
 Frame = +2

Query  170  ASSRSPHLVPLTAV----gnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  337
            ++SR  HL PL AV            S ++ + A +   Y+DD ALG  YR+PPPEIRDI
Sbjct  50   STSRFHHLAPLAAVPAENSAGGTSNGSVSSYSTADSSTDYEDDSALGVGYRVPPPEIRDI  109

Query  338  VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  517
            VDAPPVPALSFSP RDKI+FLKRRSLPPL++LARPE KLAG+RIDG CNSRSRMSFYTG+
Sbjct  110  VDAPPVPALSFSPHRDKIIFLKRRSLPPLTELARPEEKLAGLRIDGYCNSRSRMSFYTGL  169

Query  518  GIHQLLEDGTLXPE  559
            GIHQ+L DGTL PE
Sbjct  170  GIHQILPDGTLGPE  183



>ref|XP_006397934.1| hypothetical protein EUTSA_v10001294mg [Eutrema salsugineum]
 gb|ESQ39387.1| hypothetical protein EUTSA_v10001294mg [Eutrema salsugineum]
Length=956

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DDD ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101  DDDLALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  161  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  194



>gb|AAM20412.1| unknown protein [Arabidopsis thaliana]
Length=599

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ A+G  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101  DDELAIGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  161  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  194



>ref|XP_010544966.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=961

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DDD A+GN+YRLPP EIRDIVDAPP+PALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  103  DDDLAIGNEYRLPPSEIRDIVDAPPLPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  162

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRIDG+CN+RSRMS+YTGIGIHQL+ DGTL PE
Sbjct  163  GIRIDGQCNTRSRMSYYTGIGIHQLMADGTLGPE  196



>ref|XP_010544967.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=960

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DDD A+GN+YRLPP EIRDIVDAPP+PALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  103  DDDLAIGNEYRLPPSEIRDIVDAPPLPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  162

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRIDG+CN+RSRMS+YTGIGIHQL+ DGTL PE
Sbjct  163  GIRIDGQCNTRSRMSYYTGIGIHQLMADGTLGPE  196



>ref|XP_006375436.1| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
 gb|ERP53233.1| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
Length=968

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 108/129 (84%), Gaps = 4/129 (3%)
 Frame = +2

Query  173  SSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAPP  352
            +SR P+LVPL ++  E+ GG S  + + A    S +D+EAL  +Y+LPPPEI++IVDAPP
Sbjct  58   TSRFPNLVPLNSIAAENVGGRSNDSVSSA----STEDEEALAGKYQLPPPEIKNIVDAPP  113

Query  353  VPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQL  532
            +PALSFSPQRDKILFLKRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIHQL
Sbjct  114  LPALSFSPQRDKILFLKRRSLPPLAELARPEEKLAGMRIDGKCNTRSRMSFYTGIGIHQL  173

Query  533  LEDGTLXPE  559
            + DG L PE
Sbjct  174  MPDGILGPE  182



>ref|XP_006375435.1| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
 gb|ERP53232.1| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
Length=957

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 108/129 (84%), Gaps = 4/129 (3%)
 Frame = +2

Query  173  SSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAPP  352
            +SR P+LVPL ++  E+ GG S  + + A    S +D+EAL  +Y+LPPPEI++IVDAPP
Sbjct  58   TSRFPNLVPLNSIAAENVGGRSNDSVSSA----STEDEEALAGKYQLPPPEIKNIVDAPP  113

Query  353  VPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQL  532
            +PALSFSPQRDKILFLKRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIHQL
Sbjct  114  LPALSFSPQRDKILFLKRRSLPPLAELARPEEKLAGMRIDGKCNTRSRMSFYTGIGIHQL  173

Query  533  LEDGTLXPE  559
            + DG L PE
Sbjct  174  MPDGILGPE  182



>ref|XP_002320974.2| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
 gb|EEE99289.2| hypothetical protein POPTR_0014s11570g [Populus trichocarpa]
Length=967

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 108/129 (84%), Gaps = 4/129 (3%)
 Frame = +2

Query  173  SSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAPP  352
            +SR P+LVPL ++  E+ GG S  + + A    S +D+EAL  +Y+LPPPEI++IVDAPP
Sbjct  58   TSRFPNLVPLNSIAAENVGGRSNDSVSSA----STEDEEALAGKYQLPPPEIKNIVDAPP  113

Query  353  VPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQL  532
            +PALSFSPQRDKILFLKRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIHQL
Sbjct  114  LPALSFSPQRDKILFLKRRSLPPLAELARPEEKLAGMRIDGKCNTRSRMSFYTGIGIHQL  173

Query  533  LEDGTLXPE  559
            + DG L PE
Sbjct  174  MPDGILGPE  182



>ref|XP_009142540.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Brassica rapa]
Length=946

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE+KLA
Sbjct  88   DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPELKLA  147

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  148  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  181



>ref|XP_009142541.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Brassica rapa]
Length=945

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE+KLA
Sbjct  88   DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPELKLA  147

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  148  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  181



>emb|CDX80100.1| BnaA05g00560D [Brassica napus]
Length=946

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE+KLA
Sbjct  88   DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPELKLA  147

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  148  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  181



>gb|KDP28258.1| hypothetical protein JCGZ_14029 [Jatropha curcas]
Length=961

 Score =   169 bits (428),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 108/130 (83%), Gaps = 2/130 (2%)
 Frame = +2

Query  170  ASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAP  349
            A+SR  +LVP TA   EDGGG S  +   ++   + +DDEAL  +YRLPPPEI+DIVDAP
Sbjct  59   ANSRLGNLVPTTAFAAEDGGGGSNGSVNSSNN--TAEDDEALEGKYRLPPPEIKDIVDAP  116

Query  350  PVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQ  529
            P+PALSFSPQRDKILFLKRR+LPPL++L+RPE KLAG RIDGKCN+RSRMSFYTGIGIHQ
Sbjct  117  PLPALSFSPQRDKILFLKRRALPPLAELSRPEEKLAGTRIDGKCNTRSRMSFYTGIGIHQ  176

Query  530  LLEDGTLXPE  559
            LL DGTL PE
Sbjct  177  LLPDGTLGPE  186



>ref|XP_006293660.1| hypothetical protein CARUB_v10022616mg [Capsella rubella]
 gb|EOA26558.1| hypothetical protein CARUB_v10022616mg [Capsella rubella]
Length=875

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101  DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  161  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  194



>emb|CDY27492.1| BnaC04g51330D [Brassica napus]
Length=953

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 87/95 (92%), Gaps = 1/95 (1%)
 Frame = +2

Query  278  DDDE-ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            DDDE ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KL
Sbjct  91   DDDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEKKL  150

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            AG+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  151  AGVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  185



>ref|XP_004229392.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Solanum 
lycopersicum]
Length=977

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = +2

Query  170  ASSRSPHLVPLTAVgnedgggasaangavasadP-SYDDD--EALGNQYRLPPPEIRDIV  340
            ASSR  HLVP+ A+  EDGG  + +NGA  +    +YDDD   A    YRLPP EIRDIV
Sbjct  73   ASSRFHHLVPVNALTAEDGGNGTGSNGAADATASVAYDDDVESASATGYRLPPFEIRDIV  132

Query  341  DAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIG  520
            DAPP+PALSFSP RDKILFLKRRSLPPLSDLARPE KLAGIRIDGKCNSRSRMSFYTGI 
Sbjct  133  DAPPLPALSFSPLRDKILFLKRRSLPPLSDLARPEEKLAGIRIDGKCNSRSRMSFYTGIA  192

Query  521  IHQLLEDGTLXPE  559
            IHQL+EDG+L PE
Sbjct  193  IHQLMEDGSLGPE  205



>ref|XP_002882118.1| serine-type peptidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58377.1| serine-type peptidase [Arabidopsis lyrata subsp. lyrata]
Length=962

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101  DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  161  GVRIDGHCNTRSRMSFYTGLGIHQLLPDGTLSPE  194



>ref|XP_009604950.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=976

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 112/137 (82%), Gaps = 4/137 (3%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedgggasaangavasadP-SYDDD--EALGNQYRLPPPEI  328
            SAM ASSR  H+VP+ A+ +EDGG  S +NGA  +    +YDDD   A    YRLPP EI
Sbjct  57   SAM-ASSRFHHVVPVNALASEDGGNGSGSNGAANATASVAYDDDLESASDTGYRLPPSEI  115

Query  329  RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  508
            RDIVDAPP+PALSFSP RDKILFLKRRSLPPLSDLARPE KLAG+RIDGKCN+RSRMSFY
Sbjct  116  RDIVDAPPLPALSFSPLRDKILFLKRRSLPPLSDLARPEEKLAGVRIDGKCNTRSRMSFY  175

Query  509  TGIGIHQLLEDGTLXPE  559
            TGIGIHQL+EDG+L PE
Sbjct  176  TGIGIHQLMEDGSLGPE  192



>ref|XP_010506775.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Camelina 
sativa]
Length=959

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ ALG  YRLPP EIRDIVDAPPVPALSFSPQRDKILFLKRR+LPPL+DLARPE KLA
Sbjct  99   DDELALGTGYRLPPSEIRDIVDAPPVPALSFSPQRDKILFLKRRALPPLADLARPEEKLA  158

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  159  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  192



>emb|CDY55377.1| BnaC04g51960D [Brassica napus]
Length=939

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  81   DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  140

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  141  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  174



>ref|XP_009604951.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=964

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 112/137 (82%), Gaps = 4/137 (3%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedgggasaangavasadP-SYDDD--EALGNQYRLPPPEI  328
            SAM ASSR  H+VP+ A+ +EDGG  S +NGA  +    +YDDD   A    YRLPP EI
Sbjct  57   SAM-ASSRFHHVVPVNALASEDGGNGSGSNGAANATASVAYDDDLESASDTGYRLPPSEI  115

Query  329  RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  508
            RDIVDAPP+PALSFSP RDKILFLKRRSLPPLSDLARPE KLAG+RIDGKCN+RSRMSFY
Sbjct  116  RDIVDAPPLPALSFSPLRDKILFLKRRSLPPLSDLARPEEKLAGVRIDGKCNTRSRMSFY  175

Query  509  TGIGIHQLLEDGTLXPE  559
            TGIGIHQL+EDG+L PE
Sbjct  176  TGIGIHQLMEDGSLGPE  192



>gb|AAL57645.1| At2g47390/T8I13.23 [Arabidopsis thaliana]
 gb|AAO11566.1| At2g47390/T8I13.23 [Arabidopsis thaliana]
Length=960

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ A+G  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101  DDELAIGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  161  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  194



>sp|Q8VZF3.2|CGEP_ARATH RecName: Full=Probable glutamyl endopeptidase, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
Length=960

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ A+G  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101  DDELAIGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  161  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  194



>ref|NP_850473.1| probable glutamyl endopeptidase [Arabidopsis thaliana]
 gb|AEC10835.1| probable glutamyl endopeptidase [Arabidopsis thaliana]
Length=961

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ A+G  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101  DDELAIGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  161  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  194



>gb|AAB63841.1| unknown protein [Arabidopsis thaliana]
Length=955

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ A+G  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  101  DDELAIGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  160

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIHQLL DGTL PE
Sbjct  161  GVRIDGYCNTRSRMSFYTGLGIHQLLPDGTLSPE  194



>ref|XP_004494425.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=957

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 102/131 (78%), Gaps = 1/131 (1%)
 Frame = +2

Query  170  ASSRSPHLVPLTAV-gnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDA  346
            ++SR  HL PL AV      GG S  + +  S   S  D EALG  YR+PPPEIRDIVDA
Sbjct  50   STSRFHHLAPLAAVPAENSAGGTSNGSVSSYSTADSSTDYEALGVGYRVPPPEIRDIVDA  109

Query  347  PPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIH  526
            PPVPALSFSP RDKI+FLKRRSLPPL++LARPE KLAG+RIDG CNSRSRMSFYTG+GIH
Sbjct  110  PPVPALSFSPHRDKIIFLKRRSLPPLTELARPEEKLAGLRIDGYCNSRSRMSFYTGLGIH  169

Query  527  QLLEDGTLXPE  559
            Q+L DGTL PE
Sbjct  170  QILPDGTLGPE  180



>ref|XP_004300449.2| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Fragaria vesca subsp. vesca]
Length=955

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 106/134 (79%), Gaps = 3/134 (2%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  337
            +AM A+SR  ++VPL AV  E+ G  S ++    +   S++D+E     YRLPP EI+DI
Sbjct  51   AAMSATSRLSNIVPLNAVVAENAGNGSVSSATATT---SFEDEEDSTMGYRLPPKEIKDI  107

Query  338  VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  517
            VDAPP+PALSFSP RDKILFLKRR+LPPLS+LARPE KLAG+RIDGKCN+R+RMSFYTGI
Sbjct  108  VDAPPLPALSFSPHRDKILFLKRRALPPLSELARPEEKLAGVRIDGKCNTRTRMSFYTGI  167

Query  518  GIHQLLEDGTLXPE  559
            GIHQLL DGTL  E
Sbjct  168  GIHQLLPDGTLGSE  181



>ref|XP_010652241.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Vitis vinifera]
Length=963

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = +2

Query  161  AMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIV  340
            A  +SSR  HLVP+ A   E   G  +     ++A+   +++ ALG+ YRLPPPEI+DIV
Sbjct  57   AAMSSSRFLHLVPINAAAAEGDTGVGSNGSVSSTAED--EENSALGSGYRLPPPEIKDIV  114

Query  341  DAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIG  520
            DAPP+PALSFSPQRDKILFLKRR+LPPL +LA+PE KLAGIRIDGKCN+RSRMSFYT IG
Sbjct  115  DAPPLPALSFSPQRDKILFLKRRALPPLEELAKPEEKLAGIRIDGKCNTRSRMSFYTSIG  174

Query  521  IHQLLEDGTLXPE  559
            IHQL+ DGTL PE
Sbjct  175  IHQLMPDGTLGPE  187



>ref|XP_010652242.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Vitis vinifera]
Length=962

 Score =   166 bits (421),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = +2

Query  161  AMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIV  340
            A  +SSR  HLVP+ A   E   G  +     ++A+   +++ ALG+ YRLPPPEI+DIV
Sbjct  57   AAMSSSRFLHLVPINAAAAEGDTGVGSNGSVSSTAED--EENSALGSGYRLPPPEIKDIV  114

Query  341  DAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIG  520
            DAPP+PALSFSPQRDKILFLKRR+LPPL +LA+PE KLAGIRIDGKCN+RSRMSFYT IG
Sbjct  115  DAPPLPALSFSPQRDKILFLKRRALPPLEELAKPEEKLAGIRIDGKCNTRSRMSFYTSIG  174

Query  521  IHQLLEDGTLXPE  559
            IHQL+ DGTL PE
Sbjct  175  IHQLMPDGTLGPE  187



>emb|CBI36950.3| unnamed protein product [Vitis vinifera]
Length=913

 Score =   166 bits (421),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = +2

Query  170  ASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAP  349
            +SSR  HLVP+ A   E   G  +     ++A+   +++ ALG+ YRLPPPEI+DIVDAP
Sbjct  2    SSSRFLHLVPINAAAAEGDTGVGSNGSVSSTAED--EENSALGSGYRLPPPEIKDIVDAP  59

Query  350  PVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQ  529
            P+PALSFSPQRDKILFLKRR+LPPL +LA+PE KLAGIRIDGKCN+RSRMSFYT IGIHQ
Sbjct  60   PLPALSFSPQRDKILFLKRRALPPLEELAKPEEKLAGIRIDGKCNTRSRMSFYTSIGIHQ  119

Query  530  LLEDGTLXPE  559
            L+ DGTL PE
Sbjct  120  LMPDGTLGPE  129



>ref|XP_006349188.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
[Solanum tuberosum]
Length=976

 Score =   166 bits (421),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = +2

Query  170  ASSRSPHLVPLTAVgnedgggasaangavasadP-SYDDD--EALGNQYRLPPPEIRDIV  340
            ASSR  HLVP+ A+  EDGG  + +NGA  +    +YDDD   A    YRLPP EIRDIV
Sbjct  72   ASSRFHHLVPVNALTAEDGGNGTGSNGAADATASVAYDDDVESASVTGYRLPPFEIRDIV  131

Query  341  DAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIG  520
            DAPP+PALSFSP RDKILFLKRRSLPPLSDLARPE KLAGIRIDGKCN+RSRMSFYTGI 
Sbjct  132  DAPPLPALSFSPLRDKILFLKRRSLPPLSDLARPEEKLAGIRIDGKCNTRSRMSFYTGIA  191

Query  521  IHQLLEDGTLXPE  559
            IHQL+EDG+L PE
Sbjct  192  IHQLMEDGSLGPE  204



>ref|XP_007200322.1| hypothetical protein PRUPE_ppa000899mg [Prunus persica]
 gb|EMJ01521.1| hypothetical protein PRUPE_ppa000899mg [Prunus persica]
Length=967

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSY---DDDEALGNQYRLPPPEI  328
            +A+ A+SR  +LVP+ AV +EDG G ++     ++A  +    ++D  LG +YRLPP EI
Sbjct  55   TAVMATSRLRNLVPVNAVASEDGSGGASNGSVASTAATTALEDEEDSTLGVRYRLPPQEI  114

Query  329  RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  508
            +DIVDAPP+PALSFSP RDKILFLKRRSLPPL++LARPE KLAG+RIDGKCN+R+RMSFY
Sbjct  115  KDIVDAPPLPALSFSPHRDKILFLKRRSLPPLAELARPEEKLAGVRIDGKCNTRTRMSFY  174

Query  509  TGIGIHQLLEDGTLXPE  559
            TGIGIHQLL DGTL PE
Sbjct  175  TGIGIHQLLPDGTLGPE  191



>ref|XP_011041183.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Populus euphratica]
Length=958

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 4/129 (3%)
 Frame = +2

Query  173  SSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAPP  352
            +SR P+LVPL ++  E+ GG S  + + A    S +D+EAL  +Y+LPPPEI++IVDAPP
Sbjct  59   TSRFPNLVPLNSIAAENVGGRSNDSVSSA----STEDEEALAGKYQLPPPEIKNIVDAPP  114

