BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF046H01

Length=602
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP08875.1|  unnamed protein product                                200   6e-58   Coffea canephora [robusta coffee]
dbj|BAO02525.1|  predicted Shaggy-like kinase ortholog                  196   8e-57   Nicotiana alata [flowering tobacco]
ref|XP_006339456.1|  PREDICTED: shaggy-related protein kinase the...    196   2e-56   Solanum tuberosum [potatoes]
ref|XP_009602858.1|  PREDICTED: shaggy-related protein kinase eps...    196   3e-56   Nicotiana tomentosiformis
ref|XP_004229833.1|  PREDICTED: shaggy-related protein kinase eps...    196   3e-56   Solanum lycopersicum
gb|AAT81407.1|  shaggy-related protein kinase 6                         195   5e-56   Solanum peruvianum [Peruvian tomato]
ref|XP_009790920.1|  PREDICTED: shaggy-related protein kinase eps...    195   7e-56   Nicotiana sylvestris
emb|CAA11860.1|  shaggy-like kinase 91                                  195   8e-56   Nicotiana tabacum [American tobacco]
ref|XP_009773710.1|  PREDICTED: shaggy-related protein kinase eps...    193   3e-55   Nicotiana sylvestris
emb|CAA05329.1|  shaggy-like kinase 59                                  193   3e-55   Nicotiana tabacum [American tobacco]
emb|CAA05328.1|  shaggy-like kinase 111                                 192   8e-55   Nicotiana tabacum [American tobacco]
ref|XP_009610982.1|  PREDICTED: shaggy-related protein kinase eps...    192   8e-55   Nicotiana tomentosiformis
emb|CAA11861.1|  shaggy kinase 6                                        187   4e-53   Petunia x hybrida [garden petunia]
ref|XP_011093165.1|  PREDICTED: shaggy-related protein kinase alpha     184   8e-52   Sesamum indicum [beniseed]
ref|XP_002272112.1|  PREDICTED: shaggy-related protein kinase theta     184   1e-51   Vitis vinifera
ref|XP_006375323.1|  hypothetical protein POPTR_0014s07120g             180   4e-51   
ref|XP_002320754.2|  hypothetical protein POPTR_0014s07120g             181   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_011035087.1|  PREDICTED: shaggy-related protein kinase theta     179   5e-50   Populus euphratica
ref|XP_006345509.1|  PREDICTED: shaggy-related protein kinase the...    174   6e-48   Solanum tuberosum [potatoes]
ref|XP_011091732.1|  PREDICTED: shaggy-related protein kinase alp...    171   4e-47   Sesamum indicum [beniseed]
gb|KDP28680.1|  hypothetical protein JCGZ_14451                         171   5e-47   Jatropha curcas
gb|AFK41443.1|  unknown                                                 162   4e-46   Medicago truncatula
ref|XP_010255498.1|  PREDICTED: shaggy-related protein kinase eps...    169   6e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010278583.1|  PREDICTED: shaggy-related protein kinase eps...    168   8e-46   Nelumbo nucifera [Indian lotus]
ref|XP_004240041.1|  PREDICTED: shaggy-related protein kinase eps...    166   3e-45   Solanum lycopersicum
gb|KDO86034.1|  hypothetical protein CISIN_1g011138mg                   161   8e-45   Citrus sinensis [apfelsine]
ref|XP_002511803.1|  Glycogen synthase kinase-3 beta, putative          166   9e-45   Ricinus communis
ref|XP_011023409.1|  PREDICTED: shaggy-related protein kinase the...    164   2e-44   Populus euphratica
gb|ACU14009.1|  unknown                                                 156   2e-44   Glycine max [soybeans]
ref|XP_011023410.1|  PREDICTED: shaggy-related protein kinase the...    164   3e-44   Populus euphratica
ref|XP_007051908.1|  Shaggy-like protein kinase 32 isoform 1            164   6e-44   
gb|KDO86033.1|  hypothetical protein CISIN_1g011138mg                   160   1e-43   Citrus sinensis [apfelsine]
ref|XP_003528879.1|  PREDICTED: shaggy-related protein kinase the...    162   1e-43   Glycine max [soybeans]
emb|CAA11862.1|  shaggy kinase 7                                        161   2e-43   Petunia x hybrida [garden petunia]
gb|ACU17807.1|  unknown                                                 153   5e-43   Glycine max [soybeans]
ref|XP_006445137.1|  hypothetical protein CICLE_v10020026mg             159   1e-42   
ref|XP_003623822.1|  Shaggy-related protein kinase                      159   1e-42   Medicago truncatula
gb|KDO86031.1|  hypothetical protein CISIN_1g011138mg                   159   2e-42   Citrus sinensis [apfelsine]
dbj|BAD95891.1|  Ser/Thr protein kinase                                 159   2e-42   Lotus japonicus
ref|XP_010671733.1|  PREDICTED: shaggy-related protein kinase eps...    157   7e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU32069.1|  hypothetical protein MIMGU_mgv1a006024mg                157   7e-42   Erythranthe guttata [common monkey flower]
ref|XP_003521276.1|  PREDICTED: shaggy-related protein kinase theta     157   1e-41   Glycine max [soybeans]
ref|XP_007134960.1|  hypothetical protein PHAVU_010G090200g             157   2e-41   Phaseolus vulgaris [French bean]
gb|KHN27286.1|  Shaggy-related protein kinase theta                     155   4e-41   Glycine soja [wild soybean]
ref|XP_008460173.1|  PREDICTED: shaggy-related protein kinase theta     154   1e-40   Cucumis melo [Oriental melon]
ref|XP_007139956.1|  hypothetical protein PHAVU_008G072800g             153   2e-40   Phaseolus vulgaris [French bean]
ref|XP_004168158.1|  PREDICTED: shaggy-related protein kinase the...    153   3e-40   
ref|XP_004144981.1|  PREDICTED: shaggy-related protein kinase the...    153   3e-40   Cucumis sativus [cucumbers]
ref|XP_004492676.1|  PREDICTED: shaggy-related protein kinase the...    152   5e-40   Cicer arietinum [garbanzo]
ref|XP_003552357.1|  PREDICTED: shaggy-related protein kinase the...    152   6e-40   Glycine max [soybeans]
ref|XP_003534597.1|  PREDICTED: shaggy-related protein kinase theta     152   1e-39   Glycine max [soybeans]
ref|XP_007051910.1|  Shaggy-like protein kinase 32 isoform 3            151   1e-39   
ref|XP_008232743.1|  PREDICTED: shaggy-related protein kinase the...    152   1e-39   Prunus mume [ume]
gb|KHN29413.1|  Shaggy-related protein kinase theta                     150   2e-39   Glycine soja [wild soybean]
dbj|BAO02536.1|  predicted Shaggy-like kinase ortholog                  142   3e-39   Nicotiana alata [flowering tobacco]
ref|XP_010540275.1|  PREDICTED: shaggy-related protein kinase the...    150   3e-39   Tarenaya hassleriana [spider flower]
ref|XP_010919260.1|  PREDICTED: shaggy-related protein kinase NtK...    149   6e-39   Elaeis guineensis
emb|CAC08564.1|  wound-induced GSK-3-like protein                       149   6e-39   Medicago sativa subsp. x varia
ref|XP_009340624.1|  PREDICTED: shaggy-related protein kinase the...    149   7e-39   Pyrus x bretschneideri [bai li]
ref|XP_007218957.1|  hypothetical protein PRUPE_ppa003552mg             149   1e-38   
ref|XP_010919259.1|  PREDICTED: shaggy-related protein kinase eps...    149   1e-38   Elaeis guineensis
ref|XP_008383272.1|  PREDICTED: shaggy-related protein kinase theta     148   3e-38   
gb|KEH18946.1|  shaggy-like kinase                                      147   5e-38   Medicago truncatula
gb|EYU35065.1|  hypothetical protein MIMGU_mgv1a0059282mg               139   5e-38   Erythranthe guttata [common monkey flower]
ref|XP_010090625.1|  Shaggy-related protein kinase theta                145   5e-37   
ref|XP_010523040.1|  PREDICTED: shaggy-related protein kinase theta     143   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_010940878.1|  PREDICTED: shaggy-related protein kinase eps...    143   1e-36   Elaeis guineensis
ref|XP_008799540.1|  PREDICTED: shaggy-related protein kinase alp...    143   2e-36   
ref|XP_008799541.1|  PREDICTED: shaggy-related protein kinase alp...    143   2e-36   Phoenix dactylifera
ref|XP_004510856.1|  PREDICTED: shaggy-related protein kinase the...    140   1e-35   Cicer arietinum [garbanzo]
ref|XP_008803034.1|  PREDICTED: shaggy-related protein kinase eps...    140   2e-35   Phoenix dactylifera
ref|XP_008385705.1|  PREDICTED: shaggy-related protein kinase the...    140   2e-35   Malus domestica [apple tree]
dbj|BAJ93751.1|  predicted protein                                      139   3e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002465046.1|  hypothetical protein SORBIDRAFT_01g031220          139   5e-35   Sorghum bicolor [broomcorn]
ref|XP_006396267.1|  hypothetical protein EUTSA_v10028631mg             138   7e-35   Eutrema salsugineum [saltwater cress]
ref|NP_001065093.1|  Os10g0521700                                       138   1e-34   
gb|EEC67328.1|  hypothetical protein OsI_34360                          137   2e-34   Oryza sativa Indica Group [Indian rice]
ref|NP_191981.1|  Shaggy-related protein kinase theta                   137   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003574217.1|  PREDICTED: shaggy-related protein kinase alp...    135   8e-34   Brachypodium distachyon [annual false brome]
ref|XP_006375322.1|  shaggy-related protein kinase theta                135   9e-34   Populus trichocarpa [western balsam poplar]
ref|XP_002872933.1|  hypothetical protein ARALYDRAFT_490498             135   1e-33   
ref|XP_011023408.1|  PREDICTED: shaggy-related protein kinase NtK...    135   1e-33   Populus euphratica
ref|XP_010933863.1|  PREDICTED: shaggy-related protein kinase eps...    133   4e-33   Elaeis guineensis
ref|XP_008657609.1|  PREDICTED: shaggy-related protein kinase alp...    133   5e-33   
ref|XP_008660602.1|  PREDICTED: shaggy-related protein kinase alp...    133   5e-33   Zea mays [maize]
gb|KJB22348.1|  hypothetical protein B456_004G042400                    133   6e-33   Gossypium raimondii
ref|XP_006661970.1|  PREDICTED: shaggy-related protein kinase the...    132   7e-33   Oryza brachyantha
ref|XP_007051909.1|  Shaggy-like protein kinase 32 isoform 2            130   3e-32   
ref|XP_004983886.1|  PREDICTED: LOW QUALITY PROTEIN: shaggy-relat...    130   4e-32   
ref|XP_010424046.1|  PREDICTED: shaggy-related protein kinase the...    125   7e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010053665.1|  PREDICTED: shaggy-related protein kinase eps...    129   1e-31   Eucalyptus grandis [rose gum]
gb|ABR17117.1|  unknown                                                 128   2e-31   Picea sitchensis
gb|ABK24428.1|  unknown                                                 128   2e-31   Picea sitchensis
ref|XP_009134534.1|  PREDICTED: shaggy-related protein kinase theta     128   3e-31   Brassica rapa
emb|CDX74346.1|  BnaA03g27010D                                          128   3e-31   
emb|CAA58595.1|  Petunia Shaggy kinase 6                                127   5e-31   Petunia x hybrida [garden petunia]
ref|XP_010419626.1|  PREDICTED: shaggy-related protein kinase the...    125   5e-31   Camelina sativa [gold-of-pleasure]
emb|CDY07202.1|  BnaCnng02170D                                          127   7e-31   
ref|XP_010427333.1|  PREDICTED: shaggy-related protein kinase the...    127   9e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010255499.1|  PREDICTED: shaggy-related protein kinase eps...    126   2e-30   
ref|XP_009111468.1|  PREDICTED: shaggy-related protein kinase theta     125   3e-30   Brassica rapa
ref|XP_006289072.1|  hypothetical protein CARUB_v10002475mg             125   4e-30   Capsella rubella
gb|ACJ84778.1|  unknown                                                 117   5e-30   Medicago truncatula
emb|CDY51144.1|  BnaA09g51790D                                          124   1e-29   Brassica napus [oilseed rape]
ref|XP_009393923.1|  PREDICTED: shaggy-related protein kinase eps...    124   1e-29   
ref|XP_009393922.1|  PREDICTED: shaggy-related protein kinase eps...    123   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004306833.1|  PREDICTED: shaggy-related protein kinase the...    123   2e-29   Fragaria vesca subsp. vesca
ref|XP_009400715.1|  PREDICTED: shaggy-related protein kinase eta...    122   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
sp|O04160.2|KSGT_BRANA  RecName: Full=Shaggy-related protein kina...    122   2e-29   Brassica napus [oilseed rape]
ref|XP_010456251.1|  PREDICTED: shaggy-related protein kinase theta     122   3e-29   Camelina sativa [gold-of-pleasure]
gb|KJB41234.1|  hypothetical protein B456_007G096100                    122   6e-29   Gossypium raimondii
emb|CDX91895.1|  BnaC03g31970D                                          121   8e-29   
gb|KFK30649.1|  hypothetical protein AALP_AA6G009500                    120   2e-28   Arabis alpina [alpine rockcress]
ref|XP_002301334.1|  hypothetical protein POPTR_0002s15640g             119   4e-28   
ref|XP_008344049.1|  PREDICTED: shaggy-related protein kinase eps...    119   6e-28   
ref|XP_009412822.1|  PREDICTED: shaggy-related protein kinase alp...    117   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412821.1|  PREDICTED: shaggy-related protein kinase alp...    117   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002991115.1|  hypothetical protein SELMODRAFT_451471             114   2e-26   Selaginella moellendorffii
gb|KJB41237.1|  hypothetical protein B456_007G096100                    110   7e-25   Gossypium raimondii
gb|KHG02100.1|  Shaggy-related protein kinase theta                     108   2e-24   Gossypium arboreum [tree cotton]
gb|KHG02099.1|  Shaggy-related protein kinase theta                     108   3e-24   Gossypium arboreum [tree cotton]
gb|KJB24672.1|  hypothetical protein B456_004G156700                    108   3e-24   Gossypium raimondii
gb|KJB24673.1|  hypothetical protein B456_004G156700                    108   3e-24   Gossypium raimondii
gb|KJB24671.1|  hypothetical protein B456_004G156700                    108   5e-24   Gossypium raimondii
ref|XP_002987888.1|  GSK3/shaggy-like protein kinase                    105   3e-23   Selaginella moellendorffii
gb|KJB41235.1|  hypothetical protein B456_007G096100                    103   1e-22   Gossypium raimondii
ref|XP_001762052.1|  predicted protein                                  102   3e-22   
gb|AAQ23109.1|  shaggy-related protein kinase 4                         102   4e-22   Physcomitrella patens
emb|CDY19757.1|  BnaA09g04100D                                          101   6e-22   Brassica napus [oilseed rape]
ref|XP_001763270.1|  predicted protein                                  101   7e-22   
emb|CDX87033.1|  BnaC09g03480D                                          101   9e-22   
gb|AAQ23111.1|  shaggy-related protein kinase 1                         100   1e-21   Physcomitrella patens
gb|ABR68632.1|  RIM11-like protein                                      100   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001781582.1|  predicted protein                                  100   2e-21   
gb|AAQ23108.1|  shaggy-related protein kinase 3                         100   2e-21   Physcomitrella patens
ref|XP_001765207.1|  predicted protein                                  100   2e-21   
ref|XP_011079505.1|  PREDICTED: shaggy-related protein kinase alp...  99.8    3e-21   Sesamum indicum [beniseed]
gb|AAQ23107.1|  shaggy-related protein kinase 2                       99.8    3e-21   Physcomitrella patens
ref|XP_001763265.1|  predicted protein                                99.8    3e-21   
ref|XP_009111716.1|  PREDICTED: shaggy-related protein kinase alp...  99.0    6e-21   Brassica rapa
gb|KJB22347.1|  hypothetical protein B456_004G042400                  99.0    7e-21   Gossypium raimondii
ref|XP_001781586.1|  predicted protein                                98.2    1e-20   
ref|XP_010674528.1|  PREDICTED: shaggy-related protein kinase alpha   96.7    3e-20   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB45482.1|  hypothetical protein B456_007G308500                  95.5    4e-20   Gossypium raimondii
gb|KDP23349.1|  hypothetical protein JCGZ_23182                       96.3    4e-20   Jatropha curcas
gb|EPS63877.1|  hypothetical protein M569_10905                       96.3    5e-20   Genlisea aurea
ref|XP_008803035.1|  PREDICTED: shaggy-related protein kinase eps...  96.7    5e-20   Phoenix dactylifera
gb|ABK93098.1|  unknown                                               95.9    6e-20   Populus trichocarpa [western balsam poplar]
ref|XP_002319468.1|  Glycogen synthase kinase-3 MsK-1 family protein  95.9    6e-20   Populus trichocarpa [western balsam poplar]
ref|XP_009400716.1|  PREDICTED: shaggy-related protein kinase alp...  96.3    7e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB45480.1|  hypothetical protein B456_007G308500                  95.1    7e-20   Gossypium raimondii