Query  353  VPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQL  532
            +PALSFSPQRDKILFLKRRSLPPL++LARPE KLAG+RIDG CN++SRMSFYTGIGIHQL
Sbjct  115  LPALSFSPQRDKILFLKRRSLPPLAELARPEEKLAGLRIDGNCNTKSRMSFYTGIGIHQL  174

Query  533  LEDGTLXPE  559
            + DG L PE
Sbjct  175  MPDGILGPE  183



>ref|XP_010259303.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Nelumbo nucifera]
 ref|XP_010259304.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Nelumbo nucifera]
Length=963

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            +++ +LG+ YRLPP EI+DIVDAPP+PALSFSPQRDKILFLKRRSLPPL++LARPE KLA
Sbjct  96   EENASLGSGYRLPPTEIKDIVDAPPLPALSFSPQRDKILFLKRRSLPPLAELARPEEKLA  155

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRIDGKCNSRSRMSFYTGIGIHQLL+DG+L PE
Sbjct  156  GIRIDGKCNSRSRMSFYTGIGIHQLLQDGSLGPE  189



>ref|XP_010259302.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Nelumbo nucifera]
Length=964

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            +++ +LG+ YRLPP EI+DIVDAPP+PALSFSPQRDKILFLKRRSLPPL++LARPE KLA
Sbjct  96   EENASLGSGYRLPPTEIKDIVDAPPLPALSFSPQRDKILFLKRRSLPPLAELARPEEKLA  155

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRIDGKCNSRSRMSFYTGIGIHQLL+DG+L PE
Sbjct  156  GIRIDGKCNSRSRMSFYTGIGIHQLLQDGSLGPE  189



>ref|XP_008369041.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Malus domestica]
Length=972

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 110/138 (80%), Gaps = 4/138 (3%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedggg--asaangavasadPSYDDDE--ALGNQYRLPPPE  325
            +A  A+SR  +LVP+ AV +ED     A+  + +  +A  S DD+E   LG +YRLPP E
Sbjct  59   AAAMATSRLRNLVPVNAVASEDSNSGGATNGSVSSTAAATSLDDEEDATLGVRYRLPPQE  118

Query  326  IRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSF  505
            I+DIVDAPP+PALSFSP RDKILFLKRR+LPPL++LARPE KLAG+RIDGKCN+R+RMSF
Sbjct  119  IKDIVDAPPLPALSFSPHRDKILFLKRRALPPLAELARPEEKLAGVRIDGKCNTRTRMSF  178

Query  506  YTGIGIHQLLEDGTLXPE  559
            YTGIGIHQLL DGTL PE
Sbjct  179  YTGIGIHQLLPDGTLGPE  196



>ref|XP_008369043.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Malus domestica]
 ref|XP_008369044.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Malus domestica]
 ref|XP_008363721.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Malus domestica]
 ref|XP_008363722.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Malus domestica]
Length=971

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 110/138 (80%), Gaps = 4/138 (3%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedggg--asaangavasadPSYDDDE--ALGNQYRLPPPE  325
            +A  A+SR  +LVP+ AV +ED     A+  + +  +A  S DD+E   LG +YRLPP E
Sbjct  59   AAAMATSRLRNLVPVNAVASEDSNSGGATNGSVSSTAAATSLDDEEDATLGVRYRLPPQE  118

Query  326  IRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSF  505
            I+DIVDAPP+PALSFSP RDKILFLKRR+LPPL++LARPE KLAG+RIDGKCN+R+RMSF
Sbjct  119  IKDIVDAPPLPALSFSPHRDKILFLKRRALPPLAELARPEEKLAGVRIDGKCNTRTRMSF  178

Query  506  YTGIGIHQLLEDGTLXPE  559
            YTGIGIHQLL DGTL PE
Sbjct  179  YTGIGIHQLLPDGTLGPE  196



>gb|KCW58331.1| hypothetical protein EUGRSUZ_H01015 [Eucalyptus grandis]
Length=967

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            D+  ALG  YRLPPPEIRDIVDAPP+PALSFSPQRDKILFL+RR+LPPL++LARPE KLA
Sbjct  99   DEGSALGGAYRLPPPEIRDIVDAPPLPALSFSPQRDKILFLRRRALPPLAELARPEEKLA  158

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRIDGKCN+RSRMSFYTGIGIHQLL DG L PE
Sbjct  159  GIRIDGKCNTRSRMSFYTGIGIHQLLPDGKLGPE  192



>gb|KCW58332.1| hypothetical protein EUGRSUZ_H01015 [Eucalyptus grandis]
Length=971

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            D+  ALG  YRLPPPEIRDIVDAPP+PALSFSPQRDKILFL+RR+LPPL++LARPE KLA
Sbjct  99   DEGSALGGAYRLPPPEIRDIVDAPPLPALSFSPQRDKILFLRRRALPPLAELARPEEKLA  158

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRIDGKCN+RSRMSFYTGIGIHQLL DG L PE
Sbjct  159  GIRIDGKCNTRSRMSFYTGIGIHQLLPDGKLGPE  192



>ref|XP_010069839.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Eucalyptus 
grandis]
Length=968

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            D+  ALG  YRLPPPEIRDIVDAPP+PALSFSPQRDKILFL+RR+LPPL++LARPE KLA
Sbjct  100  DEGSALGGAYRLPPPEIRDIVDAPPLPALSFSPQRDKILFLRRRALPPLAELARPEEKLA  159

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRIDGKCN+RSRMSFYTGIGIHQLL DG L PE
Sbjct  160  GIRIDGKCNTRSRMSFYTGIGIHQLLPDGKLGPE  193



>gb|KFK37479.1| hypothetical protein AALP_AA4G262700 [Arabis alpina]
Length=964

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+ ALG  YRLPPPEIRDIVDAPPVPALSFSP RDKILFLKRR+LPPL+DLARPE KLA
Sbjct  103  DDELALGTGYRLPPPEIRDIVDAPPVPALSFSPHRDKILFLKRRALPPLADLARPEEKLA  162

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG CN+RSRMSFYTG+GIH LL DGTL PE
Sbjct  163  GVRIDGYCNTRSRMSFYTGLGIHLLLPDGTLSPE  196



>ref|XP_008235148.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Prunus mume]
Length=966

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSY---DDDEALGNQYRLPPPEI  328
            +A+ A+SR  +LVP+ AV +EDG G ++     ++A  +    ++D  LG +YRLPP EI
Sbjct  55   TAVMATSRLRNLVPVNAVASEDGSGRASNGSVSSTAATTALEDEEDSTLGVRYRLPPQEI  114

Query  329  RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  508
            +DIVDAPP+PALSFSP RDKILFLKRRSLPPL+++ARPE KLAG+RIDGKCN+R+RMSFY
Sbjct  115  KDIVDAPPLPALSFSPHRDKILFLKRRSLPPLAEIARPEEKLAGVRIDGKCNTRTRMSFY  174

Query  509  TGIGIHQLLEDGTLXPE  559
            TGIGIHQLL DGTL PE
Sbjct  175  TGIGIHQLLPDGTLGPE  191



>ref|XP_008235149.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Prunus mume]
Length=966

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSY---DDDEALGNQYRLPPPEI  328
            +A+ A+SR  +LVP+ AV +EDG G ++     ++A  +    ++D  LG +YRLPP EI
Sbjct  55   TAVMATSRLRNLVPVNAVASEDGSGRASNGSVSSTAATTALEDEEDSTLGVRYRLPPQEI  114

Query  329  RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  508
            +DIVDAPP+PALSFSP RDKILFLKRRSLPPL+++ARPE KLAG+RIDGKCN+R+RMSFY
Sbjct  115  KDIVDAPPLPALSFSPHRDKILFLKRRSLPPLAEIARPEEKLAGVRIDGKCNTRTRMSFY  174

Query  509  TGIGIHQLLEDGTLXPE  559
            TGIGIHQLL DGTL PE
Sbjct  175  TGIGIHQLLPDGTLGPE  191



>gb|KEH24431.1| glutamyl endopeptidase, putative [Medicago truncatula]
Length=959

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = +2

Query  161  AMPASSRSPHLVPLTAVgne-dgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  337
            A  ++SR  H+VPL AV  E   GGA   + + +S   +Y D EALG  Y +PPPEIRDI
Sbjct  49   ASMSTSRFRHIVPLAAVSTEDGAGGAVNGSVSSSSTADTYYDYEALGVGYCVPPPEIRDI  108

Query  338  VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  517
            VDAPPVPALSFSP RDKI+FLKRR+LPPL+DLARPE KLAG+RIDG CNSRSRMSFYTG+
Sbjct  109  VDAPPVPALSFSPFRDKIIFLKRRALPPLTDLARPEEKLAGLRIDGYCNSRSRMSFYTGL  168

Query  518  GIHQLLEDGTLXPE  559
            GIH++L DGTL PE
Sbjct  169  GIHEILPDGTLGPE  182



>ref|XP_003625970.1| Acylamino-acid-releasing enzyme [Medicago truncatula]
 gb|AES82188.1| glutamyl endopeptidase, putative [Medicago truncatula]
Length=962

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +2

Query  161  AMPASSRSPHLVPLTAVgnedgggasaangavasadPS----YDDDEALGNQYRLPPPEI  328
            A  ++SR  H+VPL AV  EDG G +      +S+       Y+DD ALG  Y +PPPEI
Sbjct  49   ASMSTSRFRHIVPLAAVSTEDGAGGAVNGSVSSSSTADTYYDYEDDLALGVGYCVPPPEI  108

Query  329  RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  508
            RDIVDAPPVPALSFSP RDKI+FLKRR+LPPL+DLARPE KLAG+RIDG CNSRSRMSFY
Sbjct  109  RDIVDAPPVPALSFSPFRDKIIFLKRRALPPLTDLARPEEKLAGLRIDGYCNSRSRMSFY  168

Query  509  TGIGIHQLLEDGTLXPE  559
            TG+GIH++L DGTL PE
Sbjct  169  TGLGIHEILPDGTLGPE  185



>gb|KEH24430.1| glutamyl endopeptidase, putative [Medicago truncatula]
Length=959

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = +2

Query  161  AMPASSRSPHLVPLTAVgne-dgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  337
            A  ++SR  H+VPL AV  E   GGA   + + +S   +Y D EALG  Y +PPPEIRDI
Sbjct  49   ASMSTSRFRHIVPLAAVSTEDGAGGAVNGSVSSSSTADTYYDYEALGVGYCVPPPEIRDI  108

Query  338  VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  517
            VDAPPVPALSFSP RDKI+FLKRR+LPPL+DLARPE KLAG+RIDG CNSRSRMSFYTG+
Sbjct  109  VDAPPVPALSFSPFRDKIIFLKRRALPPLTDLARPEEKLAGLRIDGYCNSRSRMSFYTGL  168

Query  518  GIHQLLEDGTLXPE  559
            GIH++L DGTL PE
Sbjct  169  GIHEILPDGTLGPE  182



>gb|KEH24432.1| glutamyl endopeptidase, putative [Medicago truncatula]
Length=962

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +2

Query  161  AMPASSRSPHLVPLTAVgnedgggasaangavasadPS----YDDDEALGNQYRLPPPEI  328
            A  ++SR  H+VPL AV  EDG G +      +S+       Y+DD ALG  Y +PPPEI
Sbjct  49   ASMSTSRFRHIVPLAAVSTEDGAGGAVNGSVSSSSTADTYYDYEDDLALGVGYCVPPPEI  108

Query  329  RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  508
            RDIVDAPPVPALSFSP RDKI+FLKRR+LPPL+DLARPE KLAG+RIDG CNSRSRMSFY
Sbjct  109  RDIVDAPPVPALSFSPFRDKIIFLKRRALPPLTDLARPEEKLAGLRIDGYCNSRSRMSFY  168

Query  509  TGIGIHQLLEDGTLXPE  559
            TG+GIH++L DGTL PE
Sbjct  169  TGLGIHEILPDGTLGPE  185



>ref|XP_011465337.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Fragaria vesca subsp. vesca]
Length=954

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 106/134 (79%), Gaps = 4/134 (3%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  337
            +AM A+SR  ++VPL AV  E+ G  S ++    ++    D+D  +G  YRLPP EI+DI
Sbjct  51   AAMSATSRLSNIVPLNAVVAENAGNGSVSSATATTSFE--DEDSTMG--YRLPPKEIKDI  106

Query  338  VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  517
            VDAPP+PALSFSP RDKILFLKRR+LPPLS+LARPE KLAG+RIDGKCN+R+RMSFYTGI
Sbjct  107  VDAPPLPALSFSPHRDKILFLKRRALPPLSELARPEEKLAGVRIDGKCNTRTRMSFYTGI  166

Query  518  GIHQLLEDGTLXPE  559
            GIHQLL DGTL  E
Sbjct  167  GIHQLLPDGTLGSE  180



>gb|KEH24433.1| glutamyl endopeptidase, putative [Medicago truncatula]
Length=867

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 106/137 (77%), Gaps = 4/137 (3%)
 Frame = +2

Query  161  AMPASSRSPHLVPLTAVgnedgggasaangavasadPS----YDDDEALGNQYRLPPPEI  328
            A  ++SR  H+VPL AV  EDG G +      +S+       Y+DD ALG  Y +PPPEI
Sbjct  49   ASMSTSRFRHIVPLAAVSTEDGAGGAVNGSVSSSSTADTYYDYEDDLALGVGYCVPPPEI  108

Query  329  RDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFY  508
            RDIVDAPPVPALSFSP RDKI+FLKRR+LPPL+DLARPE KLAG+RIDG CNSRSRMSFY
Sbjct  109  RDIVDAPPVPALSFSPFRDKIIFLKRRALPPLTDLARPEEKLAGLRIDGYCNSRSRMSFY  168

Query  509  TGIGIHQLLEDGTLXPE  559
            TG+GIH++L DGTL PE
Sbjct  169  TGLGIHEILPDGTLGPE  185



>ref|XP_007051106.1| Prolyl oligopeptidase family protein [Theobroma cacao]
 gb|EOX95263.1| Prolyl oligopeptidase family protein [Theobroma cacao]
Length=974

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            D++ A+G +YRLPPPEIRDIVDAPP+PALSFSP RDKILFLKRRSLPPL++L RPE KLA
Sbjct  104  DENVAIGVKYRLPPPEIRDIVDAPPLPALSFSPLRDKILFLKRRSLPPLAELGRPEEKLA  163

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRIDGKCN+RSRMSFYTGIGIHQL+ DG+L PE
Sbjct  164  GIRIDGKCNTRSRMSFYTGIGIHQLMPDGSLGPE  197



>ref|XP_007163177.1| hypothetical protein PHAVU_001G213000g [Phaseolus vulgaris]
 gb|ESW35171.1| hypothetical protein PHAVU_001G213000g [Phaseolus vulgaris]
Length=951

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  275  YDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            Y+D+  LG +YR+PPPEI  IVDAPPVPALSFSP RDKI+FLKRR+LPPL+++ARPE KL
Sbjct  80   YEDESTLGTKYRVPPPEISKIVDAPPVPALSFSPLRDKIIFLKRRALPPLAEIARPEKKL  139

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            AG+RIDGKCN+RSRMSFYTGIGIHQ+L DGTL PE
Sbjct  140  AGVRIDGKCNTRSRMSFYTGIGIHQILPDGTLGPE  174



>gb|EYU46808.1| hypothetical protein MIMGU_mgv1a000875mg [Erythranthe guttata]
Length=953

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  281  DDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAG  460
            +D +L N Y LPPPEIRDIVDAPP+P LSFSP RDKILFLKRRSLPPL+DLARPE KLAG
Sbjct  89   EDASLENGYCLPPPEIRDIVDAPPLPTLSFSPHRDKILFLKRRSLPPLADLARPEEKLAG  148

Query  461  IRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            +RIDGKCNSRSRMS+YTGIG+HQL+ DGTL PE
Sbjct  149  VRIDGKCNSRSRMSYYTGIGVHQLMNDGTLGPE  181



>ref|XP_007163178.1| hypothetical protein PHAVU_001G213000g [Phaseolus vulgaris]
 gb|ESW35172.1| hypothetical protein PHAVU_001G213000g [Phaseolus vulgaris]
Length=953

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  275  YDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            Y+D+  LG +YR+PPPEI  IVDAPPVPALSFSP RDKI+FLKRR+LPPL+++ARPE KL
Sbjct  80   YEDESTLGTKYRVPPPEISKIVDAPPVPALSFSPLRDKIIFLKRRALPPLAEIARPEKKL  139

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            AG+RIDGKCN+RSRMSFYTGIGIHQ+L DGTL PE
Sbjct  140  AGVRIDGKCNTRSRMSFYTGIGIHQILPDGTLGPE  174



>gb|KJB49820.1| hypothetical protein B456_008G139300 [Gossypium raimondii]
Length=962

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +2

Query  170  ASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAP  349
            ++SR   LVP+ +   EDG  A   +   +      DD+  +G +YR+PPPEIRDIVDAP
Sbjct  56   SASRFNRLVPVNSALAEDGSAAGNGSANASLTFAEDDDESVIGVKYRVPPPEIRDIVDAP  115

Query  350  PVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQ  529
            P+PALSFSP RDKILF+KRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIH 
Sbjct  116  PLPALSFSPLRDKILFMKRRSLPPLAELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHS  175

Query  530  LLEDGTLXPES  562
            L+ DG+L PE+
Sbjct  176  LMPDGSLGPET  186



>gb|KJB49821.1| hypothetical protein B456_008G139300 [Gossypium raimondii]
Length=961

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +2

Query  170  ASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAP  349
            ++SR   LVP+ +   EDG  A   +   +      DD+  +G +YR+PPPEIRDIVDAP
Sbjct  56   SASRFNRLVPVNSALAEDGSAAGNGSANASLTFAEDDDESVIGVKYRVPPPEIRDIVDAP  115

Query  350  PVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQ  529
            P+PALSFSP RDKILF+KRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIH 
Sbjct  116  PLPALSFSPLRDKILFMKRRSLPPLAELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHS  175

Query  530  LLEDGTLXPES  562
            L+ DG+L PE+
Sbjct  176  LMPDGSLGPET  186



>gb|KJB49822.1| hypothetical protein B456_008G139300 [Gossypium raimondii]
Length=964

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +2

Query  170  ASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAP  349
            ++SR   LVP+ +   EDG  A   +   +      DD+  +G +YR+PPPEIRDIVDAP
Sbjct  56   SASRFNRLVPVNSALAEDGSAAGNGSANASLTFAEDDDESVIGVKYRVPPPEIRDIVDAP  115

Query  350  PVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQ  529
            P+PALSFSP RDKILF+KRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIH 
Sbjct  116  PLPALSFSPLRDKILFMKRRSLPPLAELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHS  175

Query  530  LLEDGTLXPES  562
            L+ DG+L PE+
Sbjct  176  LMPDGSLGPET  186



>ref|XP_009774673.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Nicotiana sylvestris]
Length=964

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 2/98 (2%)
 Frame = +2

Query  272  SYDDD--EALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPE  445
            +YDDD   A    YRLPP EIRDIVDAPP+PALSFSP RDKILFLKRRSLPPLSDLARPE
Sbjct  95   AYDDDLESASETGYRLPPREIRDIVDAPPLPALSFSPLRDKILFLKRRSLPPLSDLARPE  154

Query  446  VKLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
             KLAG+RIDGKCN+RSRMSFYTGIGIH L+EDG+L PE
Sbjct  155  EKLAGVRIDGKCNTRSRMSFYTGIGIHHLMEDGSLGPE  192



>ref|XP_009774672.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Nicotiana sylvestris]
Length=975

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 86/98 (88%), Gaps = 2/98 (2%)
 Frame = +2

Query  272  SYDDD--EALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPE  445
            +YDDD   A    YRLPP EIRDIVDAPP+PALSFSP RDKILFLKRRSLPPLSDLARPE
Sbjct  95   AYDDDLESASETGYRLPPREIRDIVDAPPLPALSFSPLRDKILFLKRRSLPPLSDLARPE  154

Query  446  VKLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
             KLAG+RIDGKCN+RSRMSFYTGIGIH L+EDG+L PE
Sbjct  155  EKLAGVRIDGKCNTRSRMSFYTGIGIHHLMEDGSLGPE  192



>emb|CDP17069.1| unnamed protein product [Coffea canephora]
Length=916

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 107/133 (80%), Gaps = 8/133 (6%)
 Frame = +2

Query  164  MPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALG-NQYRLPPPEIRDIV  340
            MP SSR  +LVP+ AV  EDG  ++A++       P+  +++ LG N Y+ PPPEIRDIV
Sbjct  1    MP-SSRIHNLVPVNAVAVEDGAASNASDP------PASPENQDLGANGYQFPPPEIRDIV  53

Query  341  DAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIG  520
            DAPP+PALSFSPQRDKILFLKRRSLPPL++LARPE KLAG+RIDGKCNSRSRMSFYTGIG
Sbjct  54   DAPPLPALSFSPQRDKILFLKRRSLPPLAELARPEEKLAGVRIDGKCNSRSRMSFYTGIG  113

Query  521  IHQLLEDGTLXPE  559
            IH L  DGTL PE
Sbjct  114  IHLLNADGTLGPE  126



>gb|KHG24720.1| putative glutamyl endopeptidase, chloroplastic -like protein 
[Gossypium arboreum]
Length=896

 Score =   160 bits (405),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DD+  +G +YR+PPPEIRDIVDAPP+PALSFSP RDKILFLKRRSLPPL++LARPE KLA
Sbjct  92   DDESVIGVKYRVPPPEIRDIVDAPPLPALSFSPLRDKILFLKRRSLPPLAELARPEEKLA  151

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPES  562
            G+RIDGKCN+RSRMSFYTGIGIH L+ DG+L PE+
Sbjct  152  GLRIDGKCNTRSRMSFYTGIGIHPLMPDGSLGPET  186



>ref|XP_009378723.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Pyrus x bretschneideri]
Length=972

 Score =   160 bits (406),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            ++D  LG +YRLPP EI+DIVDAPP+PALSFSP+RDKILFLKRR+LPPL++LARPE KLA
Sbjct  103  EEDATLGVRYRLPPQEIKDIVDAPPLPALSFSPRRDKILFLKRRALPPLAELARPEEKLA  162

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDGKCN+R+RMSFYTGIGIHQ L DGTL PE
Sbjct  163  GVRIDGKCNTRTRMSFYTGIGIHQFLPDGTLGPE  196



>ref|XP_009378724.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Pyrus x bretschneideri]
Length=971

 Score =   160 bits (406),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            ++D  LG +YRLPP EI+DIVDAPP+PALSFSP+RDKILFLKRR+LPPL++LARPE KLA
Sbjct  103  EEDATLGVRYRLPPQEIKDIVDAPPLPALSFSPRRDKILFLKRRALPPLAELARPEEKLA  162

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDGKCN+R+RMSFYTGIGIHQ L DGTL PE
Sbjct  163  GVRIDGKCNTRTRMSFYTGIGIHQFLPDGTLGPE  196



>ref|XP_006444495.1| hypothetical protein CICLE_v10018738mg [Citrus clementina]
 gb|ESR57735.1| hypothetical protein CICLE_v10018738mg [Citrus clementina]
Length=771

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 106/134 (79%), Gaps = 4/134 (3%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  337
            +AM AS R  HLVP+ +V +++ G   + + + A    + +D++ L  +YRLPPPEIR+I
Sbjct  50   TAMTAS-RLHHLVPIHSVSSKNDGTNGSLSSSNAV---ATEDEDNLEGRYRLPPPEIREI  105

Query  338  VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  517
            VDAPP+PALSFSPQRDKILFLKRR+LPPL +LARPE KLAG+RIDGKCN+RSRMSFYTGI
Sbjct  106  VDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGI  165

Query  518  GIHQLLEDGTLXPE  559
            GIHQL  DG L  E
Sbjct  166  GIHQLFPDGKLGQE  179



>ref|XP_006492336.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=969

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 106/134 (79%), Gaps = 4/134 (3%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  337
            +AM AS R  HLVP+ +V +++ G   + + + A    + +D++ L  +YRLPPPEIR+I
Sbjct  50   TAMTAS-RLHHLVPIHSVSSKNDGTNGSLSSSNAV---ATEDEDNLEGRYRLPPPEIREI  105

Query  338  VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  517
            VDAPP+PALSFSPQRDKILFLKRR+LPPL +LARPE KLAG+RIDGKCN+RSRMSFYTGI
Sbjct  106  VDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGI  165

Query  518  GIHQLLEDGTLXPE  559
            GIHQL  DG L  E
Sbjct  166  GIHQLFPDGKLGQE  179



>ref|XP_006444496.1| hypothetical protein CICLE_v10018738mg [Citrus clementina]
 ref|XP_006492337.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR57736.1| hypothetical protein CICLE_v10018738mg [Citrus clementina]
 gb|KDO86996.1| hypothetical protein CISIN_1g002164mg [Citrus sinensis]
Length=953

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 106/134 (79%), Gaps = 4/134 (3%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  337
            +AM AS R  HLVP+ +V +++ G   + + + A    + +D++ L  +YRLPPPEIR+I
Sbjct  50   TAMTAS-RLHHLVPIHSVSSKNDGTNGSLSSSNAV---ATEDEDNLEGRYRLPPPEIREI  105

Query  338  VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  517
            VDAPP+PALSFSPQRDKILFLKRR+LPPL +LARPE KLAG+RIDGKCN+RSRMSFYTGI
Sbjct  106  VDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGI  165

Query  518  GIHQLLEDGTLXPE  559
            GIHQL  DG L  E
Sbjct  166  GIHQLFPDGKLGQE  179



>gb|KDO86997.1| hypothetical protein CISIN_1g002164mg [Citrus sinensis]
Length=954

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 106/134 (79%), Gaps = 4/134 (3%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  337
            +AM AS R  HLVP+ +V +++ G   + + + A    + +D++ L  +YRLPPPEIR+I
Sbjct  50   TAMTAS-RLHHLVPIHSVSSKNDGTNGSLSSSNAV---ATEDEDNLEGRYRLPPPEIREI  105

Query  338  VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  517
            VDAPP+PALSFSPQRDKILFLKRR+LPPL +LARPE KLAG+RIDGKCN+RSRMSFYTGI
Sbjct  106  VDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGI  165

Query  518  GIHQLLEDGTLXPE  559
            GIHQL  DG L  E
Sbjct  166  GIHQLFPDGKLGQE  179



>gb|KDO86995.1| hypothetical protein CISIN_1g002164mg [Citrus sinensis]
Length=958

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 106/134 (79%), Gaps = 4/134 (3%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDI  337
            +AM AS R  HLVP+ +V +++ G   + + + A    + +D++ L  +YRLPPPEIR+I
Sbjct  50   TAMTAS-RLHHLVPIHSVSSKNDGTNGSLSSSNAV---ATEDEDNLEGRYRLPPPEIREI  105

Query  338  VDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGI  517
            VDAPP+PALSFSPQRDKILFLKRR+LPPL +LARPE KLAG+RIDGKCN+RSRMSFYTGI
Sbjct  106  VDAPPLPALSFSPQRDKILFLKRRALPPLEELARPEEKLAGLRIDGKCNTRSRMSFYTGI  165

Query  518  GIHQLLEDGTLXPE  559
            GIHQL  DG L  E
Sbjct  166  GIHQLFPDGKLGQE  179



>ref|XP_010087237.1| putative glutamyl endopeptidase [Morus notabilis]
 gb|EXB28587.1| putative glutamyl endopeptidase [Morus notabilis]
Length=1305

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 112/141 (79%), Gaps = 4/141 (3%)
 Frame = +2

Query  149  SGISAMPASSRSPHLVPLTAVgnedgggasaangavasadP---SYDDDE-ALGNQYRLP  316
            + +S   +S+R  +LVP+ AV  E+GG   A+NG+ +S+     + D+DE   G  YRLP
Sbjct  44   NAVSMAGSSTRLRNLVPVNAVVAENGGNGGASNGSASSSASATLAEDEDELTAGVGYRLP  103

Query  317  PPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSR  496
            PPEI+DIVDAPP+PALSFSP RDKILFLKRRSLPPL++LARPE KLAGIRIDGKCN+RSR
Sbjct  104  PPEIKDIVDAPPLPALSFSPFRDKILFLKRRSLPPLAELARPEEKLAGIRIDGKCNARSR  163

Query  497  MSFYTGIGIHQLLEDGTLXPE  559
            MSFYTG+ IHQL+ DGTL PE
Sbjct  164  MSFYTGVAIHQLMPDGTLGPE  184



>ref|XP_002301512.2| hypothetical protein POPTR_0002s19700g [Populus trichocarpa]
 gb|EEE80785.2| hypothetical protein POPTR_0002s19700g [Populus trichocarpa]
Length=952

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  290  ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  469
            AL  +Y+LPPPEI+DIVDAPP+PALS SPQ+DKILFLKRRSLPPL++LARPE KLAG+RI
Sbjct  85   ALACKYQLPPPEIKDIVDAPPLPALSLSPQKDKILFLKRRSLPPLAELARPEEKLAGLRI  144

Query  470  DGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            DGKCN++SRMSFYTGIGIHQL+ DGTL PE
Sbjct  145  DGKCNTKSRMSFYTGIGIHQLMPDGTLGPE  174



>ref|XP_011079552.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Sesamum 
indicum]
Length=955

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  281  DDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAG  460
            +D + GN Y LPP EIRDIVDAPP+P LSFSP RDKILFLKRRSLPPL++LARPE KLAG
Sbjct  89   EDSSSGNGYCLPPREIRDIVDAPPLPTLSFSPNRDKILFLKRRSLPPLAELARPEEKLAG  148

Query  461  IRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            +RIDGKCNSRSRMS+YTGIGI+Q+++DGTL PE
Sbjct  149  VRIDGKCNSRSRMSYYTGIGIYQIMDDGTLGPE  181



>ref|XP_011042249.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Populus 
euphratica]
 ref|XP_011042250.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Populus 
euphratica]
Length=936

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 107/135 (79%), Gaps = 5/135 (4%)
 Frame = +2

Query  155  ISAMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRD  334
            IS MP   R  +LVP+ ++  E+ G  S A+ +  S   + ++++AL  +Y+LPPPEI+D
Sbjct  45   ISTMPC--RLGNLVPVNSIAAENVGSRSNASVSSTS---TTEEEDALACKYQLPPPEIKD  99

Query  335  IVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTG  514
            IVDAPP+PALS SPQ+DKILFLKRRSLPPL++LARPE KLAG+RIDG CN++SRMSFYTG
Sbjct  100  IVDAPPLPALSLSPQKDKILFLKRRSLPPLAELARPEEKLAGLRIDGNCNTKSRMSFYTG  159

Query  515  IGIHQLLEDGTLXPE  559
            IGIHQL+ DG L PE
Sbjct  160  IGIHQLMPDGILGPE  174



>gb|KHN19214.1| Putative glutamyl endopeptidase, chloroplastic [Glycine soja]
Length=970

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = +2

Query  161  AMPASSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIV  340
            A  ASSR  +L PL A   ED   AS ++   A+A   YDD+  +G +YR+PP  I DIV
Sbjct  44   ASMASSRLRNLAPLAAAPTEDAAAASISSSPNAAASVDYDDESTVGVRYRVPPSVISDIV  103

Query  341  DAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIG  520
            DAPPVPALSFSP RD+I+FLKRR+LPPL+++ARPE KLAGIRIDGKCN+RSRMSFYTGIG
Sbjct  104  DAPPVPALSFSPLRDRIIFLKRRALPPLAEIARPEEKLAGIRIDGKCNTRSRMSFYTGIG  163

Query  521  IHQLLEDGTLXPES  562
            IHQ+L DGTL  E+
Sbjct  164  IHQILPDGTLGSET  177



>ref|XP_011041192.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Populus euphratica]
Length=954

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 104/129 (81%), Gaps = 8/129 (6%)
 Frame = +2

Query  173  SSRSPHLVPLTAVgnedgggasaangavasadPSYDDDEALGNQYRLPPPEIRDIVDAPP  352
            +SR P+LVPL ++  E+ GG S  + + AS      +DE    +Y+LPPPEI++IVDAPP
Sbjct  59   TSRFPNLVPLNSIAAENVGGRSNDSVSSAST-----EDEG---KYQLPPPEIKNIVDAPP  110

Query  353  VPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQL  532
            +PALSFSPQRDKILFLKRRSLPPL++LARPE KLAG+RIDG CN++SRMSFYTGIGIHQL
Sbjct  111  LPALSFSPQRDKILFLKRRSLPPLAELARPEEKLAGLRIDGNCNTKSRMSFYTGIGIHQL  170

Query  533  LEDGTLXPE  559
            + DG L PE
Sbjct  171  MPDGILGPE  179



>ref|XP_008386780.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamyl endopeptidase, 
chloroplastic [Malus domestica]
Length=969

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 108/138 (78%), Gaps = 4/138 (3%)
 Frame = +2

Query  158  SAMPASSRSPHLVPLTAVgnedggg--asaangavasadPSYDDDE--ALGNQYRLPPPE  325
            +A+ A+SR  +LVP   V +ED  G  AS  + +  +A  + DD+E   L  +YRLP  E
Sbjct  55   TAVMATSRLRNLVPANTVASEDASGGGASKGSVSSXAATTALDDEEDATLAVRYRLPXQE  114

Query  326  IRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSF  505
            I+DIVDAPP+PALSFSP RDKILFLKRR+LPPL++LARPE KLAG+RIDGKCN+R+RMSF
Sbjct  115  IKDIVDAPPLPALSFSPHRDKILFLKRRALPPLTELARPEEKLAGVRIDGKCNTRTRMSF  174

Query  506  YTGIGIHQLLEDGTLXPE  559
            Y+G+GIHQLL DGTL PE
Sbjct  175  YSGVGIHQLLPDGTLGPE  192



>gb|KHN43458.1| Putative glutamyl endopeptidase, chloroplastic [Glycine soja]
Length=910

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  275  YDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            YDD+  +G +Y +PP  I DIVDAPPVPALSFSP RDKI+FLKRR+LPPL+++ARPE KL
Sbjct  37   YDDESTVGVRYHVPPSVISDIVDAPPVPALSFSPLRDKIIFLKRRALPPLAEIARPEEKL  96

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPES  562
            AGIRIDGKCN+RSRMSFYT IGIHQ+L DGTL PE+
Sbjct  97   AGIRIDGKCNTRSRMSFYTAIGIHQILPDGTLGPET  132



>ref|XP_006604741.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X2 [Glycine max]
 ref|XP_006604742.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X3 [Glycine max]
Length=948

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  275  YDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            YDD+  +G +Y +PP  I DIVDAPPVPALSFSP RDKI+FLKRR+LPPL+++ARPE KL
Sbjct  76   YDDESTVGVRYHVPPSVISDIVDAPPVPALSFSPLRDKIIFLKRRALPPLAEIARPEEKL  135

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPES  562
            AGIRIDGKCN+RSRMSFYT IGIHQ+L DGTL PE+
Sbjct  136  AGIRIDGKCNTRSRMSFYTAIGIHQILPDGTLGPET  171



>ref|XP_006604740.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X1 [Glycine max]
Length=949

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  275  YDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            YDD+  +G +Y +PP  I DIVDAPPVPALSFSP RDKI+FLKRR+LPPL+++ARPE KL
Sbjct  76   YDDESTVGVRYHVPPSVISDIVDAPPVPALSFSPLRDKIIFLKRRALPPLAEIARPEEKL  135

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPES  562
            AGIRIDGKCN+RSRMSFYT IGIHQ+L DGTL PE+
Sbjct  136  AGIRIDGKCNTRSRMSFYTAIGIHQILPDGTLGPET  171



>ref|XP_008451481.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic [Cucumis 
melo]
Length=967

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/94 (79%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            D+D  LG  YRLPP EIRDIVDAPP+P LSFSP RDKILFLKRRSLPPLS+LA+PE KLA
Sbjct  99   DEDSVLGVGYRLPPAEIRDIVDAPPLPILSFSPYRDKILFLKRRSLPPLSELAKPEEKLA  158