gb|KJB45479.1|  hypothetical protein B456_007G308500                  95.5    8e-20   Gossypium raimondii
ref|XP_007031229.1|  Shaggy-related kinase 11, 11 isoform 1           95.5    8e-20   
emb|CAL07991.1|  shaggy/glycogen synthase kinase-3 like protein       90.5    1e-19   Platanus x hispanica [London plane tree]
ref|XP_006382290.1|  hypothetical protein POPTR_0005s00710g           94.7    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010455024.1|  PREDICTED: shaggy-related protein kinase alp...  94.7    2e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006289925.1|  hypothetical protein CARUB_v10003541mg           94.4    2e-19   Capsella rubella
gb|EMT29598.1|  Shaggy-related protein kinase theta                   95.5    2e-19   
gb|EYU46859.1|  hypothetical protein MIMGU_mgv1a007395mg              94.4    2e-19   Erythranthe guttata [common monkey flower]
gb|EPS68300.1|  hypothetical protein M569_06467                       94.4    2e-19   Genlisea aurea
ref|XP_002512564.1|  Glycogen synthase kinase-3 beta, putative        94.0    3e-19   
ref|XP_010660897.1|  PREDICTED: shaggy-related protein kinase eps...  94.0    3e-19   
ref|XP_007031504.1|  Shaggy-like kinase 13 isoform 1                  94.4    3e-19   
ref|XP_010660896.1|  PREDICTED: shaggy-related protein kinase eps...  94.0    3e-19   Vitis vinifera
ref|XP_007031506.1|  Shaggy-like kinase 13 isoform 3                  94.0    3e-19   
ref|XP_010524830.1|  PREDICTED: shaggy-related protein kinase alp...  94.0    3e-19   Tarenaya hassleriana [spider flower]
gb|AEQ94143.1|  putative Glycogen synthase kinase 3                   92.4    3e-19   Elaeis guineensis
ref|XP_003554602.1|  PREDICTED: shaggy-related protein kinase alp...  94.0    3e-19   Glycine max [soybeans]
ref|XP_006394905.1|  hypothetical protein EUTSA_v10004319mg           94.0    3e-19   Eutrema salsugineum [saltwater cress]
ref|NP_001242406.1|  uncharacterized protein LOC100788612             94.0    4e-19   
ref|XP_011023844.1|  PREDICTED: shaggy-related protein kinase alpha   94.0    4e-19   Populus euphratica
ref|XP_006576226.1|  PREDICTED: uncharacterized protein LOC100788...  94.0    4e-19   
ref|XP_011039006.1|  PREDICTED: shaggy-related protein kinase alpha   93.6    4e-19   Populus euphratica
gb|EPS73818.1|  hypothetical protein M569_00937                       93.6    4e-19   Genlisea aurea
ref|XP_004495628.1|  PREDICTED: glycogen synthase kinase-3 homolo...  93.6    4e-19   
gb|AEQ94156.1|  shaggy-related protein kinase                         91.7    4e-19   Elaeis guineensis
emb|CAA53181.1|  shaggy related kinase                                93.6    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495625.1|  PREDICTED: glycogen synthase kinase-3 homolo...  94.0    5e-19   
emb|CAA04265.1|  shaggy-like kinase alpha                             93.6    5e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CAA58594.1|  Petunia Shaggy kinase 4                              93.6    5e-19   Petunia x hybrida [garden petunia]
ref|NP_568486.1|  Shaggy-related protein kinase alpha                 93.2    5e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493927.1|  PREDICTED: shaggy-related protein kinase alp...  93.6    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010421531.1|  PREDICTED: shaggy-related protein kinase alp...  93.2    6e-19   Camelina sativa [gold-of-pleasure]
gb|KHG02936.1|  Shaggy-related protein kinase alpha                   93.2    6e-19   Gossypium arboreum [tree cotton]
ref|XP_010546768.1|  PREDICTED: shaggy-related protein kinase alpha   93.2    6e-19   Tarenaya hassleriana [spider flower]
ref|XP_011092192.1|  PREDICTED: shaggy-related protein kinase alpha   93.2    6e-19   Sesamum indicum [beniseed]
ref|XP_006840718.1|  hypothetical protein AMTR_s00096p00102520        92.4    6e-19   
gb|KDO45355.1|  hypothetical protein CISIN_1g015298mg                 92.8    6e-19   Citrus sinensis [apfelsine]
gb|KCW84977.1|  hypothetical protein EUGRSUZ_B01797                   92.0    7e-19   Eucalyptus grandis [rose gum]
ref|XP_002280673.1|  PREDICTED: shaggy-related protein kinase alpha   92.8    8e-19   Vitis vinifera
gb|KDO45354.1|  hypothetical protein CISIN_1g015298mg                 92.4    8e-19   Citrus sinensis [apfelsine]
emb|CDX80585.1|  BnaC07g28590D                                        92.8    8e-19   
gb|KJB24670.1|  hypothetical protein B456_004G156700                  92.8    9e-19   Gossypium raimondii
ref|XP_007205270.1|  hypothetical protein PRUPE_ppa006473mg           92.8    1e-18   Prunus persica
gb|KDO45353.1|  hypothetical protein CISIN_1g015298mg                 92.4    1e-18   Citrus sinensis [apfelsine]
ref|XP_002874323.1|  hypothetical protein ARALYDRAFT_489503           92.4    1e-18   
ref|XP_004252662.1|  PREDICTED: shaggy-related protein kinase eps...  92.4    1e-18   Solanum lycopersicum
gb|KCW78018.1|  hypothetical protein EUGRSUZ_D02249                   92.4    1e-18   Eucalyptus grandis [rose gum]
ref|XP_006480288.1|  PREDICTED: shaggy-related protein kinase alp...  92.4    1e-18   Citrus sinensis [apfelsine]
ref|XP_004252661.1|  PREDICTED: shaggy-related protein kinase eps...  92.4    1e-18   Solanum lycopersicum
ref|XP_006364003.1|  PREDICTED: shaggy-related protein kinase eps...  92.4    1e-18   Solanum tuberosum [potatoes]
ref|XP_010042192.1|  PREDICTED: shaggy-related protein kinase alpha   92.4    1e-18   Eucalyptus grandis [rose gum]
ref|XP_011003165.1|  PREDICTED: shaggy-related protein kinase alp...  92.4    1e-18   Populus euphratica
ref|XP_010276519.1|  PREDICTED: shaggy-related protein kinase alpha   92.4    1e-18   Nelumbo nucifera [Indian lotus]
gb|ABY60447.1|  serine/threonine protein kinase                       92.4    1e-18   Adonis aestivalis var. palaestina
ref|XP_008781189.1|  PREDICTED: shaggy-related protein kinase alp...  92.0    1e-18   Phoenix dactylifera
ref|XP_006841582.1|  hypothetical protein AMTR_s00003p00196730        92.0    2e-18   Amborella trichopoda
ref|XP_010270906.1|  PREDICTED: shaggy-related protein kinase alp...  92.0    2e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010270905.1|  PREDICTED: shaggy-related protein kinase alp...  92.4    2e-18   Nelumbo nucifera [Indian lotus]
gb|KHN16033.1|  Glycogen synthase kinase-3 like MsK-1                 92.0    2e-18   Glycine soja [wild soybean]
ref|XP_010097328.1|  Shaggy-related protein kinase alpha              93.2    2e-18   
gb|ACQ91102.1|  glycogen synthase kinase                              92.0    2e-18   Glycine max [soybeans]
ref|XP_010910596.1|  PREDICTED: shaggy-related protein kinase alp...  92.0    2e-18   Elaeis guineensis
ref|XP_006588432.1|  PREDICTED: glycogen synthase kinase-3 isofor...  92.0    2e-18   Glycine max [soybeans]
ref|NP_001242661.1|  glycogen synthase kinase-3                       92.0    2e-18   
ref|XP_009775930.1|  PREDICTED: shaggy-related protein kinase NtK...  92.0    2e-18   Nicotiana sylvestris
ref|XP_009629200.1|  PREDICTED: shaggy-related protein kinase NtK...  92.0    2e-18   Nicotiana tomentosiformis
ref|XP_004230343.1|  PREDICTED: shaggy-related protein kinase NtK-1   92.0    2e-18   Solanum lycopersicum
ref|XP_010921357.1|  PREDICTED: shaggy-related protein kinase alpha   92.0    2e-18   
gb|AFH00876.1|  glycogen synthase kinase-3                            92.0    2e-18   Glycine soja [wild soybean]
ref|XP_007145031.1|  hypothetical protein PHAVU_007G204000g           92.0    2e-18   Phaseolus vulgaris [French bean]
ref|XP_002302794.1|  Glycogen synthase kinase-3 MsK-3 family protein  92.0    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_006338576.1|  PREDICTED: shaggy-related protein kinase eps...  92.0    2e-18   Solanum tuberosum [potatoes]
ref|XP_008793304.1|  PREDICTED: shaggy-related protein kinase alp...  92.0    2e-18   
ref|XP_006338577.1|  PREDICTED: shaggy-related protein kinase eps...  91.7    2e-18   Solanum tuberosum [potatoes]
ref|XP_006446534.1|  hypothetical protein CICLE_v10015323mg           92.0    2e-18   Citrus clementina [clementine]
ref|NP_001274855.1|  Shaggy-like protein kinase NtK-1                 91.7    2e-18   Solanum tuberosum [potatoes]
ref|XP_006428242.1|  hypothetical protein CICLE_v10013624mg           92.4    2e-18   
ref|XP_008246288.1|  PREDICTED: shaggy-related protein kinase alpha   91.7    2e-18   Prunus mume [ume]
gb|ACJ83284.1|  unknown                                               89.0    2e-18   Medicago truncatula
ref|XP_008381452.1|  PREDICTED: glycogen synthase kinase-3 homolo...  91.7    2e-18   
ref|XP_010091400.1|  Glycogen synthase kinase-3-MsK-3-like protein    91.3    3e-18   Morus notabilis
ref|XP_010251221.1|  PREDICTED: shaggy-related protein kinase eps...  90.9    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009759533.1|  PREDICTED: shaggy-related protein kinase eps...  91.3    3e-18   Nicotiana sylvestris
ref|XP_011040636.1|  PREDICTED: shaggy-related protein kinase alp...  91.3    3e-18   Populus euphratica
ref|XP_002279596.1|  PREDICTED: shaggy-related protein kinase alp...  91.3    3e-18   Vitis vinifera
ref|XP_009598967.1|  PREDICTED: shaggy-related protein kinase eps...  91.3    3e-18   Nicotiana tomentosiformis
ref|XP_011097427.1|  PREDICTED: shaggy-related protein kinase eps...  91.3    3e-18   Sesamum indicum [beniseed]
ref|XP_010251217.1|  PREDICTED: shaggy-related protein kinase eps...  90.9    4e-18   Nelumbo nucifera [Indian lotus]
ref|XP_007031230.1|  Shaggy-related kinase 11, 11 isoform 2           90.9    4e-18   
ref|XP_010251218.1|  PREDICTED: shaggy-related protein kinase eps...  90.9    4e-18   Nelumbo nucifera [Indian lotus]
ref|XP_002515218.1|  Glycogen synthase kinase-3 beta, putative        90.9    4e-18   Ricinus communis
gb|EYU38392.1|  hypothetical protein MIMGU_mgv1a007572mg              90.9    4e-18   Erythranthe guttata [common monkey flower]
ref|XP_008795404.1|  PREDICTED: shaggy-related protein kinase the...  90.5    4e-18   
gb|EYU34726.1|  hypothetical protein MIMGU_mgv1a007335mg              90.9    5e-18   Erythranthe guttata [common monkey flower]
gb|KDO66111.1|  hypothetical protein CISIN_1g0141741mg                88.6    5e-18   Citrus sinensis [apfelsine]
gb|KDO86865.1|  hypothetical protein CISIN_1g015632mg                 89.7    5e-18   Citrus sinensis [apfelsine]
emb|CAN64359.1|  hypothetical protein VITISV_041427                   90.9    5e-18   Vitis vinifera
ref|XP_007215466.1|  hypothetical protein PRUPE_ppa006497mg           90.5    6e-18   
ref|XP_008230580.1|  PREDICTED: shaggy-related protein kinase eps...  90.5    6e-18   Prunus mume [ume]
ref|XP_009151155.1|  PREDICTED: shaggy-related protein kinase alpha   90.5    6e-18   Brassica rapa
gb|KDO86864.1|  hypothetical protein CISIN_1g015632mg                 89.7    7e-18   Citrus sinensis [apfelsine]
gb|KDO66115.1|  hypothetical protein CISIN_1g0141741mg                88.6    7e-18   Citrus sinensis [apfelsine]
gb|KDO66112.1|  hypothetical protein CISIN_1g0141741mg                88.6    7e-18   Citrus sinensis [apfelsine]
ref|XP_009363099.1|  PREDICTED: glycogen synthase kinase-3 homolo...  90.1    7e-18   Pyrus x bretschneideri [bai li]
ref|XP_006444574.1|  hypothetical protein CICLE_v10020852mg           89.7    7e-18   
emb|CDP15204.1|  unnamed protein product                              90.1    8e-18   Coffea canephora [robusta coffee]
ref|XP_003555781.1|  PREDICTED: glycogen synthase kinase-3 homolo...  90.1    1e-17   Glycine max [soybeans]
ref|XP_006444573.1|  hypothetical protein CICLE_v10020852mg           89.7    1e-17   
ref|XP_010938176.1|  PREDICTED: shaggy-related protein kinase alp...  89.7    1e-17   Elaeis guineensis
ref|XP_004232308.1|  PREDICTED: shaggy-related protein kinase eps...  89.7    1e-17   Solanum lycopersicum
ref|XP_010108792.1|  Shaggy-related protein kinase epsilon            91.7    2e-17   
ref|XP_010070089.1|  PREDICTED: shaggy-related protein kinase alp...  89.0    2e-17   
ref|XP_010070081.1|  PREDICTED: shaggy-related protein kinase alp...  89.0    2e-17   Eucalyptus grandis [rose gum]
ref|XP_008443540.1|  PREDICTED: shaggy-related protein kinase eps...  89.0    2e-17   Cucumis melo [Oriental melon]
emb|CDP02094.1|  unnamed protein product                              89.0    2e-17   Coffea canephora [robusta coffee]
emb|CAB87631.1|  protein kinase MSK-3-like                            89.0    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873682.1|  kinase family protein                            89.0    2e-17   
ref|XP_010941497.1|  PREDICTED: shaggy-related protein kinase alpha   88.6    2e-17   
ref|NP_196968.2|  Shaggy-related protein kinase 13                    88.6    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006470301.1|  PREDICTED: shaggy-related protein kinase eps...  88.6    3e-17   Citrus sinensis [apfelsine]
ref|XP_003591238.1|  Glycogen synthase kinase                         88.6    3e-17   Medicago truncatula
ref|XP_008812956.1|  PREDICTED: shaggy-related protein kinase alp...  88.6    3e-17   Phoenix dactylifera
ref|XP_004304635.1|  PREDICTED: shaggy-related protein kinase eps...  88.6    3e-17   Fragaria vesca subsp. vesca
sp|P51137.1|MSK1_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...  88.6    3e-17   Medicago sativa [alfalfa]
ref|NP_001042602.1|  Os01g0252100                                     88.2    4e-17   
ref|XP_009366055.1|  PREDICTED: shaggy-related protein kinase alp...  88.2    4e-17   Pyrus x bretschneideri [bai li]
ref|XP_004494455.1|  PREDICTED: glycogen synthase kinase-3 homolo...  87.8    4e-17   
emb|CDY27737.1|  BnaA05g31460D                                        89.0    4e-17   Brassica napus [oilseed rape]
gb|ABR16348.1|  unknown                                               88.2    4e-17   
ref|XP_008363964.1|  PREDICTED: shaggy-related protein kinase alpha   87.8    4e-17   
gb|ABB55385.1|  Ser/Thr protein kinase-like                           87.8    5e-17   
ref|XP_009335521.1|  PREDICTED: shaggy-related protein kinase alpha   88.2    5e-17   
ref|XP_009383704.1|  PREDICTED: shaggy-related protein kinase alpha   87.8    5e-17   
gb|EYU34725.1|  hypothetical protein MIMGU_mgv1a007335mg              87.8    5e-17   
gb|KJB49765.1|  hypothetical protein B456_008G136600                  87.8    5e-17   
gb|KHG00969.1|  Glycogen synthase kinase-3 MsK-3                      87.8    5e-17   
ref|XP_011087526.1|  PREDICTED: shaggy-related protein kinase NtK...  87.8    5e-17   
sp|Q40518.1|MSK1_TOBAC  RecName: Full=Shaggy-related protein kina...  87.8    5e-17   
ref|XP_009334099.1|  PREDICTED: shaggy-related protein kinase eps...  87.8    6e-17   
ref|XP_007051226.1|  Shaggy-related kinase 11, 11 isoform 1           87.8    6e-17   
ref|XP_003518657.1|  PREDICTED: glycogen synthase kinase-3 homolo...  87.8    6e-17   
ref|XP_010248490.1|  PREDICTED: shaggy-related protein kinase eps...  87.8    6e-17   
emb|CAA48472.1|  protein kinase                                       87.8    6e-17   
gb|KGN65982.1|  hypothetical protein Csa_1G560660                     87.4    6e-17   
ref|XP_006588497.1|  PREDICTED: uncharacterized protein LOC100817...  87.4    6e-17   
sp|P51139.2|MSK3_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...  87.4    7e-17   
ref|NP_001269276.1|  glycogen synthase kinase-3 homolog MsK-1-like    87.4    7e-17   
ref|XP_004163362.1|  PREDICTED: shaggy-related protein kinase alp...  87.4    7e-17   
ref|XP_004135570.1|  PREDICTED: shaggy-related protein kinase alp...  87.4    7e-17   
ref|XP_010492276.1|  PREDICTED: shaggy-related protein kinase eps...  87.4    7e-17   
ref|XP_006287860.1|  hypothetical protein CARUB_v10001087mg           87.4    8e-17   
ref|XP_010420109.1|  PREDICTED: shaggy-related protein kinase eps...  87.4    8e-17   
ref|XP_008357735.1|  PREDICTED: shaggy-related protein kinase eps...  87.4    8e-17   
ref|XP_008450520.1|  PREDICTED: shaggy-related protein kinase NtK-1   87.4    8e-17   
gb|KGN59685.1|  hypothetical protein Csa_3G838640                     87.4    8e-17   
ref|XP_004164819.1|  PREDICTED: shaggy-related protein kinase eps...  87.4    8e-17   
ref|XP_004141099.1|  PREDICTED: shaggy-related protein kinase eps...  87.4    8e-17   
ref|XP_006408021.1|  hypothetical protein EUTSA_v10020835mg           87.4    8e-17   
dbj|BAJ34573.1|  unnamed protein product                              87.4    9e-17   
ref|XP_006408022.1|  hypothetical protein EUTSA_v10020835mg           87.4    9e-17   
ref|XP_006399977.1|  hypothetical protein EUTSA_v10013689mg           87.0    9e-17   
gb|AAM62970.1|  shaggy related protein kinase ASK-GAMMA               87.0    1e-16   
ref|XP_010432712.1|  PREDICTED: shaggy-related protein kinase gam...  87.0    1e-16   
ref|XP_008778092.1|  PREDICTED: shaggy-related protein kinase alp...  87.0    1e-16   
ref|XP_010486058.1|  PREDICTED: shaggy-related protein kinase gam...  87.0    1e-16   
ref|XP_009147201.1|  PREDICTED: shaggy-related protein kinase gamma   87.0    1e-16   
ref|XP_004148581.1|  PREDICTED: glycogen synthase kinase-3 homolo...  86.7    1e-16   
emb|CDY05202.1|  BnaC05g46010D                                        86.7    1e-16   
ref|XP_009134851.1|  PREDICTED: shaggy-related protein kinase gamma   86.7    1e-16   
ref|NP_187235.1|  Shaggy-related protein kinase gamma                 86.7    1e-16   
gb|AES82237.2|  glycogen synthase kinase                              86.3    1e-16   
emb|CDY49981.1|  BnaC03g34380D                                        86.7    1e-16   
ref|XP_011466950.1|  PREDICTED: glycogen synthase kinase-3 homolo...  86.7    1e-16   
ref|XP_009617298.1|  PREDICTED: shaggy-related protein kinase NtK-1   86.7    1e-16   
gb|KHN00229.1|  Glycogen synthase kinase-3 like MsK-3                 87.8    1e-16   
gb|ACJ85178.1|  unknown                                               86.3    2e-16   
ref|XP_002882438.1|  hypothetical protein ARALYDRAFT_477878           86.7    2e-16   
ref|XP_010453592.1|  PREDICTED: shaggy-related protein kinase eps...  86.7    2e-16   
ref|XP_009757512.1|  PREDICTED: shaggy-related protein kinase NtK-1   86.7    2e-16   
ref|XP_008343189.1|  PREDICTED: glycogen synthase kinase-3 homolo...  85.9    2e-16   
ref|XP_010679446.1|  PREDICTED: shaggy-related protein kinase NtK-1   86.3    2e-16   
ref|XP_003626019.1|  Protein kinase, putative                         86.3    2e-16   
ref|XP_010464137.1|  PREDICTED: shaggy-related protein kinase gamma   86.3    2e-16   
ref|XP_010523730.1|  PREDICTED: shaggy-related protein kinase bet...  86.7    2e-16   
gb|AFK38277.1|  unknown                                               86.3    2e-16   
ref|XP_009384996.1|  PREDICTED: shaggy-related protein kinase alp...  86.3    2e-16   
ref|XP_009403747.1|  PREDICTED: shaggy-related protein kinase alp...  86.3    2e-16   
ref|XP_003626020.1|  Protein kinase, putative                         86.7    2e-16   
ref|XP_008353866.1|  PREDICTED: glycogen synthase kinase-3 homolo...  85.9    3e-16   
ref|XP_010550142.1|  PREDICTED: shaggy-related protein kinase eps...  85.9    3e-16   
ref|XP_006643997.1|  PREDICTED: shaggy-related protein kinase alp...  85.9    3e-16   
ref|XP_009131419.1|  PREDICTED: shaggy-related protein kinase eps...  85.9    3e-16   
emb|CDX78587.1|  BnaA03g04990D                                        85.9    3e-16   
emb|CDX70574.1|  BnaC03g06580D                                        85.5    3e-16   
ref|XP_010038314.1|  PREDICTED: shaggy-related protein kinase alp...  85.5    3e-16   
ref|XP_008666944.1|  PREDICTED: glycogen synthase kinase-3 homolo...  81.6    3e-16   
ref|XP_011087528.1|  PREDICTED: shaggy-related protein kinase alp...  85.1    3e-16   
ref|XP_003566380.1|  PREDICTED: shaggy-related protein kinase alpha   85.5    4e-16   
ref|XP_008388444.1|  PREDICTED: shaggy-related protein kinase alpha   85.5    4e-16   
ref|XP_009386339.1|  PREDICTED: shaggy-related protein kinase alp...  85.5    4e-16   
ref|XP_006299606.1|  hypothetical protein CARUB_v10015785mg           85.5    4e-16   
ref|XP_009382471.1|  PREDICTED: shaggy-related protein kinase alp...  85.1    5e-16   
gb|KDP28311.1|  hypothetical protein JCGZ_14082                       85.1    5e-16   
ref|XP_008227813.1|  PREDICTED: glycogen synthase kinase-3 homolo...  85.1    5e-16   
emb|CDM82575.1|  unnamed protein product                              85.1    5e-16   
dbj|BAF36565.1|  Shaggy-like kinase                                   85.1    5e-16   
ref|XP_009382470.1|  PREDICTED: shaggy-related protein kinase alp...  85.1    6e-16   
ref|XP_007140965.1|  hypothetical protein PHAVU_008G156000g           84.3    7e-16   
gb|EMT32435.1|  Glycogen synthase kinase-3-MsK-3-like protein         84.7    9e-16   
gb|ABR17316.1|  unknown                                               84.7    9e-16   
emb|CBI39647.3|  unnamed protein product                              84.0    1e-15   
ref|XP_006650852.1|  PREDICTED: shaggy-related protein kinase alp...  84.0    1e-15   
ref|XP_007221484.1|  hypothetical protein PRUPE_ppa006462mg           84.0    1e-15   
dbj|BAD95892.1|  Ser/Thr protein kinase                               84.0    1e-15   
ref|XP_004495878.1|  PREDICTED: glycogen synthase kinase-3 homolo...  84.0    1e-15   
gb|ABG74911.1|  AtSK12-like protein                                   84.0    1e-15   
ref|XP_006654010.1|  PREDICTED: shaggy-related protein kinase alp...  83.2    3e-15   
tpg|DAA52173.1|  TPA: putative glycogen synthase kinase family pr...  80.9    3e-15   
ref|XP_004960405.1|  PREDICTED: shaggy-related protein kinase alp...  82.8    4e-15   
ref|XP_006858581.1|  hypothetical protein AMTR_s00071p00186380        83.2    4e-15   
gb|AAT85177.1|  putative glycogen synthase kinase                     82.0    4e-15   
gb|ABK24513.1|  unknown                                               82.8    4e-15   
tpg|DAA52172.1|  TPA: putative glycogen synthase kinase family pr...  80.9    4e-15   
gb|EMS49677.1|  Glycogen synthase kinase-3-like protein MsK-3         83.2    4e-15   
sp|P51138.1|MSK2_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...  82.4    4e-15   
gb|AAB61055.1|  Similar to shaggy related protein kinase. Belongs...  82.8    4e-15   
gb|EAY96448.1|  hypothetical protein OsI_18343                        82.4    5e-15   
ref|XP_003569078.1|  PREDICTED: shaggy-related protein kinase alp...  82.4    5e-15   
ref|XP_009384446.1|  PREDICTED: shaggy-related protein kinase alp...  82.0    6e-15   
emb|CBI37005.3|  unnamed protein product                              81.6    6e-15   
gb|KHG20282.1|  Shaggy-related protein kinase theta                   81.6    8e-15   
ref|NP_001054564.1|  Os05g0134000                                     81.6    9e-15   
gb|AAY98510.1|  glycogen synthase kinase                              81.6    9e-15   
gb|AFN42826.1|  GSK3-like protein                                     81.3    1e-14   
ref|XP_003591340.1|  Glycogen synthase kinase-3-like protein          81.3    1e-14   
gb|AES61591.2|  glycogen synthase kinase                              81.3    1e-14   
tpg|DAA53953.1|  TPA: putative glycogen synthase kinase family pr...  80.1    1e-14   
gb|ABG29426.1|  GSK-like kinase 1                                     80.9    2e-14   
gb|AFW57486.1|  putative glycogen synthase kinase family protein      80.1    2e-14   
gb|ABG29423.1|  GSK-like kinase 1B                                    80.9    2e-14   
gb|AFW79696.1|  putative glycogen synthase kinase family protein      80.5    2e-14   
ref|NP_001148880.1|  glycogen synthase kinase-3 MsK-3                 80.5    2e-14   
gb|AEN14336.1|  hypothetical protein rf1-C1-g7                        80.5    2e-14   
ref|XP_002455378.1|  hypothetical protein SORBIDRAFT_03g009580        80.5    2e-14   
tpg|DAA53950.1|  TPA: putative glycogen synthase kinase family pr...  80.1    2e-14   
gb|ABC94949.1|  GSK-like kinase                                       80.5    2e-14   
gb|ABC94947.1|  GSK-like kinase                                       80.5    2e-14   
gb|ABG29424.1|  GSK-like kinase 1D                                    80.5    2e-14   
ref|XP_002440537.1|  hypothetical protein SORBIDRAFT_09g002710        80.5    3e-14   
tpg|DAA53952.1|  TPA: putative glycogen synthase kinase family pr...  80.5    3e-14   
ref|XP_009401663.1|  PREDICTED: shaggy-related protein kinase gamma   80.1    3e-14   
ref|NP_001150105.1|  LOC100283734                                     80.1    3e-14   
tpg|DAA53951.1|  TPA: putative glycogen synthase kinase family pr...  80.1    3e-14   
ref|NP_001288361.1|  uncharacterized protein LOC103641344             80.1    3e-14   
ref|XP_008662920.1|  PREDICTED: shaggy-related protein kinase alp...  79.7    3e-14   
ref|XP_008672929.1|  PREDICTED: LOC100283734 isoform X1               80.1    4e-14   
ref|XP_010245511.1|  PREDICTED: shaggy-related protein kinase kap...  80.1    4e-14   
ref|XP_010245513.1|  PREDICTED: shaggy-related protein kinase kap...  80.1    4e-14   
emb|CDX78658.1|  BnaA03g05700D                                        80.5    5e-14   
dbj|BAJ99594.1|  predicted protein                                    79.3    5e-14   
ref|XP_002526438.1|  conserved hypothetical protein                   75.9    7e-14   
ref|XP_004967857.1|  PREDICTED: shaggy-related protein kinase alp...  79.0    7e-14   
dbj|BAO02534.1|  predicted Shaggy-like kinase ortholog                74.3    8e-14   
gb|EMT09676.1|  Shaggy-related protein kinase alpha                   79.0    9e-14   
gb|EMS62368.1|  Shaggy-related protein kinase alpha                   79.0    1e-13   
gb|ABK24355.1|  unknown                                               77.4    2e-13   
gb|ABG29422.1|  GSK-like kinase 1A                                    77.4    2e-13   
emb|CDP17018.1|  unnamed protein product                              77.0    3e-13   
ref|XP_010245514.1|  PREDICTED: shaggy-related protein kinase kap...  77.0    3e-13   
gb|EPS67477.1|  shaggy kinase 7                                       77.0    3e-13   
ref|XP_010251219.1|  PREDICTED: shaggy-related protein kinase eps...  76.6    4e-13   
ref|XP_006382289.1|  hypothetical protein POPTR_0005s00710g           75.9    8e-13   
ref|XP_006389512.1|  hypothetical protein POPTR_0022s00480g           73.6    1e-12   
emb|CDO97626.1|  unnamed protein product                              73.9    1e-12   
ref|XP_011047893.1|  PREDICTED: shaggy-related protein kinase kappa   73.6    1e-12   
gb|KHN00323.1|  Glycogen synthase kinase-3 like MsK-2                 75.1    1e-12   
gb|ACJ84453.1|  unknown                                               75.1    1e-12   
gb|KDO39707.1|  hypothetical protein CISIN_1g014595mg                 74.7    1e-12   
gb|AFK37839.1|  unknown                                               75.1    1e-12   
ref|XP_010255500.1|  PREDICTED: shaggy-related protein kinase the...  75.1    1e-12   
gb|KDO39709.1|  hypothetical protein CISIN_1g014595mg                 75.1    2e-12   
gb|KHN26183.1|  Glycogen synthase kinase-3 like MsK-1                 74.7    2e-12   
ref|XP_010493929.1|  PREDICTED: shaggy-related protein kinase alp...  74.7    2e-12   
ref|XP_004967591.1|  PREDICTED: shaggy-related protein kinase alp...  75.1    2e-12   
gb|KDO39706.1|  hypothetical protein CISIN_1g014595mg                 74.7    2e-12   
ref|XP_006431595.1|  hypothetical protein CICLE_v10001277mg           74.7    2e-12   
ref|XP_006588498.1|  PREDICTED: uncharacterized protein LOC100817...  74.3    3e-12   
ref|XP_008366455.1|  PREDICTED: shaggy-related protein kinase kap...  72.8    3e-12   
gb|KEH23337.1|  shaggy-like kinase                                    73.9    3e-12   
ref|XP_010657061.1|  PREDICTED: shaggy-related protein kinase eta...  74.3    3e-12   
gb|ADE76936.1|  unknown                                               74.3    3e-12   
ref|XP_010910153.1|  PREDICTED: shaggy-related protein kinase kap...  74.3    3e-12   
emb|CBI22011.3|  unnamed protein product                              73.6    3e-12   
gb|ABD97992.1|  glycogen synthase kinase                              73.6    3e-12   
gb|KJB16216.1|  hypothetical protein B456_002G218100                  73.2    4e-12   
ref|XP_010671741.1|  PREDICTED: shaggy-related protein kinase the...  73.9    4e-12   
gb|ABC94948.1|  GSK-like kinase                                       73.9    4e-12   
ref|XP_004300628.1|  PREDICTED: shaggy-related protein kinase kappa   73.9    4e-12   
ref|XP_009131508.1|  PREDICTED: shaggy-related protein kinase eps...  73.2    4e-12   
ref|NP_974471.1|  shaggy-related protein kinase beta                  73.9    4e-12   
ref|XP_007041206.1|  Shaggy-like protein kinase 41 isoform 3          73.2    4e-12   
ref|XP_003567575.1|  PREDICTED: shaggy-related protein kinase alp...  73.9    5e-12   
ref|XP_011028359.1|  PREDICTED: shaggy-related protein kinase kappa   73.9    5e-12   
ref|NP_001241073.1|  uncharacterized protein LOC100799387             73.6    5e-12   
ref|XP_006402514.1|  hypothetical protein EUTSA_v10005969mg           73.9    5e-12   
gb|AAM77397.1|  GSK-like kinase                                       73.6    5e-12   
gb|KFK35315.1|  hypothetical protein AALP_AA5G268300                  73.9    5e-12   
ref|XP_010652295.1|  PREDICTED: shaggy-related protein kinase alp...  73.6    6e-12   
gb|ACJ85100.1|  unknown                                               71.6    6e-12   
emb|CDY68803.1|  BnaC04g54370D                                        69.3    6e-12   
gb|KDO86866.1|  hypothetical protein CISIN_1g015632mg                 73.2    6e-12   
ref|XP_006385048.1|  hypothetical protein POPTR_0004s23430g           73.2    7e-12   
gb|KJB16218.1|  hypothetical protein B456_002G218100                  72.8    7e-12   
gb|KDP42457.1|  hypothetical protein JCGZ_00254                       73.2    7e-12   
gb|KCW84976.1|  hypothetical protein EUGRSUZ_B01797                   72.8    7e-12   
ref|XP_010682019.1|  PREDICTED: shaggy-related protein kinase kap...  73.2    8e-12   
gb|KJB16217.1|  hypothetical protein B456_002G218100                  72.8    9e-12   
ref|XP_008802919.1|  PREDICTED: shaggy-related protein kinase kap...  73.2    9e-12   
ref|XP_010096433.1|  Shaggy-related protein kinase kappa              73.2    9e-12   
ref|XP_008802921.1|  PREDICTED: shaggy-related protein kinase kap...  72.8    1e-11   
ref|XP_007041204.1|  Shaggy-like protein kinase 41 isoform 1          72.8    1e-11   
gb|KJB16220.1|  hypothetical protein B456_002G218100                  72.4    1e-11   
dbj|BAJ89558.1|  predicted protein                                    72.8    1e-11   
ref|NP_001242506.1|  uncharacterized protein LOC100817819             72.4    1e-11   
gb|KJB47882.1|  hypothetical protein B456_008G045800                  72.0    1e-11   
ref|XP_007222549.1|  hypothetical protein PRUPE_ppa006218mg           72.4    1e-11   
gb|KHF99018.1|  Shaggy-related protein kinase delta                   72.8    1e-11   
gb|KJB16215.1|  hypothetical protein B456_002G218100                  72.4    1e-11   
gb|KHF99017.1|  Shaggy-related protein kinase delta                   72.8    1e-11   
ref|XP_003591341.1|  Glycogen synthase kinase-3-like protein          72.0    1e-11   
gb|EMS50777.1|  Glycogen synthase kinase-3-like protein MsK-3         72.4    1e-11   
gb|KCW57138.1|  hypothetical protein EUGRSUZ_I02776                   72.0    2e-11   
gb|KJB47880.1|  hypothetical protein B456_008G045800                  72.0    2e-11   
gb|KJB47881.1|  hypothetical protein B456_008G045800                  72.4    2e-11   
gb|KJB47877.1|  hypothetical protein B456_008G045800                  72.0    2e-11   
ref|XP_010030186.1|  PREDICTED: shaggy-related protein kinase kappa   72.0    2e-11   
ref|XP_004147888.1|  PREDICTED: shaggy-related protein kinase kap...  72.0    2e-11   
ref|XP_010414192.1|  PREDICTED: shaggy-related protein kinase zet...  72.0    2e-11   
ref|XP_010510261.1|  PREDICTED: shaggy-related protein kinase zeta    71.6    2e-11   
ref|XP_010469777.1|  PREDICTED: shaggy-related protein kinase zet...  71.6    2e-11   
ref|XP_004168206.1|  PREDICTED: uncharacterized protein LOC101227928  72.4    2e-11   
ref|XP_009355333.1|  PREDICTED: shaggy-related protein kinase kappa   71.6    2e-11   
gb|EMT00762.1|  Glycogen synthase kinase-3-MsK-3-like protein         71.2    3e-11   
ref|XP_006307671.1|  hypothetical protein CARUB_v10009298mg           70.9    5e-11   
emb|CDY65303.1|  BnaCnng46510D                                        70.9    5e-11   
gb|ACJ85155.1|  unknown                                               67.8    6e-11   
ref|XP_006392357.1|  hypothetical protein EUTSA_v10023486mg           70.5    6e-11   
ref|XP_009396814.1|  PREDICTED: shaggy-related protein kinase kap...  70.5    6e-11   
gb|KFK31745.1|  hypothetical protein AALP_AA6G153600                  70.1    7e-11   