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRIDG+CN RSR+SFYTGIGIHQL+ D +L PE
Sbjct  159  GIRIDGQCNCRSRISFYTGIGIHQLMPDDSLGPE  192



>ref|XP_010938262.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamyl endopeptidase, 
chloroplastic [Elaeis guineensis]
Length=951

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +2

Query  269  PSYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEV  448
            P  D++ +LG  Y LPP EIRDIVDAPP+P LSFSP RDKILFLKRR+LPPLS+LARPE 
Sbjct  86   PEEDEELSLGGGYHLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRALPPLSELARPEE  145

Query  449  KLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            KLAG+RIDG  N+RSRMSFYTGIGIH+L++DG L PE
Sbjct  146  KLAGVRIDGNSNARSRMSFYTGIGIHELMDDGKLGPE  182



>ref|XP_004135991.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform 1 [Cucumis sativus]
 ref|XP_004163142.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform 1 [Cucumis sativus]
Length=971

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            D+D  LG  YRLPP EIRDIVDAPP+P LSFSP RDKILFLKRRSLPPL++LA+PE KLA
Sbjct  100  DEDSVLGVGYRLPPAEIRDIVDAPPLPLLSFSPYRDKILFLKRRSLPPLAELAKPEEKLA  159

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRIDG+CN RSR+SFYTGIGIHQL+ D +L PE
Sbjct  160  GIRIDGQCNCRSRISFYTGIGIHQLMPDDSLGPE  193



>ref|XP_004135992.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform 2 [Cucumis sativus]
 ref|XP_004163143.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform 2 [Cucumis sativus]
 gb|KGN45015.1| hypothetical protein Csa_7G407680 [Cucumis sativus]
Length=970

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            D+D  LG  YRLPP EIRDIVDAPP+P LSFSP RDKILFLKRRSLPPL++LA+PE KLA
Sbjct  100  DEDSVLGVGYRLPPAEIRDIVDAPPLPLLSFSPYRDKILFLKRRSLPPLAELAKPEEKLA  159

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRIDG+CN RSR+SFYTGIGIHQL+ D +L PE
Sbjct  160  GIRIDGQCNCRSRISFYTGIGIHQLMPDDSLGPE  193



>ref|XP_006840458.1| hypothetical protein AMTR_s00045p00176400 [Amborella trichopoda]
 gb|ERN02133.1| hypothetical protein AMTR_s00045p00176400 [Amborella trichopoda]
Length=899

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            D + +L   Y+LPPP+IR IVD+PP+PALSFSP+RDK+LFLKRR+LPPL+DLARPE KLA
Sbjct  31   DGESSLDGGYQLPPPDIRCIVDSPPLPALSFSPKRDKMLFLKRRALPPLADLARPEEKLA  90

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRIDG CN+RSRMSF+TGIGIH L++DGTL PE
Sbjct  91   GIRIDGNCNTRSRMSFHTGIGIHSLMDDGTLGPE  124



>ref|XP_008813383.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X5 [Phoenix dactylifera]
Length=972

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +2

Query  269  PSYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEV  448
            P  D++ + G  Y LPP EIRDIVDAPP+P LSFSP RDKILFLKRR+LPPLS+LARPE 
Sbjct  90   PEEDEELSSGGGYHLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRALPPLSELARPEE  149

Query  449  KLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            KLAG+RIDG  N+RSRMSFYTGIGIH+L++DG L PE
Sbjct  150  KLAGVRIDGNSNTRSRMSFYTGIGIHELMDDGKLGPE  186



>ref|XP_008813381.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Phoenix dactylifera]
Length=989

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +2

Query  269  PSYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEV  448
            P  D++ + G  Y LPP EIRDIVDAPP+P LSFSP RDKILFLKRR+LPPLS+LARPE 
Sbjct  90   PEEDEELSSGGGYHLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRALPPLSELARPEE  149

Query  449  KLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            KLAG+RIDG  N+RSRMSFYTGIGIH+L++DG L PE
Sbjct  150  KLAGVRIDGNSNTRSRMSFYTGIGIHELMDDGKLGPE  186



>ref|XP_010679382.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=965

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +2

Query  275  YDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            Y+DD A    Y+LPP EIRDIVDAPP+PALS SPQRDK+LFLKRRSLPPL D+A+PE KL
Sbjct  99   YEDDLAASAGYQLPPSEIRDIVDAPPLPALSISPQRDKVLFLKRRSLPPLIDIAKPEEKL  158

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
             GIR+D K N+RSRMSFYTGIGIHQL  DGTL PE
Sbjct  159  GGIRVDVKSNTRSRMSFYTGIGIHQLTSDGTLGPE  193



>ref|XP_008813379.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Phoenix dactylifera]
Length=998

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +2

Query  269  PSYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEV  448
            P  D++ + G  Y LPP EIRDIVDAPP+P LSFSP RDKILFLKRR+LPPLS+LARPE 
Sbjct  90   PEEDEELSSGGGYHLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRALPPLSELARPEE  149

Query  449  KLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            KLAG+RIDG  N+RSRMSFYTGIGIH+L++DG L PE
Sbjct  150  KLAGVRIDGNSNTRSRMSFYTGIGIHELMDDGKLGPE  186



>ref|XP_008813382.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X4 [Phoenix dactylifera]
Length=981

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +2

Query  269  PSYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEV  448
            P  D++ + G  Y LPP EIRDIVDAPP+P LSFSP RDKILFLKRR+LPPLS+LARPE 
Sbjct  90   PEEDEELSSGGGYHLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRALPPLSELARPEE  149

Query  449  KLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            KLAG+RIDG  N+RSRMSFYTGIGIH+L++DG L PE
Sbjct  150  KLAGVRIDGNSNTRSRMSFYTGIGIHELMDDGKLGPE  186



>gb|EMS47754.1| putative glutamyl endopeptidase, chloroplastic [Triticum urartu]
Length=867

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 83/94 (88%), Gaps = 2/94 (2%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DDD +LG  YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLA
Sbjct  79   DDDLSLG--YRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKLA  136

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG  N+RSRMS YTGIGIH+L++DGTL PE
Sbjct  137  GVRIDGHSNTRSRMSSYTGIGIHKLMDDGTLGPE  170



>gb|EMT29865.1| Dipeptidyl peptidase family member 6 [Aegilops tauschii]
Length=854

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 83/94 (88%), Gaps = 2/94 (2%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            DDD +LG  YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLA
Sbjct  81   DDDLSLG--YRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKLA  138

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            G+RIDG  N+RSRMS YTGIGIH+L++DGTL PE
Sbjct  139  GVRIDGHSNTRSRMSSYTGIGIHKLMDDGTLGPE  172



>ref|XP_008813380.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Phoenix dactylifera]
Length=994

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +2

Query  269  PSYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEV  448
            PS   +E  G  Y LPP EIRDIVDAPP+P LSFSP RDKILFLKRR+LPPLS+LARPE 
Sbjct  86   PSSRPEEDEGGGYHLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRALPPLSELARPEE  145

Query  449  KLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            KLAG+RIDG  N+RSRMSFYTGIGIH+L++DG L PE
Sbjct  146  KLAGVRIDGNSNTRSRMSFYTGIGIHELMDDGKLGPE  182



>ref|XP_006649964.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
[Oryza brachyantha]
Length=851

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLAG+RIDG  N
Sbjct  4    YRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKLAGVRIDGHSN  63

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
            +RSRMSFYTGIGIH+L+EDGTL PE
Sbjct  64   TRSRMSFYTGIGIHRLMEDGTLGPE  88



>ref|XP_009414908.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009414909.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=964

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = +2

Query  278  DDDEALG-NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            +D+E+L    YRLPP EIRDIVDAPP+P LSFSP RDKILFLKRRSLPPLS+LARPE KL
Sbjct  97   EDEESLSLGGYRLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRSLPPLSELARPEEKL  156

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            AGIRIDG  N+RSRMSFYTGIGIH L +DG L PE
Sbjct  157  AGIRIDGNYNARSRMSFYTGIGIHSLTDDGKLGPE  191



>ref|XP_009414913.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X5 [Musa acuminata subsp. malaccensis]
Length=960

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = +2

Query  278  DDDEALG-NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            +D+E+L    YRLPP EIRDIVDAPP+P LSFSP RDKILFLKRRSLPPLS+LARPE KL
Sbjct  97   EDEESLSLGGYRLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRSLPPLSELARPEEKL  156

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            AGIRIDG  N+RSRMSFYTGIGIH L +DG L PE
Sbjct  157  AGIRIDGNYNARSRMSFYTGIGIHSLTDDGKLGPE  191



>ref|XP_009414911.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Musa acuminata subsp. malaccensis]
 ref|XP_009414912.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=961

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = +2

Query  278  DDDEALG-NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            +D+E+L    YRLPP EIRDIVDAPP+P LSFSP RDKILFLKRRSLPPLS+LARPE KL
Sbjct  97   EDEESLSLGGYRLPPKEIRDIVDAPPLPVLSFSPHRDKILFLKRRSLPPLSELARPEEKL  156

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            AGIRIDG  N+RSRMSFYTGIGIH L +DG L PE
Sbjct  157  AGIRIDGNYNARSRMSFYTGIGIHSLTDDGKLGPE  191



>ref|XP_004984622.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X1 [Setaria italica]
Length=944

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLAG+RIDG  N
Sbjct  96   YRLPPKEIQDIVDAPPLPVLSFSPNKDKILFLKRRALPPLSDLAKPEEKLAGLRIDGNSN  155

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
            +RSRMSFYTGIGIH+LL+DGTL PE
Sbjct  156  TRSRMSFYTGIGIHKLLDDGTLGPE  180



>ref|XP_004984623.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
isoform X2 [Setaria italica]
Length=943

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLAG+RIDG  N
Sbjct  96   YRLPPKEIQDIVDAPPLPVLSFSPNKDKILFLKRRALPPLSDLAKPEEKLAGLRIDGNSN  155

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
            +RSRMSFYTGIGIH+LL+DGTL PE
Sbjct  156  TRSRMSFYTGIGIHKLLDDGTLGPE  180



>ref|XP_002467980.1| hypothetical protein SORBIDRAFT_01g037483 [Sorghum bicolor]
 gb|EER94978.1| hypothetical protein SORBIDRAFT_01g037483 [Sorghum bicolor]
Length=943

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/95 (76%), Positives = 83/95 (87%), Gaps = 1/95 (1%)
 Frame = +2

Query  278  DDDEALGNQ-YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            DD  + G+  YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KL
Sbjct  86   DDGLSSGDMGYRLPPKEIQDIVDAPPLPVLSFSPNKDKILFLKRRALPPLSDLAKPEEKL  145

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            AG+RIDG  N+RSRMSFYTGIGIH+LL+DGTL PE
Sbjct  146  AGLRIDGNSNTRSRMSFYTGIGIHKLLDDGTLGPE  180



>ref|XP_010228712.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Brachypodium distachyon]
 ref|XP_010228713.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Brachypodium distachyon]
Length=931

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 83/95 (87%), Gaps = 1/95 (1%)
 Frame = +2

Query  278  DDDEALGNQ-YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            DDD + G   YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KL
Sbjct  74   DDDLSSGEMGYRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKL  133

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            AG+RIDG  N+RSRMSFYTGIGIH+L+++GTL PE
Sbjct  134  AGVRIDGHSNTRSRMSFYTGIGIHKLMDNGTLGPE  168



>ref|XP_003558080.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X4 [Brachypodium distachyon]
Length=927

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 83/95 (87%), Gaps = 1/95 (1%)
 Frame = +2

Query  278  DDDEALGNQ-YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            DDD + G   YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KL
Sbjct  74   DDDLSSGEMGYRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKL  133

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            AG+RIDG  N+RSRMSFYTGIGIH+L+++GTL PE
Sbjct  134  AGVRIDGHSNTRSRMSFYTGIGIHKLMDNGTLGPE  168



>ref|XP_010228711.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Brachypodium distachyon]
Length=943

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/95 (75%), Positives = 83/95 (87%), Gaps = 1/95 (1%)
 Frame = +2

Query  278  DDDEALGNQ-YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            DDD + G   YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KL
Sbjct  74   DDDLSSGEMGYRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKL  133

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            AG+RIDG  N+RSRMSFYTGIGIH+L+++GTL PE
Sbjct  134  AGVRIDGHSNTRSRMSFYTGIGIHKLMDNGTLGPE  168



>gb|EEE58916.1| hypothetical protein OsJ_10563 [Oryza sativa Japonica Group]
Length=920

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLAG+RIDG  N
Sbjct  77   YRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKLAGVRIDGYSN  136

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
            +RSRMSFYTGIGIH+L++DGTL PE
Sbjct  137  TRSRMSFYTGIGIHKLMDDGTLGPE  161



>gb|EEC75088.1| hypothetical protein OsI_11240 [Oryza sativa Indica Group]
Length=887

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLAG+RIDG  N
Sbjct  77   YRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKLAGVRIDGYSN  136

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
            +RSRMSFYTGIGIH+L++DGTL PE
Sbjct  137  TRSRMSFYTGIGIHKLMDDGTLGPE  161



>ref|NP_001049893.1| Os03g0307100 [Oryza sativa Japonica Group]
 sp|Q10MJ1.1|CGEP_ORYSJ RecName: Full=Probable glutamyl endopeptidase, chloroplastic; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABF95536.1| prolyl oligopeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11807.1| Os03g0307100 [Oryza sativa Japonica Group]
Length=938

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSDLA+PE KLAG+RIDG  N
Sbjct  91   YRLPPKEIQDIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKLAGVRIDGYSN  150

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
            +RSRMSFYTGIGIH+L++DGTL PE
Sbjct  151  TRSRMSFYTGIGIHKLMDDGTLGPE  175



>gb|KCW58330.1| hypothetical protein EUGRSUZ_H01014 [Eucalyptus grandis]
Length=682

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            D+  ALG  YRLPPPEIRDIVDAPP P LS SPQ DKILFLKRR+LPPL++LARPE KLA
Sbjct  34   DEGSALGGTYRLPPPEIRDIVDAPPCPVLSLSPQGDKILFLKRRALPPLAELARPEEKLA  93

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRID KC++RSR+S+YTG+GIHQL  D  L PE
Sbjct  94   GIRIDVKCSTRSRISYYTGMGIHQLSPDDNLGPE  127



>gb|KCW58328.1| hypothetical protein EUGRSUZ_H01014 [Eucalyptus grandis]
 gb|KCW58329.1| hypothetical protein EUGRSUZ_H01014 [Eucalyptus grandis]
Length=874

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            D+  ALG  YRLPPPEIRDIVDAPP P LS SPQ DKILFLKRR+LPPL++LARPE KLA
Sbjct  34   DEGSALGGTYRLPPPEIRDIVDAPPCPVLSLSPQGDKILFLKRRALPPLAELARPEEKLA  93

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRID KC++RSR+S+YTG+GIHQL  D  L PE
Sbjct  94   GIRIDVKCSTRSRISYYTGMGIHQLSPDDNLGPE  127



>ref|XP_010069840.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamyl endopeptidase, 
chloroplastic [Eucalyptus grandis]
Length=916

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            D+  ALG  YRLPPPEIRDIVDAPP P LS SPQ DKILFLKRR+LPPL++LARPE KLA
Sbjct  34   DEGSALGGTYRLPPPEIRDIVDAPPCPVLSLSPQGDKILFLKRRALPPLAELARPEEKLA  93

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRID KC++RSR+S+YTG+GIHQL  D  L PE
Sbjct  94   GIRIDVKCSTRSRISYYTGMGIHQLSPDDNLGPE  127



>ref|XP_008654901.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X1 [Zea mays]
Length=946

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = +2

Query  278  DDDEALGNQ-YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            DD  + G+  YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSD+A+PE KL
Sbjct  88   DDGLSSGDMGYRLPPKEIQDIVDAPPLPVLSFSPNKDKILFLKRRALPPLSDIAKPEEKL  147

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            AG+RIDG  N+RSRMSFYTGI IH+LL+DGTL PE
Sbjct  148  AGLRIDGNSNTRSRMSFYTGISIHKLLDDGTLGPE  182



>tpg|DAA45011.1| TPA: hypothetical protein ZEAMMB73_493989 [Zea mays]
Length=850

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSD+A+PE KLAG+RIDG  N
Sbjct  3    YRLPPKEIQDIVDAPPLPVLSFSPNKDKILFLKRRALPPLSDIAKPEEKLAGLRIDGNSN  62

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
            +RSRMSFYTGI IH+LL+DGTL PE
Sbjct  63   TRSRMSFYTGISIHKLLDDGTLGPE  87



>ref|XP_008654905.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X2 [Zea mays]
Length=945

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 82/95 (86%), Gaps = 1/95 (1%)
 Frame = +2

Query  278  DDDEALGNQ-YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKL  454
            DD  + G+  YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSD+A+PE KL
Sbjct  88   DDGLSSGDMGYRLPPKEIQDIVDAPPLPVLSFSPNKDKILFLKRRALPPLSDIAKPEEKL  147

Query  455  AGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            AG+RIDG  N+RSRMSFYTGI IH+LL+DGTL PE
Sbjct  148  AGLRIDGNSNTRSRMSFYTGISIHKLLDDGTLGPE  182



>ref|XP_008654909.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic isoform 
X3 [Zea mays]
Length=871

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP EI+DIVDAPP+P LSFSP +DKILFLKRR+LPPLSD+A+PE KLAG+RIDG  N
Sbjct  23   YRLPPKEIQDIVDAPPLPVLSFSPNKDKILFLKRRALPPLSDIAKPEEKLAGLRIDGNSN  82

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
            +RSRMSFYTGI IH+LL+DGTL PE
Sbjct  83   TRSRMSFYTGISIHKLLDDGTLGPE  107



>ref|XP_001754620.1| predicted protein [Physcomitrella patens]
 gb|EDQ80590.1| predicted protein [Physcomitrella patens]
Length=850

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LPP EIR+IVDAPP+PALSFSP+RD+I+FL+RRSLPP+++ A+PE+KLAGIRID   N
Sbjct  23   YQLPPKEIREIVDAPPIPALSFSPKRDEIVFLQRRSLPPVAEFAKPELKLAGIRIDPDYN  82