>emb|CDP08875.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 124/152 (82%), Gaps = 3/152 (2%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGRSSVSDP  GDS IKRVK+ Q+ D R+  + ES E CTTA     AS
Sbjct  1    MNVMRRLKSIASGRSSVSDP-SGDSGIKRVKIEQEADWRVGLESESVEKCTTASEQNMAS  59

Query  322  TSQEDASGIS-LVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGTET  495
            TS E A+  S +VAR  KSGY+ELP+EMH+MKI+DDKSD +++ +KD+EP +++GNGTET
Sbjct  60   TSAEPAASTSKVVARPVKSGYDELPREMHDMKIRDDKSDTHEDTMKDLEPAIVSGNGTET  119

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            GQIIVTT GGRNGE+KQ LSYMAERVVGTGSF
Sbjct  120  GQIIVTTAGGRNGEEKQTLSYMAERVVGTGSF  151



>dbj|BAO02525.1| predicted Shaggy-like kinase ortholog, partial [Nicotiana alata]
Length=415

 Score =   196 bits (498),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 129/157 (82%), Gaps = 5/157 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTT-APMHEAA  318
            MNVMRRLKS+ASGRSSVSDP GGDSSIKRVKV Q+ DQR+ G+ + EE CTT  P  + A
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSIKRVKVEQEVDQRVVGETQMEERCTTTVPKEDMA  59

Query  319  STSQEDASGIS--LVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGT  489
            STS+   +G +  +  R E S ++ELPKEMHEMKIKD+K+D +++NLKDMEP V++GNGT
Sbjct  60   STSKGTTTGSTSTMDTRPENSEFDELPKEMHEMKIKDEKADSHEDNLKDMEPAVVSGNGT  119

Query  490  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            ETGQIIVTTV GRNG+QKQ LSYMAERVVGTGSF +V
Sbjct  120  ETGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGTV  156



>ref|XP_006339456.1| PREDICTED: shaggy-related protein kinase theta-like [Solanum 
tuberosum]
Length=475

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 125/161 (78%), Gaps = 9/161 (6%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTT--APMHEA  315
            MNVMRRLKS+ASGRSSVSDP GGDSSIKRVKV ++ DQR+ G+ + EE CTT   P  + 
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSIKRVKVEKEVDQRVVGETQMEERCTTTTVPKEDM  59

Query  316  ASTSQEDA--SGISLVARSEKSGYEELPKEMHEMKIKDDKSDN----QNNLKDMEPVVIT  477
            ASTS+E    S  ++  R E S  +ELPKEMHEMKIKD+K+D     ++NLKDMEP V++
Sbjct  60   ASTSKETTARSTSAMDTRPENSELDELPKEMHEMKIKDEKADKADSLEDNLKDMEPAVVS  119

Query  478  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GNGTETGQIIVTTV GRNG +KQ LSYMAERVVGTGSF  V
Sbjct  120  GNGTETGQIIVTTVSGRNGLEKQTLSYMAERVVGTGSFGVV  160



>ref|XP_009602858.1| PREDICTED: shaggy-related protein kinase epsilon [Nicotiana tomentosiformis]
 emb|CAA69899.1| NSK6 [Nicotiana tabacum]
Length=471

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 129/157 (82%), Gaps = 5/157 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTT-APMHEAA  318
            MNVMRRLKS+ASGRSSVSDP GGDSSIKRVKV Q+ DQR+ G+ + EE CTT  P  + A
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSIKRVKVEQEVDQRVVGETQMEERCTTIVPKEDMA  59

Query  319  STSQEDASGIS--LVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGT  489
            STS+   +G +  +  R E S ++ELPKEMHEMKIKD+K+D +++NLKDMEP V++GNGT
Sbjct  60   STSKGTTTGSTSTMDTRPENSEFDELPKEMHEMKIKDEKADSHEDNLKDMEPAVVSGNGT  119

Query  490  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            ETGQIIVTTV GRNG+QKQ LSYMAERVVGTGSF +V
Sbjct  120  ETGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGTV  156



>ref|XP_004229833.1| PREDICTED: shaggy-related protein kinase epsilon [Solanum lycopersicum]
Length=475

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 124/161 (77%), Gaps = 9/161 (6%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTT--APMHEA  315
            MNVMRRLKS+ASGRSSVSDP GGDSSIKRVKV ++ DQR+ G+ + EE CTT   P  + 
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSIKRVKVEKEVDQRVVGETQMEEGCTTTTVPKEDM  59

Query  316  ASTSQEDASGIS--LVARSEKSGYEELPKEMHEMKIKDDKSDN----QNNLKDMEPVVIT  477
            ASTS E  +G +  +  R E S  +ELPKEMHEMKIKD+K D      +NLKDMEP V++
Sbjct  60   ASTSMETTAGSTSTMDIRLENSELDELPKEMHEMKIKDEKDDKADSLDDNLKDMEPAVVS  119

Query  478  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GNGTETGQIIVTTV GRNG++KQ LSYMAERVVGTGSF  V
Sbjct  120  GNGTETGQIIVTTVSGRNGQEKQTLSYMAERVVGTGSFGVV  160



>gb|AAT81407.1| shaggy-related protein kinase 6 [Solanum peruvianum]
Length=475

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 127/161 (79%), Gaps = 9/161 (6%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTT--APMHEA  315
            MNVMRRLKS+ASGRSSVSDP GGDSSIKRVKV ++ DQR+ G+ + EE CTT   P  + 
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSIKRVKVEKEVDQRVVGETQMEEGCTTTTVPKEDM  59

Query  316  ASTSQEDASGIS--LVARSEKSGYEELPKEMHEMKIK---DDKSDN-QNNLKDMEPVVIT  477
            ASTS+E  +G +  +  R E S  +ELPKEMHEMKIK   DDK+D+  +NLKDMEP V++
Sbjct  60   ASTSKETTAGSTSTMDTRLENSELDELPKEMHEMKIKGEKDDKADSLDDNLKDMEPAVVS  119

Query  478  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GNGTETGQIIVTTV GRNG++KQ LSYMAERVVGTGSF  V
Sbjct  120  GNGTETGQIIVTTVSGRNGQEKQTLSYMAERVVGTGSFGVV  160



>ref|XP_009790920.1| PREDICTED: shaggy-related protein kinase epsilon-like [Nicotiana 
sylvestris]
Length=471

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 124/157 (79%), Gaps = 5/157 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHE---  312
            MNVMRRLKS+ASGRSSVSDP GGDSSIKRVKV Q+ DQR+ G+ + EE CTT    E   
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSIKRVKVEQEVDQRLVGETQMEERCTTTFPKEDMP  59

Query  313  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGT  489
            + S      S  ++  R E S ++ELPKEMHEMKIKD+K+D +++NLKDMEP V++GNGT
Sbjct  60   STSKGTTTGSTSTMDTRPENSEFDELPKEMHEMKIKDEKTDSHEDNLKDMEPAVVSGNGT  119

Query  490  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            ETGQIIVTTV GRNG+QKQ LSYMAERVVGTGSF +V
Sbjct  120  ETGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGTV  156



>emb|CAA11860.1| shaggy-like kinase 91 [Nicotiana tabacum]
Length=471

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 124/157 (79%), Gaps = 5/157 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHE---  312
            MNVMRRLKS+ASGRSSVSDP GGDSSIKRVKV Q+ DQR+ G+ + EE CTT    E   
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSIKRVKVEQEVDQRLVGETQMEERCTTTFPKEDMP  59

Query  313  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGT  489
            + S      S  ++  R E S ++ELPKEMHEMKIKD+K+D +++NLKDMEP V++GNGT
Sbjct  60   STSKGTTTGSTSTMDTRPENSEFDELPKEMHEMKIKDEKTDSHEDNLKDMEPAVVSGNGT  119

Query  490  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            ETGQIIVTTV GRNG+QKQ LSYMAERVVGTGSF +V
Sbjct  120  ETGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSFGTV  156



>ref|XP_009773710.1| PREDICTED: shaggy-related protein kinase epsilon-like [Nicotiana 
sylvestris]
Length=469

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 128/155 (83%), Gaps = 3/155 (2%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEA-A  318
            MNVMRRLKS+ASGRSSVSDP GGD S+KRVKV Q+ D R+ G+ +SEE CT AP  +  +
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDFSLKRVKVEQEVDHRVDGETQSEEQCTIAPKQDVIS  59

Query  319  STSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGTET  495
            ++S+   + +++  R EKSGYEELPKEM+EMKI+DDK++  ++++KDMEP V++GNGTET
Sbjct  60   TSSESTTTTLNVDTRPEKSGYEELPKEMNEMKIRDDKTNGREDDIKDMEPAVVSGNGTET  119

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GQIIVTT+ GRNG+QK+ LSYMAERVVGTGSF  V
Sbjct  120  GQIIVTTLSGRNGQQKKTLSYMAERVVGTGSFGVV  154



>emb|CAA05329.1| shaggy-like kinase 59 [Nicotiana tabacum]
Length=469

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 127/155 (82%), Gaps = 3/155 (2%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGRSSVSDP GGD S+KRVKV Q+ D R+ G+ +SEE CT AP  +  S
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDFSLKRVKVEQEVDHRVDGETQSEEQCTIAPKQDVTS  59

Query  322  TSQEDASG-ISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGTET  495
            TS E  +  +++  R EKSGYEELPKEM+EMKI+DDK++  ++++KDMEP V++GNGTET
Sbjct  60   TSSESTTTTLNVDTRPEKSGYEELPKEMNEMKIRDDKTNGREDDIKDMEPAVVSGNGTET  119

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GQIIVTT+ GRNG+QK+ LSYMAERVVGTGSF  V
Sbjct  120  GQIIVTTLSGRNGQQKKTLSYMAERVVGTGSFGVV  154



>emb|CAA05328.1| shaggy-like kinase 111 [Nicotiana tabacum]
Length=469

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 123/152 (81%), Gaps = 3/152 (2%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGRSSVSDP GGD S+K+V V Q+ D R+ G+ + EE CT AP  +  S
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDFSLKKVTVEQEVDHRVDGETQLEEQCTIAPKQDVTS  59

Query  322  TSQED-ASGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGTET  495
            TS+E     +++  R EKS YEELPKEM+EMKI+D+K++ +++++KDMEP V++GNGTET
Sbjct  60   TSEESTVCTLNVDTRPEKSRYEELPKEMNEMKIRDEKTNGHEDDIKDMEPAVVSGNGTET  119

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            GQIIVTT+ GRNG QK+ LSYMAERVVGTGSF
Sbjct  120  GQIIVTTLSGRNGRQKKTLSYMAERVVGTGSF  151



>ref|XP_009610982.1| PREDICTED: shaggy-related protein kinase epsilon-like [Nicotiana 
tomentosiformis]
Length=469

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 123/152 (81%), Gaps = 3/152 (2%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGRSSVSDP GGD S+K+V V Q+ D R+ G+ + EE CT AP  +  S
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDFSLKKVTVEQEVDHRVDGETQLEEQCTIAPKQDVTS  59

Query  322  TSQED-ASGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGTET  495
            TS+E     +++  R EKS YEELPKEM+EMKI+D+K++ +++++KDMEP V++GNGTET
Sbjct  60   TSEESTVCTLNVDTRPEKSRYEELPKEMNEMKIRDEKTNGHEDDIKDMEPAVVSGNGTET  119

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            GQIIVTT+ GRNG QK+ LSYMAERVVGTGSF
Sbjct  120  GQIIVTTLSGRNGRQKKTLSYMAERVVGTGSF  151



>emb|CAA11861.1| shaggy kinase 6 [Petunia x hybrida]
Length=470

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 124/154 (81%), Gaps = 6/154 (4%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTT-APMHEAA  318
            MNVMRRLKS+ SGRSS+SDP GGDSSIKRVKV Q+  +R+ G  + ++ CTT AP  + A
Sbjct  1    MNVMRRLKSITSGRSSISDP-GGDSSIKRVKVEQEI-ERVVGDTQMDDRCTTTAPKEDMA  58

Query  319  STSQED--ASGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNGT  489
            STS++   AS  ++  R E S  +ELPKE+HEMKIKD+++D +++NLKDMEP V++GNG 
Sbjct  59   STSKDTTTASTSTMDTRPENSEVDELPKELHEMKIKDERTDSHEDNLKDMEPAVVSGNGA  118

Query  490  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            ETGQIIVTTV GRNG+QKQ LSYMAERVVGTGSF
Sbjct  119  ETGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSF  152



>ref|XP_011093165.1| PREDICTED: shaggy-related protein kinase alpha [Sesamum indicum]
Length=469

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 115/152 (76%), Gaps = 3/152 (2%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MN+MRRLKS+ASGRSSVSDP G DSSIKRVKV Q+ D R +   E+ E C  AP     S
Sbjct  1    MNMMRRLKSIASGRSSVSDPVG-DSSIKRVKVEQELDHRDSCDVETGENCLQAPEQHMES  59

Query  322  TSQEDASGISLV-ARSEKSGYEELPKEMHEMKIKDDKSDNQN-NLKDMEPVVITGNGTET  495
             S E  +  S V  + EKSGY+ELPKEMHEMKI+DDK+DN   N+KDME  +++GNGTE 
Sbjct  60   NSLEAVASTSNVHGKPEKSGYDELPKEMHEMKIRDDKTDNHEANVKDMESTIVSGNGTEA  119

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            GQIIVT++GG NG+ KQ +SYMAERVVGTGSF
Sbjct  120  GQIIVTSIGGHNGQPKQTMSYMAERVVGTGSF  151



>ref|XP_002272112.1| PREDICTED: shaggy-related protein kinase theta [Vitis vinifera]
 emb|CBI38764.3| unnamed protein product [Vitis vinifera]
Length=468

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 122/153 (80%), Gaps = 6/153 (4%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGRSSVSDP GGDSS KR KV Q+ +Q++A +  S E  T+   H  AS
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSTKRAKVDQEAEQKVADETHSVEKSTSLEQH-MAS  58

Query  322  TSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TSQE A   S +S +AR+E+SGY++LPKEMH+MKI+D+K D  ++ KD EP V++G+GTE
Sbjct  59   TSQETAASTSNVSSIARTEQSGYDQLPKEMHDMKIRDEKVDPHDD-KDAEPTVVSGSGTE  117

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TGQII TT+GGRNG+ KQ +SYMAERVVGTGSF
Sbjct  118  TGQIIATTIGGRNGQPKQTVSYMAERVVGTGSF  150



>ref|XP_006375323.1| hypothetical protein POPTR_0014s07120g [Populus trichocarpa]
 gb|ERP53120.1| hypothetical protein POPTR_0014s07120g [Populus trichocarpa]
Length=391

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 116/153 (76%), Gaps = 4/153 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGD+  KR KV Q+ +Q+I G+    E   T      AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDAVTKRAKVDQEMEQKIDGESYLVERSVTEQEQHMAS  60

Query  322  TSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TSQE+A   S ++ V R+EK GY++LPKEMHEMKI+DDK+ N +  KDME  +++GNGTE
Sbjct  61   TSQENAASASNVTSVTRTEKPGYDQLPKEMHEMKIRDDKNTNHDE-KDMEAAIVSGNGTE  119

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TGQII TTVGGRNG+ KQ++SYMAERVVGTGSF
Sbjct  120  TGQIIATTVGGRNGQPKQIISYMAERVVGTGSF  152



>ref|XP_002320754.2| hypothetical protein POPTR_0014s07120g [Populus trichocarpa]
 gb|EEE99069.2| hypothetical protein POPTR_0014s07120g [Populus trichocarpa]
Length=473

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 117/156 (75%), Gaps = 4/156 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGD+  KR KV Q+ +Q+I G+    E   T      AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDAVTKRAKVDQEMEQKIDGESYLVERSVTEQEQHMAS  60

Query  322  TSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TSQE+A   S ++ V R+EK GY++LPKEMHEMKI+DDK+ N +  KDME  +++GNGTE
Sbjct  61   TSQENAASASNVTSVTRTEKPGYDQLPKEMHEMKIRDDKNTNHDE-KDMEAAIVSGNGTE  119

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TGQII TTVGGRNG+ KQ++SYMAERVVGTGSF  V
Sbjct  120  TGQIIATTVGGRNGQPKQIISYMAERVVGTGSFGVV  155



>ref|XP_011035087.1| PREDICTED: shaggy-related protein kinase theta [Populus euphratica]
Length=473

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 117/156 (75%), Gaps = 4/156 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGD+  KR KV Q+ + +I G+    E   T      AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDAVTKRAKVDQEMEPKIDGESYLVERSVTDQEQHMAS  60

Query  322  TSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TSQE+A   S ++ V R+EKSGY++LPKEMHEMKI+DDK+ N +  KDME  +++GNGTE
Sbjct  61   TSQENAASASNVTSVTRTEKSGYDQLPKEMHEMKIRDDKNTNHDE-KDMEAAIVSGNGTE  119

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TGQII TTVGGRNG+ KQ++SYMAERVVGTGSF  V
Sbjct  120  TGQIIATTVGGRNGQPKQIISYMAERVVGTGSFGVV  155



>ref|XP_006345509.1| PREDICTED: shaggy-related protein kinase theta-like [Solanum 
tuberosum]
Length=465

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 120/155 (77%), Gaps = 7/155 (5%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGRSSVSDP GGD S+KR+K+ Q  D R+  + + EE CT AP  +  S
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDISLKRLKIEQKVDHRVDIEIQMEERCTIAPKDDVTS  59

Query  322  TSQ-EDASGISLVARSEKSGYEELPKEMHEMKIKDDKS-DNQNNLKDMEPVVITGNGTET  495
            TS+  DAS +++  R EKSG +ELP   +EM+I++  S D++++LKDMEP V++GNGTET
Sbjct  60   TSEGSDASTLTVDTRQEKSGKKELP---NEMRIREKNSYDHEDDLKDMEPTVVSGNGTET  116

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GQIIVTT+ GRNG QKQ LSYMAERVVGTGSF  V
Sbjct  117  GQIIVTTLSGRNG-QKQTLSYMAERVVGTGSFGVV  150



>ref|XP_011091732.1| PREDICTED: shaggy-related protein kinase alpha-like [Sesamum 
indicum]
Length=460

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 116/155 (75%), Gaps = 12/155 (8%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPM-HEAA  318
            MN+MRRLKS+ASGRSSVSDP GGDSSIKRVKV Q+ DQ++  + ++ E C   P+ H  A
Sbjct  1    MNMMRRLKSIASGRSSVSDP-GGDSSIKRVKVEQEIDQKVDCEVDTGEKCVRVPVVHMEA  59

Query  319  STSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNL-KDMEPVVITGNGTET  495
                      S+ A +  S    LPKEMHEMKI++DK+D+ +++ KDMEP V++GNGTET
Sbjct  60   K---------SMGAVASTSDVHVLPKEMHEMKIREDKTDDHDDIGKDMEPTVVSGNGTET  110

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GQIIVT++GGRNG+ KQ +SYMAERVVGTGSF  V
Sbjct  111  GQIIVTSIGGRNGQPKQTMSYMAERVVGTGSFGVV  145



>gb|KDP28680.1| hypothetical protein JCGZ_14451 [Jatropha curcas]
Length=474

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 115/156 (74%), Gaps = 4/156 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGDS  KRVKV QD D +I G+   +E   T      AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDSLTKRVKVDQDTDHKIDGELIQDERSATGMEQHMAS  60

Query  322  TSQEDASGIS---LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TS E+A+  S    + R+EKSGY++LPKEM EMKI+D+K+ N +  KDME  +++GNGTE
Sbjct  61   TSLENAASTSDATSMTRTEKSGYDQLPKEMREMKIRDEKNANHDE-KDMEAAIVSGNGTE  119

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TGQII TTVGGRNG+ KQ +S+MAERVVGTGSF  V
Sbjct  120  TGQIIATTVGGRNGKPKQTISFMAERVVGTGSFGVV  155



>gb|AFK41443.1| unknown [Medicago truncatula]
Length=195

 Score =   162 bits (410),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 112/161 (70%), Gaps = 14/161 (9%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEIC--------TT  297
            MN+MRRLKS+ASGR+SVS   GGDS+ KR K    FD    GK E+EE            
Sbjct  1    MNMMRRLKSIASGRTSVSSDPGGDSTTKRAK----FDLETEGK-ENEETNRGERGGNNQD  55

Query  298  APMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVIT  477
              +     TS    S +S VA++EKSG+++LPKE+HEMKIKDDKS N NN KDME  V+ 
Sbjct  56   KYVDAVEETSSSCNSNVSAVAKTEKSGFDQLPKELHEMKIKDDKSKN-NNEKDMEATVVN  114

Query  478  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GNGTETGQII T++GGR+G+ K+++SYMAERVVGTGSF  V
Sbjct  115  GNGTETGQIITTSIGGRDGQPKRIISYMAERVVGTGSFGVV  155



>ref|XP_010255498.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Nelumbo 
nucifera]
Length=469

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 113/156 (72%), Gaps = 5/156 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            M+VMRRLKS+ASGRSSVSDP GGDS  KR KV Q+ +Q    +    E  +       AS
Sbjct  1    MHVMRRLKSIASGRSSVSDP-GGDSGSKRAKVDQEMEQNATNETHLMEKTSIGLEQHVAS  59

Query  322  TSQE---DASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TS E     S IS+ +++EKSGY++LPKEMHEMKI+DDK++N ++ KD E  ++ GNGTE
Sbjct  60   TSIETDVSTSNISITSKTEKSGYDQLPKEMHEMKIRDDKTENHDD-KDAEATIVNGNGTE  118

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
             GQII TT+GGRNG+ KQ +SYMAERVVGTGSF  V
Sbjct  119  AGQIIATTIGGRNGQPKQTISYMAERVVGTGSFGVV  154



>ref|XP_010278583.1| PREDICTED: shaggy-related protein kinase epsilon-like [Nelumbo 
nucifera]
Length=469

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 119/156 (76%), Gaps = 5/156 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            M+VMRRLKS+ASGRSS+SDP GGDS  KR KV Q+ +Q + G+ +S E  T       +S
Sbjct  1    MHVMRRLKSIASGRSSISDP-GGDSGSKRAKVDQETEQNVTGETQSVEKTTVGLEQHISS  59

Query  322  TSQE-DASG--ISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
             S E DAS   IS  +++EKSG+++LPKEMHEMKI+DDK+++ ++ KDME  VI GNGTE
Sbjct  60   ASLEADASTSTISSNSKTEKSGFDQLPKEMHEMKIRDDKTESHDD-KDMEAAVINGNGTE  118

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TGQII TT+GG+NG+ KQ +SYMAERVVGTGSF  V
Sbjct  119  TGQIISTTIGGKNGQPKQTISYMAERVVGTGSFGVV  154



>ref|XP_004240041.1| PREDICTED: shaggy-related protein kinase epsilon [Solanum lycopersicum]
Length=466

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 117/152 (77%), Gaps = 6/152 (4%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGRSS+SDP G D S+KR+K  Q+ D R+  + + EE CT A   +  S
Sbjct  1    MNVMRRLKSIASGRSSISDP-GVDISLKRLKNEQEVDHRVDIEFQMEERCTIASKDDVTS  59

Query  322  TSQ-EDASGISLVARSEKSGYEELPKEMHEMKIKDDKS-DNQNNLKDMEPVVITGNGTET  495
            TS+  DAS +++  R EKSG EELP   +EM+I++  S D++++LKDMEP V++GNGTET
Sbjct  60   TSEGSDASTLTVDTRQEKSGKEELP---NEMRIREKSSYDHEDDLKDMEPTVVSGNGTET  116

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            GQIIVTT+  RNG++KQ LSYMAERVVGTGSF
Sbjct  117  GQIIVTTLSDRNGQKKQTLSYMAERVVGTGSF  148



>gb|KDO86034.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=272

 Score =   161 bits (407),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 6/156 (4%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGDS IKR KV ++ +  + G+    E   ++     AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDSGIKRAKVDKELE--VNGEANLVERSASSLEQHMAS  58

Query  322  TSQEDASGIS---LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TS E  +  S    VAR+E+SG+++LPKEM+EM+I+D+K+ N ++ KD+EP ++ GNGTE
Sbjct  59   TSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDD-KDLEPSIVNGNGTE  117

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
             GQ+I TTVGGRNG+ KQ +SYMAERVVGTGSF  V
Sbjct  118  AGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVV  153



>ref|XP_002511803.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF50472.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=474

 Score =   166 bits (419),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 115/156 (74%), Gaps = 4/156 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MN+MRRLKS+ASGR+S+S   GGDS  KRVKV Q+ +Q+I G+  S+E   T      AS
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSLTKRVKVDQETEQKIDGEVYSDERNATGLEQHMAS  60

Query  322  TSQEDASGIS---LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TS E+ +  S    V ++EKSG+++LPKEMHEM+IKDDK+ + +  KDME  +++G GTE
Sbjct  61   TSLENPASTSNSASVVKTEKSGFDQLPKEMHEMRIKDDKTTSHDE-KDMEAAIVSGTGTE  119

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TG II TT+GGRNG+ KQ +S+MAERVVGTGSF  V
Sbjct  120  TGHIIATTLGGRNGQPKQTISFMAERVVGTGSFGVV  155



>ref|XP_011023409.1| PREDICTED: shaggy-related protein kinase theta-like isoform X2 
[Populus euphratica]
Length=419

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 114/153 (75%), Gaps = 4/153 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGD   KR KV Q+ ++++  +    E   T      AS
Sbjct  1    MNVMRRLKSMASGRTSISSDPGGDVGTKRAKVDQEIERKVDQESYLVERSVTDQEQHMAS  60

Query  322  TSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TSQE+A   S I+ VAR+EKSGY++LPKEMH+MKI+D+K+   +  K++E V+++GNGTE
Sbjct  61   TSQENAASTSNITSVARTEKSGYDQLPKEMHQMKIRDEKTTFHDE-KEVEAVIVSGNGTE  119

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TGQII TTVGGRNG+ KQ +SYMAE +VGTGSF
Sbjct  120  TGQIIATTVGGRNGQPKQTISYMAEHMVGTGSF  152



>gb|ACU14009.1| unknown [Glycine max]
Length=156

 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 111/156 (71%), Gaps = 4/156 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAP---MHE  312
            MN+MRRLKS+ASGR+S+S   GGD++ KR K   + + +   K  + E   T     +  
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDNNSKRAKFEPETEVKADEKTNTTETIYTDQEQLIDT  60

Query  313  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            +  TS    S +S VAR+EKSG+EELPKE++EMKI+D+KS N N+ KD+E  V++GNGTE
Sbjct  61   SKETSNVGTSDVSTVARTEKSGFEELPKELNEMKIRDEKSKN-NSEKDIEATVVSGNGTE  119

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TGQII T +GGR+G+ KQ +SYMAERVVGTGSF  V
Sbjct  120  TGQIITTAIGGRDGQPKQTISYMAERVVGTGSFGIV  155