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
            S SRMSFYTGI I +LL++G L PE
Sbjct  83   SGSRMSFYTGISIRKLLDEGILGPE  107



>ref|XP_006431496.1| hypothetical protein CICLE_v10000356mg [Citrus clementina]
 gb|ESR44736.1| hypothetical protein CICLE_v10000356mg [Citrus clementina]
Length=770

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G +Y+LPP E+R+IVDAP +P LSFSP+RDKILFLKR +LPPL++LARPE KLAGIRID 
Sbjct  25   GGRYQLPPAELREIVDAPSLPVLSFSPRRDKILFLKRSALPPLAELARPEDKLAGIRIDR  84

Query  476  KCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
             CN++SR+ FYTG+GIH +L D +L PE
Sbjct  85   SCNTKSRIPFYTGLGIHLILPDDSLGPE  112



>ref|XP_001761707.1| predicted protein [Physcomitrella patens]
 gb|EDQ73463.1| predicted protein [Physcomitrella patens]
Length=930

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LPP EIR+IVDAP  PALSFSP+RD+ILFL+RRSLPP++D A+PE+KLAG+RID   N
Sbjct  121  YQLPPEEIREIVDAPSTPALSFSPKRDEILFLQRRSLPPVADFAKPELKLAGMRIDPDYN  180

Query  485  SRSRMSFYTGIGIHQLLEDGTLXP  556
            +RSRMSFYTGI IH+ L++G L P
Sbjct  181  ARSRMSFYTGINIHKFLDEGMLGP  204



>ref|XP_004958766.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like 
[Setaria italica]
Length=933

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 76/94 (81%), Gaps = 2/94 (2%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            +DD  LG  YRLPP EI++IVD PP P+   SP+RD+I+FLKRR++PPLSDLA+P+  LA
Sbjct  64   EDDGDLG--YRLPPKEIQEIVDVPPTPSYYISPRRDRIMFLKRRAMPPLSDLAKPDKILA  121

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            GIRID   N+RSRMSFYTGI IH L++DGTL PE
Sbjct  122  GIRIDPSSNTRSRMSFYTGISIHLLMDDGTLGPE  155



>gb|EPS59919.1| hypothetical protein M569_14885 [Genlisea aurea]
Length=198

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +2

Query  290  ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  469
            +LGN YRLP  EIRDIVDAPP+P L+  P++DKILFLKR SLP L+DLARPE KLAG+RI
Sbjct  40   SLGNGYRLPVQEIRDIVDAPPLPNLTLPPRKDKILFLKRNSLPNLADLARPEEKLAGLRI  99

Query  470  DGKCNSRSRMSFYTGIGIHQLLEDGTLXPE  559
            DGK   RSRMS YTGI ++Q+LED TL PE
Sbjct  100  DGKSYCRSRMSSYTGISVYQILEDYTLGPE  129



>ref|XP_002992516.1| hypothetical protein SELMODRAFT_135368, partial [Selaginella 
moellendorffii]
 gb|EFJ06454.1| hypothetical protein SELMODRAFT_135368, partial [Selaginella 
moellendorffii]
Length=837

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LP PEIR IVDAPP PALSFSP+RDKILF+KR SLPPLS+LARPE+KLAG+RID +CN
Sbjct  2    YQLPAPEIRRIVDAPPNPALSFSPKRDKILFMKRTSLPPLSELARPELKLAGLRIDPECN  61

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
             RSRMS Y G+G+  L +DG +  E
Sbjct  62   CRSRMSSYVGLGMSSLSDDGLVGVE  86



>dbj|BAK03859.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=291

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP EI++IVD PP P+   SP+RD+I+FLKRR++PPLS+LA+P+  LAGIRID   N
Sbjct  10   YRLPPKEIQEIVDVPPNPSYHLSPRRDRIMFLKRRAMPPLSELAKPDKVLAGIRIDPGSN  69

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
             RSRMSFYTG+ IH L++DG+L PE
Sbjct  70   MRSRMSFYTGVSIHLLMDDGSLGPE  94



>ref|XP_006442098.1| hypothetical protein CICLE_v10018865mg [Citrus clementina]
 gb|ESR55338.1| hypothetical protein CICLE_v10018865mg [Citrus clementina]
Length=693

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            ++LP PE+R+IVDAP +P+LSFSPQRDKILFLKR SL PL +LARPE KLA  +ID KCN
Sbjct  14   FQLPAPELREIVDAPALPSLSFSPQRDKILFLKRSSLLPLVELARPEEKLASAKIDVKCN  73

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
            ++SRM F+TGIGIH+LL D +L PE
Sbjct  74   AKSRMPFFTGIGIHRLLPDDSLGPE  98



>ref|XP_006442097.1| hypothetical protein CICLE_v10018865mg [Citrus clementina]
 gb|ESR55337.1| hypothetical protein CICLE_v10018865mg [Citrus clementina]
Length=672

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            ++LP PE+R+IVDAP +P+LSFSPQRDKILFLKR SL PL +LARPE KLA  +ID KCN
Sbjct  14   FQLPAPELREIVDAPALPSLSFSPQRDKILFLKRSSLLPLVELARPEEKLASAKIDVKCN  73

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
            ++SRM F+TGIGIH+LL D +L PE
Sbjct  74   AKSRMPFFTGIGIHRLLPDDSLGPE  98



>ref|XP_002990171.1| hypothetical protein SELMODRAFT_131182, partial [Selaginella 
moellendorffii]
 gb|EFJ08731.1| hypothetical protein SELMODRAFT_131182, partial [Selaginella 
moellendorffii]
Length=837

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LP PEIR IVDAPP PALSFSP+RDKILF+KR SLPPLS+LARPE+KLAG+RID +CN
Sbjct  2    YQLPAPEIRRIVDAPPNPALSFSPKRDKILFMKRTSLPPLSELARPELKLAGLRIDPECN  61

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
             RSRMS Y G+G+  L  DG +  E
Sbjct  62   CRSRMSSYVGLGMSSLSHDGLVGVE  86



>ref|XP_006442099.1| hypothetical protein CICLE_v10018865mg [Citrus clementina]
 gb|ESR55339.1| hypothetical protein CICLE_v10018865mg [Citrus clementina]
Length=829

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            ++LP PE+R+IVDAP +P+LSFSPQRDKILFLKR SL PL +LARPE KLA  +ID KCN
Sbjct  14   FQLPAPELREIVDAPALPSLSFSPQRDKILFLKRSSLLPLVELARPEEKLASAKIDVKCN  73

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
            ++SRM F+TGIGIH+LL D +L PE
Sbjct  74   AKSRMPFFTGIGIHRLLPDDSLGPE  98



>ref|XP_001772878.1| predicted protein [Physcomitrella patens]
 gb|EDQ62280.1| predicted protein [Physcomitrella patens]
Length=886

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +2

Query  272  SYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVK  451
            +Y+  +   N Y++PP EIR IVDAPP P L FSP +  ILFL+RRSL PLSD+ARPE+K
Sbjct  27   NYESTQPADNGYQIPPEEIRKIVDAPPTPTLMFSPTKKTILFLQRRSLAPLSDIARPELK  86

Query  452  LAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTL  550
            L G+RID + N++SRMSFYTGI I ++L D  +
Sbjct  87   LGGMRIDPEYNTKSRMSFYTGIHIRKVLSDNNI  119



>gb|EEE67855.1| hypothetical protein OsJ_25660 [Oryza sativa Japonica Group]
Length=916

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            +DD A G  YR PP +I++I+D PP P+   SP+RD+I+FL+R ++PPLS+L +PE+ L+
Sbjct  57   EDDVAGGLGYRHPPKQIQEILDVPPNPSYLISPRRDRIMFLQRTAMPPLSELTKPEIVLS  116

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXP  556
            GIRID   N RSRMSFYTGI IH L++ GTL P
Sbjct  117  GIRIDPGSNMRSRMSFYTGIIIHDLMDSGTLGP  149



>dbj|BAC21362.1| aminoacyl peptidase-like [Oryza sativa Japonica Group]
 dbj|BAD30598.1| aminoacyl peptidase-like [Oryza sativa Japonica Group]
Length=704

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            +DD A G  YR PP +I++I+D PP P+   SP+RD+I+FL+R ++PPLS+L +PE+ L+
Sbjct  57   EDDVAGGLGYRHPPKQIQEILDVPPNPSYLISPRRDRIMFLQRTAMPPLSELTKPEIVLS  116

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXP  556
            GIRID   N RSRMSFYTGI IH L++ GTL P
Sbjct  117  GIRIDPGSNMRSRMSFYTGIIIHDLMDSGTLGP  149



>ref|NP_001060706.1| Os07g0689400 [Oryza sativa Japonica Group]
 dbj|BAF22620.1| Os07g0689400 [Oryza sativa Japonica Group]
Length=712

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            +DD A G  YR PP +I++I+D PP P+   SP+RD+I+FL+R ++PPLS+L +PE+ L+
Sbjct  65   EDDVAGGLGYRHPPKQIQEILDVPPNPSYLISPRRDRIMFLQRTAMPPLSELTKPEIVLS  124

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXP  556
            GIRID   N RSRMSFYTGI IH L++ GTL P
Sbjct  125  GIRIDPGSNMRSRMSFYTGIIIHDLMDSGTLGP  157



>gb|EEC82725.1| hypothetical protein OsI_27416 [Oryza sativa Indica Group]
Length=916

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLA  457
            +DD A G  YR PP +I++I+D PP P+   SP+RD+I+FL+R ++PPLS+L +PE+ L+
Sbjct  57   EDDVAGGLGYRHPPKQIQEILDVPPNPSYLISPRRDRIMFLQRTAMPPLSELTKPEIVLS  116

Query  458  GIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXP  556
            GIRID   N RSRMSFYTGI +H L++ GTL P
Sbjct  117  GIRIDPGSNMRSRMSFYTGIIVHDLMDSGTLGP  149



>gb|EMS61523.1| putative glutamyl endopeptidase, chloroplastic [Triticum urartu]
Length=792

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YR+PP EI++IVD PP P+   SP+RD+I+FLKRR++PPLS+LA+ +  LAGIRID   N
Sbjct  10   YRIPPKEIQEIVDVPPNPSYHLSPRRDRIMFLKRRAMPPLSELAKSDKILAGIRIDSSSN  69

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPE  559
             RSRMSFYTGI IH L++DG+L PE
Sbjct  70   MRSRMSFYTGISIHLLMDDGSLGPE  94



>gb|KJB49818.1| hypothetical protein B456_008G139300 [Gossypium raimondii]
Length=830

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  398  LKRRSLPPLSDLARPEVKLAGIRIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPES  562
            +KRRSLPPL++LARPE KLAG+RIDGKCN+RSRMSFYTGIGIH L+ DG+L PE+
Sbjct  1    MKRRSLPPLAELARPEEKLAGLRIDGKCNTRSRMSFYTGIGIHSLMPDGSLGPET  55



>gb|EMT02117.1| Dipeptidyl peptidase family member 6 [Aegilops tauschii]
Length=822

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP EI++IVD PP  +   SP+RD+I+FLKRR++PPLS+LA+P+  LAGIRID  CN
Sbjct  10   YRLPPKEIQEIVDVPPNASYHLSPRRDRIMFLKRRAMPPLSELAKPDKILAGIRIDSSCN  69

Query  485  SRSRMS  502
             RSRMS
Sbjct  70   MRSRMS  75



>gb|KIY94927.1| hypothetical protein MNEG_13035 [Monoraphidium neglectum]
Length=511

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 1/86 (1%)
 Frame = +2

Query  269  PSYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKR-RSLPPLSDLARPE  445
            PS +   A G+ YR PPPEI  IVDAPP P+LSFSP R  +L L+R  SLPP+S+++RPE
Sbjct  28   PSSNGAAAPGSGYRQPPPEILQIVDAPPQPSLSFSPDRRLLLQLQRPPSLPPISEISRPE  87

Query  446  VKLAGIRIDGKCNSRSRMSFYTGIGI  523
            +KLAGIRID +  SRSRM + T + I
Sbjct  88   LKLAGIRIDAEQFSRSRMGYNTSLAI  113



>ref|XP_005642798.1| alpha/beta-hydrolase [Coccomyxa subellipsoidea C-169]
 gb|EIE18254.1| alpha/beta-hydrolase [Coccomyxa subellipsoidea C-169]
Length=824

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +2

Query  311  LPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRS-LPPLSDLARPEVKLAGIRIDGKCNS  487
            LPP EI D+VD PP P LSFSP R ++L L R   LPP+S++ARPE+KLAG+RID + NS
Sbjct  2    LPPQEIIDLVDVPPEPNLSFSPDRTQVLQLYRPPPLPPISEVARPELKLAGLRIDAETNS  61

Query  488  RSRMSFYTGIGIHQLLED  541
             SRM +Y G+ I Q+ +D
Sbjct  62   GSRMGYYLGLSIVQMTDD  79



>ref|XP_002954276.1| hypothetical protein VOLCADRAFT_106292 [Volvox carteri f. nagariensis]
 gb|EFJ44700.1| hypothetical protein VOLCADRAFT_106292 [Volvox carteri f. nagariensis]
Length=998

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 1/76 (1%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRR-SLPPLSDLARPEVKLAGIRIDG  475
            N Y+LPPPEI  IVDAP  P+LS+SP R   L L R  SLPP+ +++RPE+KLAG+R+D 
Sbjct  79   NGYKLPPPEIATIVDAPAQPSLSYSPDRKTFLQLTRPPSLPPILEMSRPELKLAGLRVDP  138

Query  476  KCNSRSRMSFYTGIGI  523
               +RS+MS+YTGI I
Sbjct  139  DLYARSKMSYYTGISI  154



>gb|KER10044.1| aminoacyl peptidase [Chlorobium sp. GBChlB]
Length=820

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +2

Query  293  LGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRID  472
            L + Y+LPP  I DIVDAPP P LS SP+ D  L L+R SLPP+S+LA PE++LAGIRI+
Sbjct  30   LQSGYKLPPKAIADIVDAPPTPLLSVSPKNDVALVLERSSLPPISELAAPELRLAGIRIN  89

Query  473  GKCNSRSRMSFYTGIGIHQL  532
             +   RSR  ++T + I  +
Sbjct  90   PRTFGRSRAPYFTKLTIKDI  109



>ref|WP_035401763.1| aminoacyl peptidase [Chlorobium sp. GBChlB]
Length=805

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = +2

Query  293  LGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRID  472
            L + Y+LPP  I DIVDAPP P LS SP+ D  L L+R SLPP+S+LA PE++LAGIRI+
Sbjct  15   LQSGYKLPPKAIADIVDAPPTPLLSVSPKNDVALVLERSSLPPISELAAPELRLAGIRIN  74

Query  473  GKCNSRSRMSFYTGIGIHQL  532
             +   RSR  ++T + I  +
Sbjct  75   PRTFGRSRAPYFTKLTIKDI  94



>ref|XP_011401392.1| putative glutamyl endopeptidase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM28377.1| putative glutamyl endopeptidase, chloroplastic [Auxenochlorella 
protothecoides]
Length=841

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRR-SLPPLSDLARPEVKLAGIRIDGKC  481
            Y LPPPE+  +VDAPP P LSFSP R  +L L R  S PP+S+LARPE+KLAG+RID + 
Sbjct  10   YMLPPPEMAAVVDAPPEPTLSFSPDRKMVLQLGRPPSNPPISELARPELKLAGLRIDPET  69

Query  482  NSRSRMSFYTGI  517
             SRSRMS+YT +
Sbjct  70   FSRSRMSYYTDL  81



>ref|XP_002500610.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61868.1| predicted protein [Micromonas sp. RCC299]
Length=865

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRS-LPPLSDLARPEVKLAGIRIDGKC  481
            YR+PPPE+   V+ P  P++S SP RD++L+L R    P +S+LARPE+KLAG+RID   
Sbjct  29   YRMPPPEVAQFVERPQNPSISISPMRDQLLYLMRPPPYPLVSELARPELKLAGMRIDETQ  88

Query  482  NSRSRMSFYTGIGI  523
            NSRSRMS  TGI I
Sbjct  89   NSRSRMSGNTGIAI  102



>ref|WP_007163371.1| hypothetical protein [Erythrobacter sp. NAP1]
 gb|EAQ29341.1| hypothetical protein NAP1_01175 [Erythrobacter sp. NAP1]
Length=804

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = +2

Query  290  ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  469
            A  + Y+ PPPE+ DIV   P P +S SP  D IL ++R +LPP++DLARP  KLAGIR+
Sbjct  24   AAQDGYQTPPPEVTDIVTRAPAPRVSISPDNDLILLMEREALPPVADLARPMEKLAGIRL  83

Query  470  DGKCNSRSRMSFYTGIGIHQL  532
            D   N R     + G+ +  +
Sbjct  84   DASINDRYGTRAFVGLSLQDI  104



>ref|WP_040613448.1| peptidase S9 prolyl oligopeptidase, partial [Oceanicaulis sp. 
HTCC2633]
Length=798

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP +I DIVDAPP P  + SP +  +L L R  LPP+S+LARP  +LAG+R+D + N
Sbjct  28   YRLPPQDIVDIVDAPPSPFTTLSPDKRHLLLLHREGLPPVSELARPMERLAGLRLDAETN  87

Query  485  SR  490
             R
Sbjct  88   GR  89



>ref|WP_011644979.1| peptidase S9 prolyl oligopeptidase [Maricaulis maris]
 gb|ABI67335.1| glutamyl peptidase, Serine peptidase, MEROPS family S09D [Maricaulis 
maris MCS10]
Length=815

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP EI DIVDA P P  S SP RD +L + R +LPP+++LARP  +LAG+R+D   N
Sbjct  29   YRLPPQEIIDIVDAAPSPWTSLSPARDTLLLMHREALPPVAELARPMERLAGLRLDATLN  88

Query  485  SR  490
             R
Sbjct  89   GR  90



>gb|EAP89653.1| hypothetical protein OA2633_10314 [Oceanicaulis sp. HTCC2633]
Length=816

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP +I DIVDAPP P  + SP +  +L L R  LPP+S+LARP  +LAG+R+D + N
Sbjct  28   YRLPPQDIVDIVDAPPSPFTTLSPDKRHLLLLHREGLPPVSELARPMERLAGLRLDAETN  87

Query  485  SR  490
             R
Sbjct  88   GR  89



>ref|WP_029952658.1| MULTISPECIES: aminoacyl peptidase [unclassified Cloacimonetes]
Length=819

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LPP EI D+VDA   P +   P+   +L L+R SLPP+ +L +P++KLAG+RI+ K N
Sbjct  38   YQLPPKEIIDLVDAHLTPLIRIDPKIKWMLLLERPSLPPIEELTKPDLKLAGLRINPKTN  97

Query  485  SRSRMSFYTGIGIHQL  532
             +S   +YT I +H +
Sbjct  98   GKSTTYYYTNIKLHSI  113



>ref|WP_029944702.1| hypothetical protein, partial [Cloacimonetes bacterium JGI 0000014-K11]
Length=679

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LPP EI D+VDA   P +   P+   +L L+R SLPP+ +L +P++KLAG+RI+ K N
Sbjct  38   YQLPPKEIIDLVDAHLTPLIRIDPKIKWMLLLERPSLPPIEELTKPDLKLAGLRINPKTN  97

Query  485  SRSRMSFYTGIGIHQL  532
             +S   +YT I +H +
Sbjct  98   GKSTTYYYTNIKLHSI  113



>ref|WP_022700787.1| peptidase S9 prolyl oligopeptidase [Oceanicaulis alexandrii]
Length=816

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP EI DIVDAP  P  + SP +  +L L R  LPP+S++ARP  +LAG+R+D + N
Sbjct  28   YRLPPQEIVDIVDAPNAPYTTLSPNKRHLLLLHREGLPPISEMARPMERLAGLRLDAETN  87

Query  485  SR  490
             R
Sbjct  88   GR  89



>gb|ADV63172.1| glutamyl peptidase [Isosphaera pallida ATCC 43644]
Length=853

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YR PP  I  I+DAPP PA+S SP R ++L+L+RR LP +++LA PE+ LAG+RI+ + N
Sbjct  48   YRQPPEPIASILDAPPPPAISVSPDRTRLLYLERRGLPTIAELAAPELGLAGVRINPRAN  107

Query  485  SRSRMSFYTGIGIHQLL  535
            + SR+S +    +  L+
Sbjct  108  APSRVSTFIDYAVRPLI  124



>ref|WP_044255181.1| aminoacyl peptidase, partial [Isosphaera pallida]
Length=818

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YR PP  I  I+DAPP PA+S SP R ++L+L+RR LP +++LA PE+ LAG+RI+ + N
Sbjct  34   YRQPPEPIASILDAPPPPAISVSPDRTRLLYLERRGLPTIAELAAPELGLAGVRINPRAN  93

Query  485  SRSRMSFYTGIGIHQLL  535
            + SR+S +    +  L+
Sbjct  94   APSRVSTFIDYAVRPLI  110



>gb|KDD76957.1| hypothetical protein H632_c56p2 [Helicosporidium sp. ATCC 50920]
Length=883

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +2

Query  293  LGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKR-RSLPPLSDLARPEVKLAGIRI  469
            L + Y LPPPEI +IVD  P P L  SP R  +L L +  + PP+S+L+RPE+KLAGIRI
Sbjct  46   LSHPYLLPPPEIAEIVDRVPPPRLVVSPDRRLVLQLSQPHANPPISELSRPELKLAGIRI  105

Query  470  DGKCNSRSRMSFYTGIGI  523
            D +  SRSRMS YT + +
Sbjct  106  DPELYSRSRMSHYTALAV  123



>ref|WP_029496139.1| aminoacyl peptidase [Janthinobacterium lividum]
Length=835

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP  ++ IVDAP  P LS SP+R+    L   SLP +S++A+PE+KLAG+RI+ +  
Sbjct  28   YQAPPAPLQAIVDAPRAPTLSLSPKRNLAAVLATPSLPSMSEVAQPELKLAGLRINPRTY  87

Query  485  SRSRMSFYTGIGI  523
            S SR SF+TG+G+
Sbjct  88   SASRFSFHTGLGL  100



>ref|WP_014678753.1| WD40-like beta propeller repeat protein,prolyl oligopeptidase 
family protein [Solitalea canadensis]
 gb|AFD05525.1| WD40-like beta propeller repeat protein,prolyl oligopeptidase 
family protein [Solitalea canadensis DSM 3403]
Length=800

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            + Y+LPP E+ D++DAP +P +S SPQ++ +L +  +  P ++ +++P +++ G+RI+ +
Sbjct  21   SSYKLPPKEVVDVIDAPTLPGVSISPQQNDMLLISSKPYPSIATVSQPILRIGGVRINPQ  80

Query  479  CNSRSRMSFYTGIGIHQLLEDGTL  550
             NSR R++   G+ I Q L DG +
Sbjct  81   LNSRQRLTEIYGLSI-QNLSDGKI  103



>ref|XP_003057252.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58897.1| predicted protein [Micromonas pusilla CCMP1545]
Length=877

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 7/79 (9%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPP----LSDLARPEVKLAGIR  466
            ++Y++PPP++   V+ P  P LS SP R  +L+  R   PP    +S+LARPE+KLAG+R
Sbjct  25   DRYKMPPPDVAQFVERPQSPGLSLSPDRSSLLYSFR---PPPYPFVSELARPELKLAGLR  81

Query  467  IDGKCNSRSRMSFYTGIGI  523
            ID   NSRSRMS  TGI +
Sbjct  82   IDETQNSRSRMSGQTGIAL  100



>ref|WP_019923325.1| hypothetical protein [Duganella zoogloeoides]
Length=830

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP  ++ IVDAP  PALS SP+RD    ++  +LP ++++A+PE+KLAG+RI+ +  
Sbjct  28   YRLPPEPLQAIVDAPRAPALSLSPRRDTAAVVQTPALPGIAEVAQPELKLAGLRINPRTY  87

Query  485  SRSRMSFYTGIGI  523
            + SR SF TG+ +
Sbjct  88   AGSRFSFGTGLSL  100



>ref|WP_026334910.1| aminoacyl peptidase [Oxalobacteraceae bacterium AB_14]
Length=819

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP  + DIVDAP  PALS SPQR+ +  ++   LP ++++A+PE+KLAG+RI+ +  
Sbjct  28   YRLPPSALLDIVDAPRAPALSLSPQRNLVAVVQTPPLPGIAEVAQPELKLAGLRINPRTC  87

Query  485  SRSRMSFYTGIGI  523
            S SR SF T + +
Sbjct  88   SSSRFSFGTDLAL  100



>ref|WP_034753463.1| aminoacyl peptidase [Janthinobacterium lividum]
 gb|EZP38873.1| Peptidase S9 prolyl oligopeptidase catalytic domain-containing 
protein [Janthinobacterium lividum]
Length=831

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP  ++ IVDAP  P LS SP+R+    L   SLP +S++A+PE+KLAG+RI+ +  
Sbjct  28   YQAPPAPLQAIVDAPRAPTLSLSPKRNLAAVLPTPSLPSISEVAQPELKLAGLRINPRTY  87

Query  485  SRSRMSFYTGIGI  523
            S SR SF+TG+G+
Sbjct  88   SASRFSFHTGLGL  100



>ref|WP_034784341.1| aminoacyl peptidase [Janthinobacterium lividum]
 gb|KHA77690.1| aminoacyl peptidase [Janthinobacterium lividum]
Length=835

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP  ++ IVDAP  P LS SP+R+    L   SLP +S++A+PE+KLAG+RI+ +  
Sbjct  28   YQAPPAPLQAIVDAPRAPTLSLSPKRNLAAVLPTPSLPSISEVAQPELKLAGLRINPRTY  87

Query  485  SRSRMSFYTGIGI  523
            S SR SF+TG+G+
Sbjct  88   SASRFSFHTGLGL  100



>ref|WP_044201691.1| aminoacyl peptidase [Echinicola pacifica]
Length=796

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 41/90 (46%), Positives = 56/90 (62%), Gaps = 3/90 (3%)
 Frame = +2

Query  287  EALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIR  466
            E LG  Y+ PP EI +++DAP  P++SFS   D++L L+R     +  L++PE++LAGIR
Sbjct  12   EHLG--YQTPPEEIIELLDAPVTPSVSFSKSGDRMLILERPGYTSIQQLSQPELRLAGIR  69

Query  467  IDGKCNSRSRMSFYTGIGIHQLLEDGTLXP  556
            I+   N  SR S YTGI I   LE G   P
Sbjct  70   INPMTNGPSRSSGYTGIKIKN-LESGQAEP  98



>ref|WP_035787784.1| aminoacyl peptidase [Janthinobacterium sp. CG3]
Length=818

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP  ++ IVDAP  PALS SP R+    ++  +LP +S++A+PE+KLAG+RI+ +  
Sbjct  28   YQAPPAALQAIVDAPRAPALSLSPLRNLAAMVQTPALPGISEVAQPELKLAGVRINPRTY  87

Query  485  SRSRMSFYTGIGI  523
            S+SR SF +G+G+
Sbjct  88   SQSRFSFGSGLGL  100



>ref|WP_014101391.1| glutamyl peptidase [Candidatus Chloracidobacterium thermophilum]
 gb|AEP13653.1| glutamyl peptidase, Serine peptidase, MEROPS family S09D [Candidatus 
Chloracidobacterium thermophilum B]
Length=820

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YR PP  I D+VDAP  P    SPQR+ +L   R +LPP++++A+PE++L GIR + K N
Sbjct  22   YRTPPKAIADLVDAPLPPVALLSPQRNWLLLADRPTLPPIAEVAQPELRLGGIRFNPKTN  81

Query  485  SRSRMSFYTGIGIHQLLEDGTLXP  556
              S+ S+ TG+ + + L DGT  P
Sbjct  82   GPSQPSYLTGLTLVR-LTDGTKRP  104



>ref|WP_008444659.1| peptidase S9 prolyl oligopeptidase catalytic domain-containing 
protein [Janthinobacterium sp. HH01]
 gb|ELX12312.1| peptidase S9 prolyl oligopeptidase catalytic domain-containing 
protein [Janthinobacterium sp. HH01]
Length=819

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP  + +IVDAP  PALS SPQR+    ++   LP ++++A+PE+KLAG+RI+ +  
Sbjct  28   YRLPPAALMEIVDAPRAPALSLSPQRNLAAVVQTPPLPGIAEVAQPELKLAGLRINPRTC  87

Query  485  SRSRMSFYTGIGI  523
            S SR +F T +G+
Sbjct  88   SSSRFAFGTDLGL  100



>ref|WP_038496716.1| aminoacyl peptidase [Janthinobacterium agaricidamnosum]
Length=829

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LPP  ++ IVDAP  PALS SP+R+    L+  +LP +S++A+PE+KLAG+RI+ +  
Sbjct  28   YQLPPAPLQAIVDAPRAPALSLSPKRNLAAMLQTPALPGMSEVAQPELKLAGLRINPRTY  87

Query  485  SRSRMSFYTGIGI  523
            S SR SF  G+ +
Sbjct  88   SASRFSFGAGLSL  100



>emb|CDG85386.1| prolyl oligopeptidase family protein [Janthinobacterium agaricidamnosum 
NBRC 102515 = DSM 9628]
Length=820

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LPP  ++ IVDAP  PALS SP+R+    L+  +LP +S++A+PE+KLAG+RI+ +  
Sbjct  19   YQLPPAPLQAIVDAPRAPALSLSPKRNLAAMLQTPALPGMSEVAQPELKLAGLRINPRTY  78

Query  485  SRSRMSFYTGIGI  523
            S SR SF  G+ +
Sbjct  79   SASRFSFGAGLSL  91



>gb|KJF45023.1| aminoacyl peptidase [Draconibacterium sp. JN14CK-3]
Length=805

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +2

Query  302  QYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKC  481
            +Y+ PP EI +++DAP VP+ SF  + + I+ L R     +++L+ PE++LAG+RI+   
Sbjct  24   EYQKPPKEILELIDAPAVPSASFDAKNENIVLLHRNQFKSINELSEPELRLAGLRINPVT  83

Query  482  NSRSRMSFYTGIGIHQLLE  538
            N  SR  +YT I + ++ E
Sbjct  84   NIGSRTRYYTNISLMKVGE  102



>ref|XP_007510843.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18376.1| predicted protein [Bathycoccus prasinos]
Length=1001

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = +2

Query  278  DDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFL-KRRSLPPLSDLARPEVKL  454
            +D E    +Y++PP +I   V  P  P++S SP R ++L+  K +  PP+++LAR E+KL
Sbjct  96   NDHEEASTKYKIPPDDISVFVTRPDAPSISLSPSRTQVLYSHKPKDNPPVAELARKELKL  155

Query  455  AGIRIDGKCNSRSRMSFYTGIGI  523
             GIRID K NS SRM     + I
Sbjct  156  GGIRIDTKQNSSSRMGHTVKLSI  178



>ref|WP_043629145.1| aminoacyl peptidase [Chromobacterium piscinae]
 gb|KIA79185.1| aminoacyl peptidase [Chromobacterium piscinae]
Length=810

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +2

Query  290  ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  469
            A  + Y+ PPPE+  +VDAP  P  S SPQ++ +L + R  LP ++D+A+PE+KLAG+R+
Sbjct  22   AAADGYQTPPPELAALVDAPRTPQQSLSPQQNIVLQISRPGLPSIADVAQPELKLAGLRL  81

Query  470  DGKCNSRSRMSFYTGIGI  523
            + K  + S+ +F  G+ +
Sbjct  82   NPKMRAYSQFNFGNGLSL  99



>ref|WP_026069661.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=844

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y LP P ++ +VDAP  P LS SP+RD    L+   LP ++D+A+PE+KLAG+RI+   +
Sbjct  53   YELPSPALQAVVDAPRAPTLSLSPRRDLAALLQTPPLPSINDVAQPELKLAGLRINPATH  112

Query  485  SRSRMSF  505
            S SR SF
Sbjct  113  SASRFSF  119



>ref|WP_043572150.1| aminoacyl peptidase [Chromobacterium subtsugae]
Length=814

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP E+  IVDAP  P+ S +PQRD IL + R  LP ++D+++PE++LAG+R++ + +
Sbjct  27   YQTPPSELAAIVDAPRTPSQSLNPQRDTILQIHRPGLPGIADVSQPELRLAGLRLNPRMH  86

Query  485  SRSRMSFYTGIGIHQLLEDGTLXPES  562
            + SR  F T + +   L DG   P S
Sbjct  87   AGSRFEFGTALTLL-TLADGKSRPVS  111



>ref|WP_007653415.1| peptidase S9 prolyl oligopeptidase active site domain-containing 
protein [Pontibacter sp. BAB1700]
 gb|EJF11239.1| peptidase S9 prolyl oligopeptidase active site domain-containing 
protein [Pontibacter sp. BAB1700]
Length=823

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 50/83 (60%), Gaps = 4/83 (5%)
 Frame = +2

Query  296  GNQ----YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGI  463
            GNQ    Y+ PP  I  I+DAP  P +S + + D +L L+R   P + +LA+PE +LAG+
Sbjct  35   GNQATTGYQRPPEAIASIIDAPSTPGVSINSKGDWMLLLERAGYPSIEELAQPESRLAGL  94

Query  464  RIDGKCNSRSRMSFYTGIGIHQL  532
            RI+   N +SR SF   I + Q+
Sbjct  95   RINPATNGQSRASFINNIKLKQV  117



>ref|WP_019595958.1| glutamyl peptidase [Rhodonellum psychrophilum]
 gb|ERM83448.1| glutamyl peptidase [Rhodonellum psychrophilum GCM71 = DSM 17998]
Length=810

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP  I D+V+AP  P++SFS   D +L L+R   P + +L++PE+++AG+RI+   N
Sbjct  34   YKTPPKAIADLVNAPVTPSVSFSRMGDFMLILERSGNPSIEELSQPELRIAGVRINPATN  93

Query  485  SRSRMSFYTGIGIHQLLE  538
            S SR   Y  I I +L E
Sbjct  94   SPSRGITYESIKIKKLKE  111



>ref|WP_021476771.1| glutamyl peptidase [Pseudogulbenkiania ferrooxidans]
 gb|ERE07228.1| glutamyl peptidase [Pseudogulbenkiania ferrooxidans EGD-HP2]
Length=814

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +2

Query  290  ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  469
            AL   Y+ PPPE+  +VDAP  P  S SP+ D +L   R  LP ++D+A+PE+KLAG+R+
Sbjct  22   ALAEGYQTPPPELAALVDAPRTPLQSLSPRNDTVLQTHRPGLPGIADVAQPELKLAGLRL  81

Query  470  DGKCNSRSRMSFYTGIGI  523
            + K  + SR  F   + +
Sbjct  82   NPKMRAASRFDFGNALSL  99



>ref|WP_020607102.1| hypothetical protein [Spirosoma spitsbergense]
Length=819

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP E+ D++ APP P ++ SP+ D +L L+R +LP + +LA PE+KL G+RI+   N
Sbjct  32   YQTPPAEMLDLLLAPPTPNINLSPKNDYLLLLERAALPTIEELAEPELKLGGLRINPANN  91

Query  485  SRSRMSFYTGIGIHQ  529
             +SR+  Y  + + +
Sbjct  92   GQSRVGSYVKLTLKR  106



>ref|WP_029164535.1| hypothetical protein [Aminicenantes bacterium SCGC AAA252-O03]
Length=802

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LPP E+ DIV+A P P  S SP +D I+ ++  ++P +  +++P +++AG RI  K N
Sbjct  26   YKLPPKEVVDIVNAAPPPRASISPTKDCIILIEYETMPSIVYMSQPLLRIAGTRITPKNN  85