>ref|XP_011023410.1| PREDICTED: shaggy-related protein kinase theta-like isoform X3 
[Populus euphratica]
Length=468

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 115/156 (74%), Gaps = 4/156 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGD   KR KV Q+ ++++  +    E   T      AS
Sbjct  1    MNVMRRLKSMASGRTSISSDPGGDVGTKRAKVDQEIERKVDQESYLVERSVTDQEQHMAS  60

Query  322  TSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TSQE+A   S I+ VAR+EKSGY++LPKEMH+MKI+D+K+   +  K++E V+++GNGTE
Sbjct  61   TSQENAASTSNITSVARTEKSGYDQLPKEMHQMKIRDEKTTFHDE-KEVEAVIVSGNGTE  119

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TGQII TTVGGRNG+ KQ +SYMAE +VGTGSF  V
Sbjct  120  TGQIIATTVGGRNGQPKQTISYMAEHMVGTGSFGVV  155



>ref|XP_007051908.1| Shaggy-like protein kinase 32 isoform 1 [Theobroma cacao]
 gb|EOX96065.1| Shaggy-like protein kinase 32 isoform 1 [Theobroma cacao]
Length=532

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 117/176 (66%), Gaps = 8/176 (5%)
 Frame = +1

Query  94   GRFSWLKGREKGA----SENMNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRI  261
            G F  L+ ++ G     S+ MNVMRRLKS+ASGRSS+S   GGDS  KR KV Q  + ++
Sbjct  43   GEFRRLRSKKSGLGSVKSKTMNVMRRLKSIASGRSSISSDPGGDSGTKRAKVDQQAECKV  102

Query  262  AGKPESEEICTTAPMHEAASTSQE---DASGISLVARSEKSGYEELPKEMHEMKIKDDKS  432
              +    E  TT      ASTS E     S ++ VAR EKSG ++LP EMHEM+I+D+K+
Sbjct  103  HEESNLVERSTTGLEQHMASTSLETVASTSNVTSVARMEKSGVDQLPNEMHEMRIRDEKT  162

Query  433  DNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
             N +  KD+E  VI GNGTETGQII T VGGRNG+ KQ +SYMAERVVGTGSF  V
Sbjct  163  ANHDE-KDVEATVINGNGTETGQIISTVVGGRNGQPKQTISYMAERVVGTGSFGVV  217



>gb|KDO86033.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=349

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 6/156 (4%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGDS IKR KV ++ +  + G+    E   ++     AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDSGIKRAKVDKELE--VNGEANLVERSASSLEQHMAS  58

Query  322  TSQEDASGIS---LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TS E  +  S    VAR+E+SG+++LPKEM+EM+I+D+K+ N ++ KD+EP ++ GNGTE
Sbjct  59   TSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDD-KDLEPSIVNGNGTE  117

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
             GQ+I TTVGGRNG+ KQ +SYMAERVVGTGSF  V
Sbjct  118  AGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVV  153



>ref|XP_003528879.1| PREDICTED: shaggy-related protein kinase theta-like [Glycine 
max]
 gb|KHN04626.1| Shaggy-related protein kinase theta [Glycine soja]
Length=470

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 114/160 (71%), Gaps = 12/160 (8%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPES-----EEICTTA--  300
            MN+MRRLKS+ASGR+S+S   GGDS+ KR K    F+    GK +      E ICT    
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSNSKRAK----FEPETEGKADEKTNTIETICTDQEQ  56

Query  301  PMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  480
            P+  +  TS    S +S VAR+EKSG++ELPKE++EMKI+D+KS N NN KD+E  V++G
Sbjct  57   PIDTSKETSNVGTSDVSTVARTEKSGFDELPKELNEMKIRDEKSKN-NNEKDIEATVVSG  115

Query  481  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            NGTETGQII T +GGR+G+ KQ +SYMAERVVGTGSF  V
Sbjct  116  NGTETGQIITTAIGGRDGQPKQTISYMAERVVGTGSFGVV  155



>emb|CAA11862.1| shaggy kinase 7 [Petunia x hybrida]
Length=459

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 113/152 (74%), Gaps = 9/152 (6%)
 Frame = +1

Query  148  VMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAASTS  327
            +MRR+KS+ASGRSSVSDP GGD ++KR KV QD D  + G+ +SEE C+ A   + +S S
Sbjct  1    MMRRIKSIASGRSSVSDP-GGDLNLKRAKVEQDVDNMVDGETQSEERCSIANKQDVSSKS  59

Query  328  QEDASGISLVARSEKSGYEELPKEMHEMKIKDDKS-DNQNNLKDMEPVVITGNGTETGQI  504
            +   +    V         ELPKE++EMKI+D+KS D++++ KDMEP V++GNGTETGQI
Sbjct  60   KRSTASTLNVD-------NELPKELNEMKIRDEKSGDHEDDTKDMEPAVVSGNGTETGQI  112

Query  505  IVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            IVTT+ GRNG++KQ LSYMAERVVGTGSF  V
Sbjct  113  IVTTMSGRNGQKKQTLSYMAERVVGTGSFGVV  144



>gb|ACU17807.1| unknown [Glycine max]
Length=173

 Score =   153 bits (387),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 104/153 (68%), Gaps = 8/153 (5%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGD + KR K  QD + ++  +    E C     H   S
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDCTTKRAKFDQDTEGKVNEETYPNERCGKDQEHHVDS  60

Query  322  TSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQ  501
                    +  V R+EKSGY++LPKE++EMKI DDK  N NN KDME  +++GNGTETG+
Sbjct  61   N-------VPSVPRTEKSGYDQLPKELNEMKIGDDKGKN-NNEKDMEATIVSGNGTETGE  112

Query  502  IIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            II T +GGR+G+ K+ +SY+AERVVGTGSF  V
Sbjct  113  IITTAIGGRDGQPKRTISYIAERVVGTGSFGVV  145



>ref|XP_006445137.1| hypothetical protein CICLE_v10020026mg [Citrus clementina]
 ref|XP_006445138.1| hypothetical protein CICLE_v10020026mg [Citrus clementina]
 ref|XP_006491022.1| PREDICTED: shaggy-related protein kinase theta-like [Citrus sinensis]
 gb|ESR58377.1| hypothetical protein CICLE_v10020026mg [Citrus clementina]
 gb|ESR58378.1| hypothetical protein CICLE_v10020026mg [Citrus clementina]
 gb|KDO86032.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=468

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 6/156 (4%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGDS IKR KV ++ +  + G+    E   ++     AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDSGIKRAKVDKELE--VNGEANLVERSASSLEQHMAS  58

Query  322  TSQEDASGIS---LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TS E  +  S    VAR+E+SG+++LPKEM+EM+I+D+K+ N ++ KD+EP ++ GNGTE
Sbjct  59   TSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDD-KDLEPSIVNGNGTE  117

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
             GQ+I TTVGGRNG+ KQ +SYMAERVVGTGSF  V
Sbjct  118  AGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVV  153



>ref|XP_003623822.1| Shaggy-related protein kinase [Medicago truncatula]
 gb|AES80040.1| shaggy-like kinase [Medicago truncatula]
Length=470

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 112/161 (70%), Gaps = 14/161 (9%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEIC--------TT  297
            MN+MRRLKS+ASGR+SVS   GGDS+ KR K    FD    GK E+EE            
Sbjct  1    MNMMRRLKSIASGRTSVSSDPGGDSTTKRAK----FDLETEGK-ENEETNRGERGGNNQD  55

Query  298  APMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVIT  477
              +     TS    S +S VA++EKSG+++LPKE+HEMKIKDDKS N NN KDME  V+ 
Sbjct  56   KYVDAVEETSSSCNSNVSAVAKTEKSGFDQLPKELHEMKIKDDKSKN-NNEKDMEATVVN  114

Query  478  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GNGTETGQII T++GGR+G+ K+++SYMAERVVGTGSF  V
Sbjct  115  GNGTETGQIITTSIGGRDGQPKRIISYMAERVVGTGSFGVV  155



>gb|KDO86031.1| hypothetical protein CISIN_1g011138mg [Citrus sinensis]
Length=492

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 114/156 (73%), Gaps = 6/156 (4%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGDS IKR KV ++ +  + G+    E   ++     AS
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDSGIKRAKVDKELE--VNGEANLVERSASSLEQHMAS  58

Query  322  TSQEDASGIS---LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TS E  +  S    VAR+E+SG+++LPKEM+EM+I+D+K+ N ++ KD+EP ++ GNGTE
Sbjct  59   TSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDD-KDLEPSIVNGNGTE  117

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
             GQ+I TTVGGRNG+ KQ +SYMAERVVGTGSF  V
Sbjct  118  AGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVV  153



>dbj|BAD95891.1| Ser/Thr protein kinase [Lotus japonicus]
Length=467

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 116/160 (73%), Gaps = 15/160 (9%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRI-------AGKPESEEICTTA  300
            MN+MRRLKS+ASGR+S+S   GGDS+ KR K+ Q+ ++++        GK + + +    
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSNSKRAKLDQETEKKVNEETKTLGGKDQEQHV----  56

Query  301  PMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  480
               +A+  S    S +S VA++EKSG++ELPKE+HEMKIKD+KS N NN KD+E  +++G
Sbjct  57   ---DASKESTVGTSDVSTVAKTEKSGFDELPKELHEMKIKDEKSKN-NNEKDIEASIVSG  112

Query  481  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            NGTETGQII T +GGR+G+ KQ +SYMAERVVGTGSF  V
Sbjct  113  NGTETGQIITTAIGGRDGQPKQTISYMAERVVGTGSFGVV  152



>ref|XP_010671733.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=469

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 111/156 (71%), Gaps = 5/156 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+SDP GGD S KR KV Q+ +     +   +E CTT      AS
Sbjct  1    MNVMRRLKSIASGRTSISDP-GGDCSTKRAKVEQETEGSFTDESHPDERCTTEVEQHVAS  59

Query  322  TSQEDASG---ISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TS E  S    +S + R++K+ Y++LP EMH MKI+++K+D  ++ KDME   ++G+GTE
Sbjct  60   TSMEQISSTSDVSSIDRTQKADYDKLPTEMHGMKIQENKADKGDD-KDMEAAFVSGSGTE  118

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
             GQII TT+GGRNG+ KQ +SYMAERVVGTGSF  V
Sbjct  119  AGQIITTTMGGRNGQPKQTVSYMAERVVGTGSFGVV  154



>gb|EYU32069.1| hypothetical protein MIMGU_mgv1a006024mg [Erythranthe guttata]
Length=461

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 113/157 (72%), Gaps = 21/157 (13%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRI------AGKPESEEICTTAP  303
            MN+MRRLKS+ASGRSSVSDP GGDS +KRVKV Q+ D  +      AG+  + +   T P
Sbjct  1    MNMMRRLKSIASGRSSVSDP-GGDSDMKRVKVEQEIDHMVVCEVDNAGERYTRQ---TEP  56

Query  304  MHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQN-NLKDMEPVVITG  480
              E+ ST           A +  S  +ELPKEMHEMKI++DK+D+ + N K+MEP V++G
Sbjct  57   HFESDSTG----------AIASTSDVQELPKEMHEMKIREDKTDDSDENGKEMEPTVVSG  106

Query  481  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            +GTETGQIIVT++GGRNG+ KQ +SYMAERVVGTGSF
Sbjct  107  SGTETGQIIVTSIGGRNGQPKQTMSYMAERVVGTGSF  143



>ref|XP_003521276.1| PREDICTED: shaggy-related protein kinase theta [Glycine max]
Length=470

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 112/153 (73%), Gaps = 4/153 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEE-ICTTAP--MHE  312
            MN+MRRLKS+ASGR+S+S   GGDS+ KR K   + + +   K  + E ICT     +  
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSNSKRAKFEPETEVKADEKTNTTETICTDQEQLIDT  60

Query  313  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            +  TS    S +S VAR+EKSG+EELPKE++EMKI+D+KS N N+ KD+E  V++GNGTE
Sbjct  61   SKETSNVGTSDVSTVARTEKSGFEELPKELNEMKIRDEKSKN-NSEKDIEATVVSGNGTE  119

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TGQII T +GGR+G+ KQ +SYMAERVVGTGSF
Sbjct  120  TGQIITTAIGGRDGQPKQTISYMAERVVGTGSF  152



>ref|XP_007134960.1| hypothetical protein PHAVU_010G090200g [Phaseolus vulgaris]
 gb|ESW06954.1| hypothetical protein PHAVU_010G090200g [Phaseolus vulgaris]
Length=469

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 112/156 (72%), Gaps = 5/156 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTT---APMHE  312
            MN+MRRLKS+ASGR+S+S   GGDS+ KR K  Q+ + +   K    E  +T    P+ +
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSNSKRAKFEQETEVKAVEKTNIVEKVSTDQDQPV-D  59

Query  313  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            A   +    S +S  AR+EKSGY+ELPKE++EMKI+D+KS N NN KDME  V++GNGTE
Sbjct  60   ALKETTVGTSDVSTAARTEKSGYDELPKELNEMKIRDEKSKN-NNEKDMEATVVSGNGTE  118

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TGQII T +GGR+G+ KQ +SYMAERVVGTGSF  V
Sbjct  119  TGQIITTAIGGRDGQPKQTISYMAERVVGTGSFGVV  154



>gb|KHN27286.1| Shaggy-related protein kinase theta [Glycine soja]
Length=470

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 112/153 (73%), Gaps = 4/153 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEE-ICTTAP--MHE  312
            MN+MRRLKS+ASGR+S+S   GGD++ KR K   + + +   K  + E ICT     +  
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDNNSKRAKFEPETEVKADEKTNTTETICTDQEQLIDT  60

Query  313  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            +  TS    S +S VAR+EKSG+EELPKE++EMKI+D+KS N N+ KD+E  V++GNGTE
Sbjct  61   SKETSNVGTSDVSTVARTEKSGFEELPKELNEMKIRDEKSKN-NSEKDIEATVVSGNGTE  119

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TGQII T +GGR+G+ KQ +SYMAERVVGTGSF
Sbjct  120  TGQIITTAIGGRDGQPKQTISYMAERVVGTGSF  152



>ref|XP_008460173.1| PREDICTED: shaggy-related protein kinase theta [Cucumis melo]
Length=469

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 112/156 (72%), Gaps = 5/156 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MN+MRRLKS+ASGR+S+S   GGD  IKR KV  + ++++ G         +    ++AS
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDFGIKRAKVDLETERKVGGVSNDVGRGASGLELDSAS  60

Query  322  TSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            TS ++A   S IS +A +EKSG++ LP+EM EM+I+D+KS++    KD+EP V+ GNGTE
Sbjct  61   TSLDNAASTSNISSIAGAEKSGFDHLPREMREMRIRDEKSNHDE--KDLEPAVVNGNGTE  118

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
             GQII TTVGGRNG+ KQ +SYMAERVVGTGSF  V
Sbjct  119  AGQIIATTVGGRNGKPKQTISYMAERVVGTGSFGVV  154



>ref|XP_007139956.1| hypothetical protein PHAVU_008G072800g [Phaseolus vulgaris]
 gb|ESW11950.1| hypothetical protein PHAVU_008G072800g [Phaseolus vulgaris]
Length=466

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 108/153 (71%), Gaps = 2/153 (1%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MN+MRRLKS+ASGR+SVS   G D + KR K  Q  ++++  +  S E C         +
Sbjct  1    MNMMRRLKSIASGRTSVSSDPGSDFTTKRPKFDQGTEEKVNEETYSNEKCGKDQEQYGDA  60

Query  322  TSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQ  501
            +++ D S ++  ARSEKSGY++LPKE++EMKI DDK  N NN KDME  ++ GNGTETGQ
Sbjct  61   STESDHSNVA-TARSEKSGYDQLPKELNEMKIGDDKGKN-NNEKDMEATIVNGNGTETGQ  118

Query  502  IIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            II T +GGR+G+ K+ +SYMAERVVGTGSF  V
Sbjct  119  IITTAIGGRDGQPKRTISYMAERVVGTGSFGVV  151



>ref|XP_004168158.1| PREDICTED: shaggy-related protein kinase theta-like [Cucumis 
sativus]
Length=469

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 111/158 (70%), Gaps = 9/158 (6%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MN+MRRLKS+ASGR+S+S   GGD  IKR KV Q+ +Q++ G   S+++   A      S
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDFGIKRAKVDQETEQKVGGV--SDDVGRAASGLGLDS  58

Query  322  TSQE-----DASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  486
            +S         S IS +A +EKSG++ LP+EM EM+IKD+KS++    KD+EP V+ GNG
Sbjct  59   SSSSLDNVASTSNISSIAGAEKSGFDHLPREMREMRIKDEKSNHDE--KDLEPAVVNGNG  116

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TE GQII TTVGGRNG+ KQ +SYMAERVVGTGSF  V
Sbjct  117  TEAGQIIATTVGGRNGKPKQTISYMAERVVGTGSFGVV  154



>ref|XP_004144981.1| PREDICTED: shaggy-related protein kinase theta-like [Cucumis 
sativus]
 ref|XP_004153803.1| PREDICTED: shaggy-related protein kinase theta-like [Cucumis 
sativus]
 gb|KGN46198.1| hypothetical protein Csa_6G074020 [Cucumis sativus]
Length=469

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 111/158 (70%), Gaps = 9/158 (6%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MN+MRRLKS+ASGR+S+S   GGD  IKR KV Q+ +Q++ G   S+++   A      S
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDFGIKRAKVDQETEQKVGGV--SDDVGRAASGLGLDS  58

Query  322  TSQE-----DASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  486
            +S         S IS +A +EKSG++ LP+EM EM+IKD+KS++    KD+EP V+ GNG
Sbjct  59   SSSSLDNVASTSNISSIAGAEKSGFDHLPREMREMRIKDEKSNHDE--KDLEPAVVNGNG  116

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TE GQII TTVGGRNG+ KQ +SYMAERVVGTGSF  V
Sbjct  117  TEAGQIIATTVGGRNGKPKQTISYMAERVVGTGSFGVV  154



>ref|XP_004492676.1| PREDICTED: shaggy-related protein kinase theta-like [Cicer arietinum]
Length=472

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 114/160 (71%), Gaps = 10/160 (6%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHE-AA  318
            MN+MRRLKS+ASGR+S+S   GGDS+ KR K  Q+ +++     E+  +     + E   
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSTTKRAKFDQETERK--DNEETNRVERGGNIREKYV  58

Query  319  STSQED------ASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  480
              SQED      +S +S+V ++EKS  ++LPKE+HEMKIKD+KS N NN KDME  ++ G
Sbjct  59   DASQEDTSDTFNSSNVSMVNKTEKSSCDQLPKELHEMKIKDEKSKN-NNEKDMEATIVNG  117

Query  481  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            NGTETGQII T++GGR+G+ K+++SYMAERVVGTGSF  V
Sbjct  118  NGTETGQIITTSIGGRDGQPKRIISYMAERVVGTGSFGVV  157



>ref|XP_003552357.1| PREDICTED: shaggy-related protein kinase theta-like [Glycine 
max]
 gb|KHN24281.1| Shaggy-related protein kinase theta [Glycine soja]
Length=467

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 109/162 (67%), Gaps = 19/162 (12%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MN+MRRLKS+ASGR+SVS   GGD + KRVK    FDQ   GK   E    T P +E   
Sbjct  1    MNMMRRLKSIASGRTSVSSDPGGDCTTKRVK----FDQETEGKVNEE----TYP-NERCG  51

Query  322  TSQE---DA------SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVI  474
              QE   DA      S +  VAR+EKSG+++LPKE++EMKI DDK  N NN KDME  ++
Sbjct  52   KDQEQYVDALKESVNSNVPSVARTEKSGFDQLPKELNEMKIGDDKGKN-NNKKDMEATIV  110

Query  475  TGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
             GNGTETGQI  T +GGR+G+ K+ +SYMAERVVGTGSF  V
Sbjct  111  NGNGTETGQITTTVIGGRDGQPKRTISYMAERVVGTGSFGVV  152



>ref|XP_003534597.1| PREDICTED: shaggy-related protein kinase theta [Glycine max]
Length=460

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 107/155 (69%), Gaps = 12/155 (8%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGD + KR K    FDQ   GK   E    T P +E   
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDCTTKRAK----FDQDTEGKVNEE----TYP-NERCG  51

Query  322  TSQEDA--SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
              QE    S +  V R+EKSGY++LPKE++EMKI DDK  N NN KDME  +++GNGTET
Sbjct  52   KDQEHHVDSNVPSVPRTEKSGYDQLPKELNEMKIGDDKGKN-NNEKDMEATIVSGNGTET  110

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            G+II T +GGR+G+ K+ +SY+AERVVGTGSF  V
Sbjct  111  GEIITTAIGGRDGQPKRTISYIAERVVGTGSFGVV  145



>ref|XP_007051910.1| Shaggy-like protein kinase 32 isoform 3, partial [Theobroma cacao]
 gb|EOX96067.1| Shaggy-like protein kinase 32 isoform 3, partial [Theobroma cacao]
Length=454

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 110/176 (63%), Gaps = 27/176 (15%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVS-DP----------------------QGGDSSIKRVKVAQDFD  252
            MNVMRRLKS+ASGRSS+S DP                      QGGDS  KR KV Q  +
Sbjct  1    MNVMRRLKSIASGRSSISSDPSVDKIMMTTIYMPCSLSYDAKYQGGDSGTKRAKVDQQAE  60

Query  253  QRIAGKPESEEICTTAPMHEAASTSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKD  423
             ++  +    E  TT      ASTS E     S ++ VAR EKSG ++LP EMHEM+I+D
Sbjct  61   CKVHEESNLVERSTTGLEQHMASTSLETVASTSNVTSVARMEKSGVDQLPNEMHEMRIRD  120

Query  424  DKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            +K+ N +  KD+E  VI GNGTETGQII T VGGRNG+ KQ +SYMAERVVGTGSF
Sbjct  121  EKTANHDE-KDVEATVINGNGTETGQIISTVVGGRNGQPKQTISYMAERVVGTGSF  175



>ref|XP_008232743.1| PREDICTED: shaggy-related protein kinase theta-like [Prunus mume]
Length=474

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 107/157 (68%), Gaps = 8/157 (5%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MN+MRRLKS+ASGR+SVS   G DS  KR KV Q+ +++   +  + E   T+       
Sbjct  1    MNMMRRLKSIASGRTSVSSEPGVDSITKRAKVDQETEKKANKQSNTVEKSATSLEQHTVP  60

Query  322  TSQEDASGISLV-------ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  480
            TS E  +  S V       A+ EKS Y++LPKEM+EMKI+D+K++N +  KDME  VI G
Sbjct  61   TSLETVASTSDVSSIAKTEAKEEKSSYDQLPKEMNEMKIRDEKANNHDE-KDMEETVING  119

Query  481  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            NGTETG II TTVGGRNG+ KQ +SYMAERVVGTGSF
Sbjct  120  NGTETGHIIATTVGGRNGQPKQTISYMAERVVGTGSF  156



>gb|KHN29413.1| Shaggy-related protein kinase theta [Glycine soja]
Length=460

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 106/155 (68%), Gaps = 12/155 (8%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGD + KR K    FDQ   GK   E    T P +E   
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDCTTKRAK----FDQDTEGKVNEE----TYP-NERCG  51

Query  322  TSQEDA--SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
              QE    S +  V R+EKSGY +LPKE++EMKI DDK  N NN KDME  +++GNGTET
Sbjct  52   KDQEHHVDSNVPSVPRTEKSGYYQLPKELNEMKIGDDKGKN-NNEKDMEATIVSGNGTET  110

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            G+II T +GGR+G+ K+ +SY+AERVVGTGSF  V
Sbjct  111  GEIITTAIGGRDGQPKRTISYIAERVVGTGSFGVV  145



>dbj|BAO02536.1| predicted Shaggy-like kinase ortholog [Nicotiana alata]
Length=118

 Score =   142 bits (357),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 95/117 (81%), Gaps = 3/117 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGRSSVSDP GGD S+KRVKV Q+ D R+ G+ +SEE CT AP  +  S
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDFSLKRVKVEQEVDHRVDGETQSEEQCTIAPKQDVTS  59

Query  322  TSQE-DASGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNG  486
            TS E  A+ +++  R EKSG+EELPKEM+EMKI+DDK++ +++++KDMEP V++GNG
Sbjct  60   TSNESSATTLNVDTRPEKSGFEELPKEMNEMKIRDDKTNGHEDDIKDMEPAVVSGNG  116



>ref|XP_010540275.1| PREDICTED: shaggy-related protein kinase theta-like [Tarenaya 
hassleriana]
Length=467

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 108/154 (70%), Gaps = 3/154 (2%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S  QGGD  +KRVKV Q+ +Q I G+P   +   T      A 
Sbjct  1    MNVMRRLKSIASGRTSISSXQGGDYGLKRVKVDQEIEQ-ICGEPMQVDQNDTDLEQNPAG  59

Query  322  TSQEDASGISL-VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETG  498
            T QE+ +G S   A +EKS YE+LP  M E + +D++ +N +  KDME  +I G+GTETG
Sbjct  60   TLQENVAGTSNDPAAAEKSTYEQLPDAMQETRTRDERHNNHDE-KDMETTIINGSGTETG  118

Query  499  QIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            Q+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  119  QVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  152



>ref|XP_010919260.1| PREDICTED: shaggy-related protein kinase NtK-1 isoform X2 [Elaeis 
guineensis]
Length=403

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 107/161 (66%), Gaps = 15/161 (9%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPES--------EEICTT  297
            M++MRRLKS+ASGRSS+SDP GGD   KR K  QD    ++ +P          ++  T+
Sbjct  1    MHMMRRLKSIASGRSSISDP-GGDPGTKRAKFDQDGAGEVSSEPHLVEDKAVGLDQNMTS  59

Query  298  APMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVIT  477
              +H  ASTS  D       AR+E +  ++LPKEMHEM IKDDK ++ N  KD E  +++
Sbjct  60   THLHLDASTSNMDPP-----ARTEDAAVDQLPKEMHEMTIKDDKVEDHNE-KDTEGTMVS  113

Query  478  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GNGTE GQII TT+GGRNG+ KQ +SYMAERVVGTGSF  V
Sbjct  114  GNGTERGQIIATTIGGRNGQPKQTISYMAERVVGTGSFGIV  154



>emb|CAC08564.1| wound-induced GSK-3-like protein [Medicago sativa subsp. x varia]
Length=468

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 110/158 (70%), Gaps = 10/158 (6%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKP----ESEEICTTAPMH  309
            MN+MRRLKS+ASGR+S+S   GGDS+ KRVK+ Q+ ++   G         E C  A   
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSNSKRVKLDQETEKVYEGINSLGRNDREQCVDASKE  60

Query  310  EAASTSQEDASGISLVARSEK-SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  486
             +  TS E    +S   ++EK SG++ELPKE+HEMKI+D+KS N NN KD+E   ++GNG
Sbjct  61   ASVGTSNE----VSTETKTEKKSGFDELPKELHEMKIRDEKSKN-NNEKDIEATTVSGNG  115

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TETGQII TT+ GR+G+ KQ +SYMAERVVGTGSF  V
Sbjct  116  TETGQIITTTIAGRDGQPKQTISYMAERVVGTGSFGVV  153



>ref|XP_009340624.1| PREDICTED: shaggy-related protein kinase theta-like [Pyrus x 
bretschneideri]
Length=474

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 112/160 (70%), Gaps = 8/160 (5%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MN+MRRLKS+ASGR+SVS   G DS+ KR KV Q+ +++   +  + E  +T      AS
Sbjct  1    MNMMRRLKSIASGRTSVSSDPGIDSTTKRAKVDQETEKKANKQSNTVEGSSTGLEQHMAS  60

Query  322  TSQE---DASGISLVARSE----KSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  480
            TS E     S +S V ++E    KS  ++LPKEMHEMKI+D+K+++ ++ KDME  +I G
Sbjct  61   TSLETGASTSSVSSVGKTETKEDKSSNDQLPKEMHEMKIRDEKANHHDD-KDMEETIING  119

Query  481  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            NGTETG II TTVGGRNG+ KQ +SYMAER+VGTGSF  V
Sbjct  120  NGTETGHIIATTVGGRNGQPKQTISYMAERIVGTGSFGVV  159



>ref|XP_007218957.1| hypothetical protein PRUPE_ppa003552mg [Prunus persica]
 gb|EMJ20156.1| hypothetical protein PRUPE_ppa003552mg [Prunus persica]
Length=566

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 106/157 (68%), Gaps = 8/157 (5%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MN+MRRLKS+ASGR+SVS   G DS  KR K  Q+ +++   +  + E   T+       
Sbjct  93   MNMMRRLKSIASGRTSVSSEPGVDSITKRAKFDQETEKKANKQSNTVEKSATSLEQHTVP  152

Query  322  TSQEDASGISLV-------ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  480
            TS E  +  S V       A+ EKS Y++LPKEM+EMKI+D+K++N +  KDME  VI G
Sbjct  153  TSLETVASTSDVSSIAKTEAKEEKSSYDQLPKEMNEMKIRDEKANNHDE-KDMEETVING  211

Query  481  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            NGTETG II TTVGGRNG+ KQ +SYMAERVVGTGSF
Sbjct  212  NGTETGHIIATTVGGRNGQPKQTISYMAERVVGTGSF  248



>ref|XP_010919259.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Elaeis 
guineensis]
Length=469

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 106/158 (67%), Gaps = 15/158 (9%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPES--------EEICTT  297
            M++MRRLKS+ASGRSS+SDP GGD   KR K  QD    ++ +P          ++  T+
Sbjct  1    MHMMRRLKSIASGRSSISDP-GGDPGTKRAKFDQDGAGEVSSEPHLVEDKAVGLDQNMTS  59

Query  298  APMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVIT  477
              +H  ASTS  D       AR+E +  ++LPKEMHEM IKDDK ++ N  KD E  +++
Sbjct  60   THLHLDASTSNMDPP-----ARTEDAAVDQLPKEMHEMTIKDDKVEDHNE-KDTEGTMVS  113

Query  478  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            GNGTE GQII TT+GGRNG+ KQ +SYMAERVVGTGSF
Sbjct  114  GNGTERGQIIATTIGGRNGQPKQTISYMAERVVGTGSF  151



>ref|XP_008383272.1| PREDICTED: shaggy-related protein kinase theta [Malus domestica]
Length=474

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 110/160 (69%), Gaps = 8/160 (5%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MN+MRRLKS+ASGR+SVS   G DS+ KR K+ QD +++   +P + E   T       S
Sbjct  1    MNMMRRLKSIASGRTSVSSDPGIDSATKRAKMDQDNEKKANKQPNTVERSATGLEQHMTS  60

Query  322  TSQEDASGISLV-------ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  480
            TS E A+  S V        +  KS Y++LPKEMHEMKI+D+K+++ ++ KDME  +I G
Sbjct  61   TSVETAASTSSVSSVAKTETKEVKSSYDQLPKEMHEMKIRDEKANHHDD-KDMEETIING  119

Query  481  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            NGTETG II TTVGG+NG+ KQ +SYMAERVVGTGSF  V
Sbjct  120  NGTETGHIIATTVGGQNGQPKQTISYMAERVVGTGSFGVV  159



>gb|KEH18946.1| shaggy-like kinase [Medicago truncatula]
Length=468

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 113/158 (72%), Gaps = 10/158 (6%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAG-----KPESEEICTTAPM  306
            MN+MRRLKS+ASGR+S+S   GGDS+ KRVK+ Q+ ++   G     + + E+   ++  
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSNSKRVKLDQETEKAYEGTNTLDRNDREQRVDSS--  58

Query  307  HEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  486
            +EA   +  + S I+     +KSG++ELPKE+HEMKI+D+KS N NN KD+E   ++GNG
Sbjct  59   NEATVGTSNEVSAIT--KTEKKSGFDELPKELHEMKIRDEKSKN-NNEKDIEATTVSGNG  115

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TETGQII TT+ GR+G+ KQ +SYMAERVVGTGSF  V
Sbjct  116  TETGQIITTTIAGRDGQPKQTISYMAERVVGTGSFGVV  153



>gb|EYU35065.1| hypothetical protein MIMGU_mgv1a0059282mg, partial [Erythranthe 
guttata]
Length=131

 Score =   139 bits (350),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 104/138 (75%), Gaps = 10/138 (7%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MN+MRRLKS+ASGRSSVSDP GGDS+IKRVKV Q+ DQR+  + E      T   H  ++
Sbjct  1    MNMMRRLKSIASGRSSVSDP-GGDSTIKRVKVEQELDQRLPYEIE------TRLNHTQSN  53