Query  485  SRSRMSFYTGIGIHQL  532
            SR   +FYTG+ I  +
Sbjct  86   SRQVTTFYTGLVIKDI  101



>ref|WP_026897909.1| aminoacyl peptidase [Pedobacter oryzae]
Length=805

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP  I D+VDAP  P +  +     +L L++  LPP+S++A+PE+++AG+RI+   N
Sbjct  26   YQTPPQSIIDLVDAPTTPEIKLNSDGSWMLLLQKPGLPPISEVAQPELRIAGLRINPATN  85

Query  485  SRSRMSFYTGI  517
             +SR +++ GI
Sbjct  86   GQSRSAYFNGI  96



>ref|WP_043929166.1| hypothetical protein, partial [Xanthomonas citri]
Length=108

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +2

Query  290  ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  469
            A G+ Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI
Sbjct  31   ASGSGYQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGLRI  90

Query  470  DGKCNSRSRMSFYTGIGI  523
              K  + SR SF + + +
Sbjct  91   HPKTFAASRFSFASKLWL  108



>ref|WP_020258490.1| hypothetical protein [Candidatus Aminicenans sakinawicola]
Length=802

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LPP E+ DIV+A P P  S SP +D I+ ++  ++P +  +++P +++AG RI  K N
Sbjct  26   YKLPPKEVVDIVNAAPPPRASISPTKDCIILIEYETMPSIVYMSQPLLRIAGTRITPKNN  85

Query  485  SRSRMSFYTGIGIHQL  532
            SR   +FYTG+ I  +
Sbjct  86   SRQVTTFYTGLVIKDI  101



>ref|WP_042837639.1| hypothetical protein, partial [Xanthomonas citri]
Length=125

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +2

Query  290  ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  469
            A G+ Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI
Sbjct  47   ASGSGYQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGLRI  106

Query  470  DGKCNSRSRMSFYTGIGI  523
              K  + SR SF + + +
Sbjct  107  HPKTFAASRFSFASKLWL  124



>ref|WP_040145576.1| hypothetical protein, partial [Xanthomonas citri]
Length=124

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +2

Query  290  ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  469
            A G+ Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI
Sbjct  47   ASGSGYQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGLRI  106

Query  470  DGKCNSRSRMSFYTGIGI  523
              K  + SR SF + + +
Sbjct  107  HPKTFAASRFSFASKLWL  124



>ref|WP_044100488.1| hypothetical protein, partial [Xanthomonas citri]
Length=125

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +2

Query  290  ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  469
            A G+ Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI
Sbjct  47   ASGSGYQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGLRI  106

Query  470  DGKCNSRSRMSFYTGIGI  523
              K  + SR SF + + +
Sbjct  107  HPKTFAASRFSFASKLWL  124



>ref|WP_042830602.1| hypothetical protein, partial [Xanthomonas citri]
Length=140

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = +2

Query  290  ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  469
            A G+ Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI
Sbjct  47   ASGSGYQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGLRI  106

Query  470  DGKCNSRSRMSFYTGIGI  523
              K  + SR SF + + +
Sbjct  107  HPKTFAASRFSFASKLWL  124



>ref|WP_018479746.1| glutamyl peptidase [Pontibacter roseus]
Length=823

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP  I  I+DAP  P +S + + D +L L+R   P + +LA+PE +LAG+RI+   N
Sbjct  42   YQRPPEAIASIIDAPSTPGVSINSKGDWMLLLERAGYPSIEELAQPESRLAGLRINPATN  101

Query  485  SRSRMSFYTGIGIHQL  532
             +SR +F   I + Q+
Sbjct  102  GQSRAAFINNIKLKQV  117



>ref|WP_033011098.1| aminoacyl peptidase, partial [Xanthomonas campestris]
 gb|KFA22987.1| aminoacyl peptidase, partial [Xanthomonas campestris pv. musacearum 
NCPPB 4394]
Length=156

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G  Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  22   GGGYQLPSTALQAVVDAPRAPLLQLSPKRDLAAMLQMPALPDIAEVAQPELKLAGMRIHP  81

Query  476  KCNSRSRMSFYTGIGI  523
            K  + SR SF + + +
Sbjct  82   KTFAASRFSFASKLWL  97



>gb|KGR65661.1| aminoacyl peptidase, partial [Xanthomonas vasicola]
Length=163

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G  Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  28   GGGYQLPSTALQAVVDAPRAPLLQLSPKRDLAAMLQMPALPDIAEVAQPELKLAGMRIHP  87

Query  476  KCNSRSRMSFYTGIGI  523
            K  + SR SF + + +
Sbjct  88   KTFAASRFSFASKLWL  103



>ref|WP_031329863.1| aminoacyl peptidase, partial [Xanthomonas axonopodis]
Length=200

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G+ YRLP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  33   GSNYRLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQMPALPDIAEVAQPELKLAGLRIHP  92

Query  476  KCNSRSRMSFYTGIGI  523
            K  + SR +F + + +
Sbjct  93   KTFAASRFAFASKLWL  108



>ref|WP_029945099.1| hypothetical protein, partial [Aminicenantes bacterium SCGC AAA252-P13]
Length=232

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LPP E+ DIV+A P P  S SP +D I+ ++  ++P +  +++P +++AG RI  K N
Sbjct  26   YKLPPKEVVDIVNAAPPPRASISPTKDCIILIEYETMPSIVYMSQPLLRIAGTRITPKNN  85

Query  485  SRSRMSFYTGIGIHQL  532
            SR   +FYT + I  +
Sbjct  86   SRQVTTFYTRLVIKDI  101



>ref|WP_036148309.1| aminoacyl peptidase, partial [Lysobacter antibioticus]
Length=796

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LPP  ++ IVDAP  P +  SP+RD++  ++  SLP +  +A+PE+KLAG+RI  +  
Sbjct  20   YQLPPKALQAIVDAPRPPQMFTSPKRDRVALVQTPSLPGIEVVAQPELKLAGLRIHPRTR  79

Query  485  SRSRMSFYTGIGI  523
            ++SR +F TG+ +
Sbjct  80   AQSRFAFGTGLSL  92



>ref|WP_039449234.1| aminoacyl peptidase, partial [Xanthomonas vasicola]
Length=167

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G  Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  32   GGGYQLPSTALQAVVDAPRAPLLQLSPKRDLAAMLQMPALPDIAEVAQPELKLAGMRIHP  91

Query  476  KCNSRSRMSFYTGIGI  523
            K  + SR SF + + +
Sbjct  92   KTFAASRFSFASKLWL  107



>ref|WP_009838053.1| glutamyl endopeptidase [Pseudoalteromonas tunicata]
 gb|EAR28791.1| hypothetical protein PTD2_07104 [Pseudoalteromonas tunicata D2]
Length=803

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ P   + D+VDAP  P  S SP +  +  L R  L  + +LA+PE KLAG+RI+    
Sbjct  22   YQTPNKMMADLVDAPQRPGFSISPNKQWVAVLNRPGLASIEELAQPEAKLAGLRINPNIF  81

Query  485  SRSRMSFYTGIGIHQLLEDGTL  550
            S SR + Y GI +  L+ D T+
Sbjct  82   STSRATGYNGIELRSLINDTTI  103



>ref|WP_026008314.1| hypothetical protein, partial [Xanthomonas axonopodis]
Length=206

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G+ YRLP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  33   GSNYRLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQMPALPDIAEVAQPELKLAGLRIHP  92

Query  476  KCNSRSRMSFYTGIGI  523
            K  + SR +F + + +
Sbjct  93   KTFAASRFAFASKLWL  108



>gb|ABZ10203.1| hypothetical protein ALOHA_HF4000APKG10H12ctg3g18 [uncultured 
marine microorganism HF4000_APKG10H12]
Length=812

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y  PPPEI DI+DAPP+P +  SP+ D +  L R ++P +++LA+P ++LAG R++ + N
Sbjct  35   YLTPPPEIVDILDAPPIPQVVVSPRGDTVALLSRPAMPSIAELAQPMLRLAGYRLNPRTN  94

Query  485  SRSRMSFYTGI  517
               R +  T I
Sbjct  95   GPQRPAGITRI  105



>ref|WP_009197199.1| Poly(3-hydroxybutyrate) depolymerase [Cesiribacter andamanensis]
 gb|EMR01049.1| Poly(3-hydroxybutyrate) depolymerase [Cesiribacter andamanensis 
AMV16]
Length=826

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP  I  +V+AP  PA+    + + +L L++   P + ++A PE++L G+RI+ + N
Sbjct  36   YQRPPEPIAQMVEAPNTPAVLIDQRGEWLLLLEQPGFPSIEEVAAPELRLGGLRINPRNN  95

Query  485  SRSRMSFYTGIGIHQLLEDGTLXP  556
              SR SFY+GI + ++++DG   P
Sbjct  96   GGSRNSFYSGISLRKMVDDGKAYP  119



>gb|KFA32366.1| aminoacyl peptidase, partial [Xanthomonas campestris pv. musacearum 
NCPPB 4384]
Length=181

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G  Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  28   GGGYQLPSTALQAVVDAPRAPLLQLSPKRDLAAMLQMPALPDIAEVAQPELKLAGMRIHP  87

Query  476  KCNSRSRMSFYTGIGI  523
            K  + SR SF + + +
Sbjct  88   KTFAASRFSFASKLWL  103



>ref|WP_015265145.1| prolyl oligopeptidase family protein [Echinicola vietnamensis]
 gb|AGA77581.1| prolyl oligopeptidase family protein [Echinicola vietnamensis 
DSM 17526]
Length=810

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP  I+++V+AP  P++ FS + D +L L+R     L ++++PE+++ GIRI+ K N
Sbjct  32   YKAPPQAIQELVNAPVTPSVYFSKKGDIMLILERPGYKSLKEVSQPELRIGGIRINPKTN  91

Query  485  SRSRMSFYTGIGIHQL  532
              SR S Y+GI + ++
Sbjct  92   GPSRSSSYSGIKVKEV  107



>ref|WP_042821301.1| aminoacyl peptidase [Xanthomonas axonopodis]
 gb|KGE53248.1| aminoacyl peptidase [Xanthomonas axonopodis pv. vasculorum]
Length=828

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +2

Query  290  ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  469
            A G+ Y+LP P ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI
Sbjct  31   AAGSGYQLPSPALQAVVDAPRAPLLQLSPKRDLAAMLQMPALPDIAEVAQPELKLAGLRI  90

Query  470  DGKCNSRSRMSF  505
              K  + SR SF
Sbjct  91   HPKTFAASRFSF  102



>ref|WP_028788724.1| peptidase S9 [Terrimonas ferruginea]
Length=801

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 31/76 (41%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP  I D+V APP P++S S + D +L L+R S P + +LA+PE+K+AG+RI+    
Sbjct  24   YQTPPKLISDLVLAPPTPSISLSKKGDWLLLLQRSSYPSVEELAQPELKIAGLRINPANF  83

Query  485  SRSRMSFYTGIGIHQL  532
            + SR +F   + + Q+
Sbjct  84   APSRQTFINSLVLRQV  99



>ref|WP_042826867.1| aminoacyl peptidase, partial [Xanthomonas axonopodis]
 gb|KGT54648.1| aminoacyl peptidase, partial [Xanthomonas axonopodis pv. phaseoli]
Length=191

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G  Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  49   GGGYQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGLRIHP  108

Query  476  KCNSRSRMSFYTGIGI  523
            K  + SR SF + + +
Sbjct  109  KTFAASRFSFASKLWL  124



>ref|WP_038894267.1| aminoacyl peptidase, partial [Xanthomonas vasicola]
 gb|KEZ98532.1| aminoacyl peptidase, partial [Xanthomonas vasicola pv. vasculorum 
NCPPB 895]
Length=195

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G  Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  22   GGGYQLPSTALQAVVDAPRAPLLQLSPKRDLAAMLQMPALPDIAEVAQPELKLAGMRIHP  81

Query  476  KCNSRSRMSFYTGIGI  523
            K  + SR SF + + +
Sbjct  82   KTFAASRFSFASKLWL  97



>ref|WP_014771634.1| prolyl oligopeptidase family protein [Belliella baltica]
 gb|AFL83627.1| prolyl oligopeptidase family protein [Belliella baltica DSM 15883]
Length=809

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP EI D+V AP  P++SFS   D +L L+R   P + DLA+PE+++AG+RI+   N
Sbjct  33   YQTPPKEIADLVKAPSTPSVSFSRTGDFMLLLERSGNPSIEDLAQPELRIAGMRINPATN  92

Query  485  SRSR  496
              SR
Sbjct  93   GPSR  96



>ref|WP_024891486.1| aminoacyl peptidase [Luteimonas huabeiensis]
Length=822

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +2

Query  284  DEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGI  463
            D A    YRLPPP ++ +VDAP  P LS SP+RD   +L+  +LP +  +A+PE++L G+
Sbjct  21   DVAAEAGYRLPPPALQALVDAPRPPRLSLSPRRDLAAYLRTPALPGIEAVAQPELRLGGL  80

Query  464  RIDGKCNSRSRMSF  505
            RI  +  + SR SF
Sbjct  81   RIHPRTYAASRFSF  94



>ref|WP_035322400.1| aminoacyl peptidase [Dyella japonica]
Length=825

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/71 (44%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP  ++ +VDAP  P LS SP RD +  ++  +LP +  +A+PE+KLAG+RI+ +  
Sbjct  40   YRLPPAPLQALVDAPRPPQLSISPHRDLLALIQSPALPGIDVVAQPELKLAGLRINPRTY  99

Query  485  SRSRMSFYTGI  517
            ++S+ SF T +
Sbjct  100  AQSKFSFGTDL  110



>ref|WP_039718325.1| peptidase S9 prolyl oligopeptidase [Scytonema millei]
 gb|KIF12997.1| peptidase S9 prolyl oligopeptidase [Scytonema millei VB511283]
Length=817

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 39/84 (46%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            YRLPP ++ DIVDAP  P  S SP RD +L + R +LPP+S+LARP  +LAG+R+D   N
Sbjct  30   YRLPPQDVVDIVDAPLPPFPSLSPNRDTLLLMHREALPPVSELARPMERLAGLRLDAATN  89

Query  485  SRSRMSFYTGIGIHQL--LEDGTL  550
             R       G+ +  L  LE+ T+
Sbjct  90   GRHGPRSVVGLSVMDLDTLEERTI  113



>ref|WP_043614381.1| aminoacyl peptidase [Chromobacterium violaceum]
Length=814

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PPPE+  +VDAP  P  S +PQ D +L   R  LP ++D+A+PE+KLAG+R++ +  
Sbjct  27   YQTPPPELAALVDAPRTPLQSLNPQGDAVLQTHRPGLPAIADVAQPELKLAGLRLNPRMR  86

Query  485  SRSRMSFYTGI  517
            + SR  F + +
Sbjct  87   AASRFDFGSAL  97



>ref|WP_011135850.1| hypothetical protein [Chromobacterium violaceum]
 gb|AAQ59975.1| conserved hypothetical protein [Chromobacterium violaceum ATCC 
12472]
Length=814

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PPPE+  +VDAP  P  S +PQ D +L   R  LP ++D+A+PE+KLAG+R++ +  
Sbjct  27   YQTPPPELAALVDAPRTPLQSLNPQGDAVLQTHRPGLPAIADVAQPELKLAGLRLNPRMR  86

Query  485  SRSRMSFYTGI  517
            + SR  F + +
Sbjct  87   AASRFDFGSAL  97



>ref|WP_020264176.1| MULTISPECIES: hypothetical protein [unclassified Aminicenantes]
Length=802

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LPP E+ DIV+A P P  S SP +D I+ ++  ++P +  +++P +++AG RI  K N
Sbjct  26   YKLPPKEVVDIVNAAPPPRASISPTKDCIILIEYETMPSIVYMSQPLLRIAGTRITPKNN  85

Query  485  SRSRMSFYTGIGIHQL  532
            SR   +FYT + I  +
Sbjct  86   SRQVTTFYTRLVIKDI  101



>ref|WP_043085508.1| aminoacyl peptidase, partial [Xanthomonas sp. SHU308]
Length=177

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = +2

Query  284  DEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGI  463
            D A  + Y+LP   ++ IVDAP  P LS SP+RD    L+  +LP ++ +A+PE+KLAG+
Sbjct  4    DPAADSGYQLPSAPLQAIVDAPRPPQLSLSPRRDLAAMLQLPALPGIAQVAQPELKLAGL  63

Query  464  RIDGKCNSRSRMSFYTGIGIHQLLEDGTLXPES  562
            RI  +  S+SR +F   + + ++ +   L  E 
Sbjct  64   RIHPRTRSQSRFAFGDKLWLLRIADGSELQIEG  96



>ref|WP_008628244.1| hypothetical protein [Mariniradius saccharolyticus]
 gb|EMS32898.1| hypothetical protein C943_00905 [Mariniradius saccharolyticus 
AK6]
Length=807

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 51/79 (65%), Gaps = 2/79 (3%)
 Frame = +2

Query  287  EALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIR  466
            EAL  QY++PP EI D+V+AP  P +SFS   D ++ L+R   P + DLA+PE+++AG+R
Sbjct  26   EAL--QYQVPPKEIADLVNAPLTPLVSFSRSGDFMMLLERPGNPSIEDLAQPELRIAGLR  83

Query  467  IDGKCNSRSRMSFYTGIGI  523
            I+   +  SR   +  + I
Sbjct  84   INPATSGPSRSGSFENVVI  102



>ref|WP_038690478.1| aminoacyl peptidase [Stenotrophomonas rhizophila]
 gb|AHY60278.1| aminoacyl peptidase [Stenotrophomonas rhizophila]
Length=841

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y LP   ++ +VDAP  P LS SP+RD    L+  SLP ++++A+PE+KLAG+RI+   +
Sbjct  50   YALPSAALQAVVDAPRAPTLSLSPRRDIAAMLQTPSLPSIAEVAQPELKLAGLRINPATH  109

Query  485  SRSRMSF  505
            + SR SF
Sbjct  110  AASRFSF  116



>gb|EYR68524.1| glutamyl peptidase [Lysobacter capsici AZ78]
Length=856

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LPP  ++ IVDAP  P +  SP+RD++  ++  SLP ++ +A+PE+KLAG+RI  +  
Sbjct  57   YQLPPKPLQAIVDAPRPPQMFLSPRRDRVALVQTPSLPGIAVVAQPELKLAGLRIHPRVR  116

Query  485  SRSRMSFYTGIGIHQLLEDGT  547
            ++SR SF + +    LL+ GT
Sbjct  117  AQSRFSFGSQLS---LLDTGT  134



>ref|WP_017165787.1| hypothetical protein, partial [Xanthomonas axonopodis]
Length=327

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G+ YRLP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  33   GSNYRLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQMPALPDIAEVAQPELKLAGLRIHP  92

Query  476  KCNSRSRMSF  505
            K  + SR +F
Sbjct  93   KTFAASRFAF  102



>gb|KGK58640.1| aminoacyl peptidase [Xanthomonas sp. Nyagatare]
Length=828

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  290  ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  469
            A G+ Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI
Sbjct  30   AAGSAYQLPSKALQAVVDAPRAPLLQLSPKRDLAAMLQLPALPDIAEVAQPELKLAGLRI  89

Query  470  DGKCNSRSRMSF  505
              K  + SR SF
Sbjct  90   HPKTFAASRFSF  101



>ref|WP_036107173.1| aminoacyl peptidase [Lysobacter capsici]
Length=820

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LPP  ++ IVDAP  P +  SP+RD++  ++  SLP ++ +A+PE+KLAG+RI  +  
Sbjct  21   YQLPPKPLQAIVDAPRPPQMFLSPRRDRVALVQTPSLPGIAVVAQPELKLAGLRIHPRVR  80

Query  485  SRSRMSFYTGIGIHQLLEDGT  547
            ++SR SF + +    LL+ GT
Sbjct  81   AQSRFSFGSQLS---LLDTGT  98



>ref|WP_028374744.1| aminoacyl peptidase [Leeuwenhoekiella sp. Hel_I_48]
Length=816

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP EI D+VD P  PA+  +   D +L L R S   +++L+  E++L G+RI+ K N
Sbjct  25   YQKPPKEILDLVDVPRAPAVVMNTAGDTMLLLYRDSFKTIAELSEEELRLGGLRINPKTN  84

Query  485  SRSRMSFYTGIGIHQLLE  538
              SR +FY  + I  + E
Sbjct  85   IGSRTTFYNDVKIKGVQE  102



>ref|WP_033370130.1| aminoacyl peptidase [Hymenobacter norwichensis]
Length=817

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/76 (36%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y++PP  I  + + PP P +S SP    +L L  + +P +++L++PE++LAG+RI+ + N
Sbjct  24   YQMPPKAIATLAETPPTPRVSISPNGAWMLMLNVQDMPTIAELSQPELRLAGLRINPRTN  83

Query  485  SRSRMSFYTGIGIHQL  532
              SR+S+ T + + +L
Sbjct  84   GPSRVSYATALRLKRL  99



>ref|WP_026007267.1| aminoacyl peptidase [Xanthomonas axonopodis]
Length=823

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G+ Y+LP   ++ +VDAP  P L  SP+RD+   L+  +LP ++++A+PE+KLAG+RI  
Sbjct  28   GSGYQLPSKALQAVVDAPRAPLLQLSPKRDQAAMLQLPALPDIAEVAQPELKLAGLRIHP  87

Query  476  KCNSRSRMSF  505
            K  + SR SF
Sbjct  88   KTFAASRFSF  97



>gb|EWC51200.1| hypothetical protein XAR_2184 [Xanthomonas axonopodis pv. glycines 
str. 8ra]
Length=839

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G+ Y+LP   ++ +VDAP  P L  SP+RD+   L+  +LP ++++A+PE+KLAG+RI  
Sbjct  44   GSGYQLPSKALQAVVDAPRAPLLQLSPKRDQAAMLQLPALPDIAEVAQPELKLAGLRIHP  103

Query  476  KCNSRSRMSF  505
            K  + SR SF
Sbjct  104  KTFAASRFSF  113



>gb|KIS37473.1| glutamyl endopeptidase, chloroplastic [Stenotrophomonas maltophilia 
WJ66]
Length=836

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  41   NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  100

Query  479  CNSRSRMSF  505
              S SR SF
Sbjct  101  TFSDSRFSF  109



>ref|WP_043035372.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=838

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43   NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  479  CNSRSRMSF  505
              S SR SF
Sbjct  103  TFSDSRFSF  111



>ref|WP_033834450.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=838

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43   NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  479  CNSRSRMSF  505
              S SR SF
Sbjct  103  TFSDSRFSF  111



>ref|WP_012479169.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia]
 emb|CAQ44353.1| conserved hypothetical protein [Stenotrophomonas maltophilia 
K279a]
Length=838

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43   NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  479  CNSRSRMSF  505
              S SR SF
Sbjct  103  TFSDSRFSF  111



>ref|WP_039426111.1| aminoacyl peptidase [Xanthomonas vesicatoria]
 gb|KHM91039.1| aminoacyl peptidase [Xanthomonas vesicatoria]
 gb|KHM97263.1| aminoacyl peptidase [Xanthomonas vesicatoria]
Length=840

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LP P ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  K  
Sbjct  47   YQLPSPALQAVVDAPRAPLLQLSPKRDLAAMLQLPALPDIAEVAQPELKLAGVRIHPKTY  106

Query  485  SRSRMSF  505
            + SR SF
Sbjct  107  AASRFSF  113



>ref|WP_043397996.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=838

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43   NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  479  CNSRSRMSF  505
              S SR SF
Sbjct  103  TFSDSRFSF  111



>ref|WP_042827901.1| aminoacyl peptidase [Xanthomonas vesicatoria]
Length=840

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LP P ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  K  
Sbjct  47   YQLPSPALQAVVDAPRAPLLQLSPKRDLAAMLQLPALPDIAEVAQPELKLAGVRIHPKTY  106

Query  485  SRSRMSF  505
            + SR SF
Sbjct  107  AASRFSF  113



>gb|EGD09851.1| glutamyl peptidase [Xanthomonas vesicatoria ATCC 35937]
Length=818

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LP P ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  K  
Sbjct  25   YQLPSPALQAVVDAPRAPLLQLSPKRDLAAMLQLPALPDIAEVAQPELKLAGVRIHPKTY  84

Query  485  SRSRMSF  505
            + SR SF
Sbjct  85   AASRFSF  91



>ref|WP_032952310.1| aminoacyl peptidase [[Pseudomonas] geniculata]
Length=838

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43   NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  479  CNSRSRMSF  505
              S SR SF
Sbjct  103  TFSDSRFSF  111



>ref|WP_032129696.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
 gb|KGM22636.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=838

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43   NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  479  CNSRSRMSF  505
              S SR SF
Sbjct  103  TFSDSRFSF  111



>ref|WP_021203441.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia]
 gb|EQM80446.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia MF89]
Length=838

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43   NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  479  CNSRSRMSF  505
              S SR SF
Sbjct  103  TFSDSRFSF  111



>ref|WP_012925251.1| peptidase S9 prolyl oligopeptidase active site domain-containing 
protein [Spirosoma linguale]
 gb|ADB36699.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Spirosoma linguale DSM 74]
Length=829

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP  + D+V AP  P +S S + D +L L++ + P + +LA+PE+KLAG+R++   N
Sbjct  33   YQTPPKALADLVTAPLTPTVSMSTKGDMMLILEQAAAPGIDELAQPELKLAGLRLNPANN  92

Query  485  SRSRMSFYTGIGIHQLLE  538
              SR  + TG+ + +L +
Sbjct  93   GPSRARYITGLKLKKLTD  110



>ref|WP_040016621.1| aminoacyl peptidase, partial [Xanthomonas axonopodis]
 gb|KHF50397.1| aminoacyl peptidase, partial [Xanthomonas axonopodis pv. phaseoli]
Length=295

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G+ Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  49   GSGYQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGLRIHP  108

Query  476  KCNSRSRMSF  505
            K  + SR SF
Sbjct  109  KTFAASRFSF  118



>gb|EIM77055.1| peptidase S9 prolyl oligopeptidase active site domain-containing 
protein [Nitritalea halalkaliphila LW7]
Length=681

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +2

Query  272  SYDDDEALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVK  451
            S+  D+A    Y++PP  I D+VDAP  P++SFS   + +L L+R   P + DLA+PE++
Sbjct  25   SFAQDKA---TYQVPPKAIADLVDAPNTPSISFSRDGEMMLVLERAGNPSIEDLAQPELR  81

Query  452  LAGIRIDGKCNSRSR  496
            +AGIRI+      SR
Sbjct  82   IAGIRINPATTGPSR  96



>ref|WP_014036004.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia]
 gb|AEM49976.1| hypothetical protein BurJV3_0642 [Stenotrophomonas maltophilia 
JV3]
Length=838

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43   NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  479  CNSRSRMSF  505
              S SR SF
Sbjct  103  TFSDSRFSF  111



>ref|WP_039404178.1| aminoacyl peptidase [Xanthomonas campestris]
 gb|KHL55730.1| aminoacyl peptidase [Xanthomonas campestris pv. cannabis]
 gb|KHL59592.1| aminoacyl peptidase [Xanthomonas campestris pv. cannabis]
Length=828

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  290  ALGNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRI  469
            A G+ Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI
Sbjct  30   AAGSAYQLPSKALQAVVDAPRPPLLQLSPKRDLAAMLQLPALPDIAEVAQPELKLAGLRI  89

Query  470  DGKCNSRSRMSFYTGIGIHQLLEDG  544
              K  + SR SF + + +  + + G
Sbjct  90   HPKTFAASRFSFASKLWLLSVADGG  114



>ref|WP_027069324.1| aminoacyl peptidase [Lysobacter defluvii]
Length=814

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G+ Y+LP P ++ +VDAP  P  S SP+RD + F++  SLP +  +A+ E++LAG+RI  
Sbjct  29   GSGYQLPVPALQALVDAPRPPQASLSPRRDLLAFIETPSLPGIDVVAQEELRLAGMRIHP  88

Query  476  KCNSRSRMSFYTGIGI  523
               SRS  SF TG+ +
Sbjct  89   HTWSRSAFSFGTGLSL  104



>ref|WP_019338085.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia]
Length=838

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43   NGYELPSAALQAVVDAPRAPSLYLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  479  CNSRSRMSF  505
              S SR SF
Sbjct  103  TFSDSRFSF  111



>gb|KGT53107.1| aminoacyl peptidase [Xanthomonas axonopodis pv. phaseoli]
Length=829

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G+ YRLP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  33   GSNYRLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQMPALPDIAEVAQPELKLAGLRIHP  92

Query  476  KCNSRSRMSF  505
            K  + SR +F
Sbjct  93   KTFAASRFAF  102



>gb|EMI51368.1| hypothetical protein C405_01692 [Stenotrophomonas maltophilia 
AU12-09]
Length=836

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  41   NGYELPSAALQAVVDAPRAPSLFLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  100

Query  479  CNSRSRMSF  505
              S SR SF
Sbjct  101  TFSDSRFSF  109



>ref|WP_039569474.1| aminoacyl peptidase [Xanthomonas axonopodis]
 gb|KHD65156.1| aminoacyl peptidase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHD66633.1| aminoacyl peptidase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHD70513.1| aminoacyl peptidase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS23741.1| aminoacyl peptidase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS29710.1| aminoacyl peptidase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS38820.1| aminoacyl peptidase [Xanthomonas axonopodis pv. phaseoli]
 gb|KHS39699.1| aminoacyl peptidase [Xanthomonas axonopodis pv. phaseoli]
 gb|KIJ01450.1| aminoacyl peptidase [Xanthomonas axonopodis pv. phaseoli]
Length=829

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G+ YRLP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  33   GSNYRLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQMPALPDIAEVAQPELKLAGLRIHP  92

Query  476  KCNSRSRMSF  505
            K  + SR +F
Sbjct  93   KTFAASRFAF  102



>ref|WP_032953936.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=838

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            N Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43   NGYELPSAALQAVVDAPRAPSLFLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  479  CNSRSRMSF  505
              S SR SF
Sbjct  103  TFSDSRFSF  111



>ref|WP_017172335.1| glutamyl peptidase [Xanthomonas axonopodis]
Length=828

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G+ YRLP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  33   GSNYRLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQMPALPDIAEVAQPELKLAGLRIHP  92

Query  476  KCNSRSRMSF  505
            K  + SR +F
Sbjct  93   KTFAASRFAF  102



>ref|WP_017167519.1| glutamyl peptidase [Xanthomonas axonopodis]
Length=829

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G+ YRLP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  33   GSNYRLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQMPALPDIAEVAQPELKLAGLRIHP  92

Query  476  KCNSRSRMSF  505
            K  + SR +F
Sbjct  93   KTFAASRFAF  102



>ref|WP_040345786.1| aminoacyl peptidase, partial [Brevundimonas diminuta]
Length=352

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y  PP  I  I+DA P P +S SP R  +L   R +LP +++LA P ++LAG RI+ K N
Sbjct  37   YHQPPSPIAQILDAKPNPGVSVSPDRKTLLLTDRSNLPAIAELAEPMLRLAGYRINPKNN  96

Query  485  --SRSRMSFYTGIGIHQLLEDGTLXP  556
              + SR+S+ TG+   Q ++ G   P
Sbjct  97   GPANSRVSWLTGLSF-QAVDGGPARP  121



>ref|WP_017169515.1| glutamyl peptidase [Xanthomonas axonopodis]
Length=829

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G+ YRLP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  33   GSNYRLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQMPALPDIAEVAQPELKLAGLRIHP  92

Query  476  KCNSRSRMSF  505
            K  + SR +F
Sbjct  93   KTFAASRFAF  102



>ref|WP_017158615.1| glutamyl peptidase [Xanthomonas axonopodis]
Length=829

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G+ YRLP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  33   GSNYRLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQMPALPDIAEVAQPELKLAGLRIHP  92

Query  476  KCNSRSRMSF  505
            K  + SR +F
Sbjct  93   KTFAASRFAF  102



>ref|WP_017160286.1| glutamyl peptidase [Xanthomonas axonopodis]
Length=829

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +2

Query  296  GNQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDG  475
            G+ YRLP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  
Sbjct  33   GSNYRLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQMPALPDIAEVAQPELKLAGLRIHP  92

Query  476  KCNSRSRMSF  505
            K  + SR +F
Sbjct  93   KTFAASRFAF  102



>ref|WP_033830372.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
 gb|EVT71224.1| dipeptidyl aminopeptidase [Stenotrophomonas maltophilia 5BA-I-2]
Length=838

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ K  
Sbjct  45   YELPSAALQAVVDAPRAPSLFLSPRRDVAALMQMPSLPSIQVVAQPELKLAGLRINPKTF  104

Query  485  SRSRMSF  505
            S SR SF
Sbjct  105  SDSRFSF  111



>emb|CCH00873.1| peptidase S9 prolyl oligopeptidase active site domain protein 
[Fibrella aestuarina BUZ 2]
Length=832

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP  + D+V  P  P++S S +   +L L++ S P +++LA+PE+KLAG+R++   N
Sbjct  39   YQTPPKALADLVTVPLTPSVSVSDKGSMMLILEQASAPGIAELAQPELKLAGLRLNPANN  98

Query  485  SRSRMSFYTGIGIHQL  532
              SRM + TG+ + +L
Sbjct  99   GPSRMRYVTGLKLKKL  114



>ref|WP_041258970.1| aminoacyl peptidase [Fibrella aestuarina]
Length=830

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+ PP  + D+V  P  P++S S +   +L L++ S P +++LA+PE+KLAG+R++   N
Sbjct  37   YQTPPKALADLVTVPLTPSVSVSDKGSMMLILEQASAPGIAELAQPELKLAGLRLNPANN  96

Query  485  SRSRMSFYTGIGIHQL  532
              SRM + TG+ + +L
Sbjct  97   GPSRMRYVTGLKLKKL  112



>ref|WP_025876539.1| MULTISPECIES: aminoacyl peptidase [Stenotrophomonas]
Length=838

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ K  
Sbjct  45   YELPSAALQAVVDAPRAPSLFLSPRRDVAALMQMPSLPSIQVVAQPELKLAGLRINPKTF  104

Query  485  SRSRMSF  505
            S SR SF
Sbjct  105  SDSRFSF  111



>gb|EZP47495.1| Peptidase S9 prolyl oligopeptidase active site domain protein 
precursor [Stenotrophomonas sp. RIT309]
Length=839

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y LP   ++ +VDAP  P+L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ K  
Sbjct  46   YELPSAALQAVVDAPRAPSLFLSPRRDVAALMQMPSLPSIQVVAQPELKLAGLRINPKTF  105

Query  485  SRSRMSF  505
            S SR SF
Sbjct  106  SDSRFSF  112



>ref|WP_011270002.1| hypothetical protein [Xanthomonas campestris]
 gb|AAY50524.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris 
str. 8004]
Length=835

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +2

Query  305  YRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGKCN  484
            Y+LP   ++ +VDAP  P L  SP+RD    L+  +LP ++++A+PE+KLAG+RI  K +
Sbjct  43   YQLPSKALQAVVDAPRAPLLQLSPRRDLAAMLQLPALPDIAEVAQPELKLAGVRIHPKTH  102

Query  485  SRSRMSF  505
            + SR SF
Sbjct  103  AASRFSF  109



>gb|AIL06870.1| X-Pro dipeptidyl-peptidase family protein [Stenotrophomonas maltophilia]
Length=836

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            N Y LP   ++ +VDAP  P L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  41   NGYELPSAALQAVVDAPRAPTLFLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  100

Query  479  CNSRSRMSF  505
              S SR SF
Sbjct  101  TFSDSRFSF  109



>ref|WP_024957292.1| aminoacyl peptidase [Stenotrophomonas maltophilia]
Length=838

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +2

Query  299  NQYRLPPPEIRDIVDAPPVPALSFSPQRDKILFLKRRSLPPLSDLARPEVKLAGIRIDGK  478
            N Y LP   ++ +VDAP  P L  SP+RD    ++  SLP +  +A+PE+KLAG+RI+ +
Sbjct  43   NGYELPSAALQAVVDAPRAPTLFLSPRRDVAAMMQMPSLPSIQVVAQPELKLAGLRINPR  102

Query  479  CNSRSRMSF  505
              S SR SF
Sbjct  103  TFSDSRFSF  111



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960