Query  322  TSQEDASGISLV-ARSEKSGY-EELPKEMHEMKIKDDKSDNQN-NLKDMEPVVITGNGTE  492
            +S+  A+  +    + EKS Y E+LP+EMH+MK+KD+K+DN + N KDME  V++GNGTE
Sbjct  54   SSKNVANKYNNAHNKPEKSSYNEQLPREMHQMKLKDNKTDNHDENFKDMEASVVSGNGTE  113

Query  493  TGQIIVTTVGGRNGEQKQ  546
            TGQIIVT+VGG++G+ KQ
Sbjct  114  TGQIIVTSVGGKDGQPKQ  131



>ref|XP_010090625.1| Shaggy-related protein kinase theta [Morus notabilis]
 gb|EXB40229.1| Shaggy-related protein kinase theta [Morus notabilis]
Length=503

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 107/161 (66%), Gaps = 13/161 (8%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            M +MRRLKS+ASGR+S+S   G D+S KR KV Q+ +Q +  K    E           S
Sbjct  1    MYMMRRLKSIASGRTSISSDPGVDTSTKRAKVDQETEQ-VNPKSNGAEAIAANIEQNVPS  59

Query  322  TSQEDASGISLVAR-----------SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPV  468
            TS E+ +  S+ +            +E+SGY++LPKEMHEMKI+D++S N ++ KD+E  
Sbjct  60   TSLENVACTSIASSMVKPEAKADDVAERSGYDQLPKEMHEMKIRDERS-NSHDEKDVEAT  118

Query  469  VITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            VI G+GTE GQII TTVGGRNG+ KQ +SYMAERVVGTGSF
Sbjct  119  VINGHGTEAGQIIATTVGGRNGQPKQTISYMAERVVGTGSF  159



>ref|XP_010523040.1| PREDICTED: shaggy-related protein kinase theta [Tarenaya hassleriana]
Length=467

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 105/154 (68%), Gaps = 3/154 (2%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGD  +KR KV Q+ +++I G+P   +   +     AA 
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGLKRAKVDQE-NEQICGEPMQVDQNVSGLEQNAAI  59

Query  322  TSQEDASGISL-VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETG  498
              QE  +G S   A +EK  YE+LP  M EM+I+D+++ N    KDME  ++ GNGTETG
Sbjct  60   ILQESVAGASNDPAAAEKPAYEKLPDVMLEMRIRDERNANSEE-KDMETTIVNGNGTETG  118

Query  499  QIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            Q+I TTVGGR+G  KQ +SYMA+RVVGTGSF  V
Sbjct  119  QVITTTVGGRDGMPKQTISYMAQRVVGTGSFGVV  152



>ref|XP_010940878.1| PREDICTED: shaggy-related protein kinase epsilon-like [Elaeis 
guineensis]
Length=469

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 112/165 (68%), Gaps = 23/165 (14%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESE------------E  285
            MNVMRRLKSVASGRSSVSDP GGDS +K+VKV QD    + GK  +E            +
Sbjct  1    MNVMRRLKSVASGRSSVSDP-GGDSGMKKVKVEQD----VEGKESTEHSVVEDKAMGLKQ  55

Query  286  ICTTAPMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEP  465
            + T+A +   ASTS +  +      R++ +G ++LPKEM+EM I++DK+D  NN KD++ 
Sbjct  56   LTTSAHLDSDASTSSKGTT-----TRAKNAGIDQLPKEMYEMTIRNDKADG-NNDKDVKA  109

Query  466  VVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
             V+ GNGTETG +I  T+GG+NG+ KQ +SYMA+ VVGTGSF  V
Sbjct  110  TVLKGNGTETGHLITATIGGQNGQPKQTVSYMADCVVGTGSFGVV  154



>ref|XP_008799540.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Phoenix dactylifera]
Length=474

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 105/162 (65%), Gaps = 23/162 (14%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEIC----------  291
            M++MRRLKS+ASGRSS+SDP GGD   KR K    FDQ  AG+  SE+            
Sbjct  1    MHMMRRLKSIASGRSSISDP-GGDPGTKRAK----FDQDGAGEVSSEQHLVEDKSVGLDH  55

Query  292  --TTAPMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEP  465
              T+  +   ASTS  D       AR+E +  ++LPKEMHEM IKDDK ++ N  KD E 
Sbjct  56   NMTSTHLPLDASTSNMDPP-----ARTEDAAVDQLPKEMHEMTIKDDKVEDHNE-KDTEG  109

Query  466  VVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
             ++ GNGTE GQII TT+GGRNG+ KQ +SYMAERVVGTGSF
Sbjct  110  TMMIGNGTERGQIIATTIGGRNGQPKQTISYMAERVVGTGSF  151



>ref|XP_008799541.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Phoenix dactylifera]
Length=469

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 105/162 (65%), Gaps = 23/162 (14%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEIC----------  291
            M++MRRLKS+ASGRSS+SDP GGD   KR K    FDQ  AG+  SE+            
Sbjct  1    MHMMRRLKSIASGRSSISDP-GGDPGTKRAK----FDQDGAGEVSSEQHLVEDKSVGLDH  55

Query  292  --TTAPMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEP  465
              T+  +   ASTS  D       AR+E +  ++LPKEMHEM IKDDK ++ N  KD E 
Sbjct  56   NMTSTHLPLDASTSNMDPP-----ARTEDAAVDQLPKEMHEMTIKDDKVEDHNE-KDTEG  109

Query  466  VVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
             ++ GNGTE GQII TT+GGRNG+ KQ +SYMAERVVGTGSF
Sbjct  110  TMMIGNGTERGQIIATTIGGRNGQPKQTISYMAERVVGTGSF  151



>ref|XP_004510856.1| PREDICTED: shaggy-related protein kinase theta-like [Cicer arietinum]
Length=467

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 112/159 (70%), Gaps = 13/159 (8%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQR------IAGKPESEEICTTAP  303
            MN+MRRLKS+ASGR+S+S   GGDS+ KR K+ Q+ +         +G+ + E+      
Sbjct  1    MNMMRRLKSIASGRTSISSDPGGDSNSKRAKLDQETENNGNEETNTSGRNDREQRV----  56

Query  304  MHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGN  483
              +A+  +    S +S V ++EKSG+++LPKE+HEMKI+D+KS N NN KD+    ++GN
Sbjct  57   --DASKETTVGTSTVSTVTKTEKSGFDQLPKELHEMKIRDEKSKN-NNEKDVAAATVSGN  113

Query  484  GTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GTETGQII TT+GGR+G+ KQ +SYMAERVVGTGSF  V
Sbjct  114  GTETGQIITTTIGGRDGQPKQTISYMAERVVGTGSFGVV  152



>ref|XP_008803034.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Phoenix dactylifera]
Length=468

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 109/158 (69%), Gaps = 15/158 (9%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPES--------EEICTT  297
            MNVMRRLKS+ASGRSSVSDP GGDSS+K+VKV QD + +   +           E++ T+
Sbjct  1    MNVMRRLKSIASGRSSVSDP-GGDSSMKKVKVEQDVEGKECTEHSVVENKAMGLEQLTTS  59

Query  298  APMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVIT  477
            A +   ASTS +  +      R + +G ++L KEMHEM I++DK+D  N+ K+++  VI 
Sbjct  60   AHLDSDASTSSKGPT-----TRLKNAGIDQLSKEMHEMTIRNDKADGHND-KNVKATVIK  113

Query  478  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            G  TETG +I TT+GG+NG+ KQ +SYMA+RVVGTGSF
Sbjct  114  GKSTETGHLITTTIGGQNGQPKQTISYMADRVVGTGSF  151



>ref|XP_008385705.1| PREDICTED: shaggy-related protein kinase theta-like [Malus domestica]
Length=474

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 109/160 (68%), Gaps = 8/160 (5%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MN+MRRLKS+ASGR+SVS   G DS+ KR KV Q+ +++   +  + E   T      AS
Sbjct  1    MNMMRRLKSIASGRTSVSSDPGIDSTTKRAKVDQENEKKANKQSNTVEGSATGLEQHMAS  60

Query  322  TSQEDASGISLV-------ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  480
            TS E A+  S V        + +KS  ++LPKEMHEMKI+D+K+++ ++ KDME  +I G
Sbjct  61   TSLETAASTSSVSSVGKTETKEDKSSNDQLPKEMHEMKIRDEKANHHDD-KDMEETIING  119

Query  481  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            NGTETG II T VGG+NG+ KQ +SYMAERVVGTGSF  V
Sbjct  120  NGTETGHIIATKVGGQNGQPKQTISYMAERVVGTGSFGVV  159



>dbj|BAJ93751.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=468

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 106/158 (67%), Gaps = 10/158 (6%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMH-EAA  318
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P   +     PMH +  
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGSKRPKFDQDGLGDIVIQPHLSD---DKPMHLDQE  56

Query  319  STSQEDASGISLV----ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  486
            S+S  DA   +      A++E +G  +LPK MH+M I D+K D  NN K+ E +++ GNG
Sbjct  57   SSSHRDAEASTSTSMNPAKAEDTG-ADLPKGMHDMTINDNKVDGHNNDKEAEGIIVDGNG  115

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TE GQIIVTT+GG+NG+ KQ +SYMAERVVGTGSF  V
Sbjct  116  TEAGQIIVTTIGGQNGKPKQKVSYMAERVVGTGSFGVV  153



>ref|XP_002465046.1| hypothetical protein SORBIDRAFT_01g031220 [Sorghum bicolor]
 gb|EER92044.1| hypothetical protein SORBIDRAFT_01g031220 [Sorghum bicolor]
Length=470

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 106/157 (68%), Gaps = 6/157 (4%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P   E        E++S
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGSKRPKFEQDGAGDIVIEPHLTEEKPVRIDQESSS  59

Query  322  TSQEDASGISLV----ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGT  489
            +S  DA   +      A++E+ G + LPKEM++M I DDK+D  N+ K+ E V + GNGT
Sbjct  60   SSNRDAEASTSTSMKPAKTEEPGADILPKEMNDMTISDDKADGHND-KEGEGVTLDGNGT  118

Query  490  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            ETGQIIVTT+GG NG+ KQ +SYMAERVVGTGSF  V
Sbjct  119  ETGQIIVTTIGGHNGKPKQKVSYMAERVVGTGSFGVV  155



>ref|XP_006396267.1| hypothetical protein EUTSA_v10028631mg [Eutrema salsugineum]
 gb|ESQ37720.1| hypothetical protein EUTSA_v10028631mg [Eutrema salsugineum]
Length=473

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 108/155 (70%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKP-ESEEICTTAPMHEAA  318
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ QD ++ + G P + +       M  A 
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGLKRAKLDQD-NENLCGDPMQVDHNSACFEMKIAD  59

Query  319  STSQEDASGISLV-ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
              SQE  +G S V A +EKS  ++LP+ M EM+I+D+++ N+   KDME  ++ G+GTET
Sbjct  60   MVSQESVAGTSNVPAVTEKSVDDQLPEVMIEMRIRDERNANREE-KDMETTIVNGSGTET  118

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  119  GQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  153



>ref|NP_001065093.1| Os10g0521700 [Oryza sativa Japonica Group]
 gb|AAM92301.1| putative shaggy-like kinase [Oryza sativa Japonica Group]
 gb|AAP54673.1| Shaggy-related protein kinase theta, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27007.1| Os10g0521700 [Oryza sativa Japonica Group]
 gb|EEE51283.1| hypothetical protein OsJ_32193 [Oryza sativa Japonica Group]
Length=469

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 108/159 (68%), Gaps = 11/159 (7%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMH--EA  315
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P    +    PM   + 
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGTKRPKFDQDGAGDIVIEPH---LTDDKPMRVDQE  56

Query  316  ASTSQEDASGISLVA----RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGN  483
            +S+S  DA   +  +    R+E++G + LPKEM+EM I DDK D  N+ K+ E V++  N
Sbjct  57   SSSSHRDAEASTSTSKNPGRTEEAGADILPKEMNEMTISDDKVDGHND-KESEGVIVNAN  115

Query  484  GTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GTETGQIIVT++GG+NG+ KQ +SYMAERVVGTGSF  V
Sbjct  116  GTETGQIIVTSIGGQNGKPKQKVSYMAERVVGTGSFGVV  154



>gb|EEC67328.1| hypothetical protein OsI_34360 [Oryza sativa Indica Group]
Length=525

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 107/156 (69%), Gaps = 11/156 (7%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMH--EA  315
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P    +    PM   + 
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGTKRPKFDQDGAGDIVIEPH---LTDDKPMRVDQE  56

Query  316  ASTSQEDASGISLVA----RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGN  483
            +S+S  DA   +  +    R+E++G + LPKEM+EM I DDK D  N+ K+ E V++  N
Sbjct  57   SSSSHRDAEASTSTSKNPGRTEEAGADILPKEMNEMTISDDKVDGHND-KESEGVIVNAN  115

Query  484  GTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            GTETGQIIVT++GG+NG+ KQ +SYMAERVVGTGSF
Sbjct  116  GTETGQIIVTSIGGQNGKPKQKVSYMAERVVGTGSF  151



>ref|NP_191981.1| Shaggy-related protein kinase theta [Arabidopsis thaliana]
 sp|Q96287.3|KSG8_ARATH RecName: Full=Shaggy-related protein kinase theta; AltName: Full=ASK-theta 
[Arabidopsis thaliana]
 emb|CAA69156.1| Shaggy-like kinase tetha [Arabidopsis thaliana]
 gb|AAC13616.1| protein kinase [Arabidopsis thaliana]
 emb|CAB80881.1| Shaggy related protein kinase tetha [Arabidopsis thaliana]
 gb|AAL32976.1| AT4g00720/F6N23_11 [Arabidopsis thaliana]
 gb|AAM70590.1| AT4g00720/F6N23_11 [Arabidopsis thaliana]
 dbj|BAE98364.1| Shaggy related protein kinase theta [Arabidopsis thaliana]
 gb|AEE81925.1| Shaggy-related protein kinase theta [Arabidopsis thaliana]
Length=472

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 107/154 (69%), Gaps = 3/154 (2%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGD ++KR K+ Q+ D       + ++  +   M +A  
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYALKRAKLDQENDNLCVDPMQVDQNSSCFEM-KADV  59

Query  322  TSQEDASGISLV-ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETG  498
             SQE  +G S V A SEK   ++LP  M EMKI+D+++ N+ + KDME  V+ G+GTETG
Sbjct  60   LSQESVAGTSNVPAVSEKPVDDQLPDVMIEMKIRDERNANRED-KDMETTVVNGSGTETG  118

Query  499  QIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            Q+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  119  QVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  152



>ref|XP_003574217.1| PREDICTED: shaggy-related protein kinase alpha-like [Brachypodium 
distachyon]
Length=469

 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 108/159 (68%), Gaps = 11/159 (7%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMH--EA  315
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  Q+    I  +P+  +     PMH  + 
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGSKRPKFDQEGSGDIVIEPQLSD---DKPMHLDQE  56

Query  316  ASTSQEDASGISLV----ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGN  483
            +S+S  DA   +      A++E++G + LPK M++M I DD+ D   + KD E V++ GN
Sbjct  57   SSSSHRDADASTSTSMNPAKTEETGADLLPKGMNDMTISDDRVDGLTD-KDAEGVIVNGN  115

Query  484  GTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GTE GQIIVTT+GG+NG+ KQ +SYMAERVVGTGSF  V
Sbjct  116  GTEAGQIIVTTIGGQNGKPKQKVSYMAERVVGTGSFGVV  154



>ref|XP_006375322.1| shaggy-related protein kinase theta [Populus trichocarpa]
 gb|ERP53119.1| shaggy-related protein kinase theta [Populus trichocarpa]
Length=438

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 88/117 (75%), Gaps = 4/117 (3%)
 Frame = +1

Query  250  DQRIAGKPESEEICTTAPMHEAASTSQEDA---SGISLVARSEKSGYEELPKEMHEMKIK  420
            +Q+I G+    E   T      ASTSQE+A   S ++ V R+EK GY++LPKEMHEMKI+
Sbjct  2    EQKIDGESYLVERSVTEQEQHMASTSQENAASASNVTSVTRTEKPGYDQLPKEMHEMKIR  61

Query  421  DDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            DDK+ N +  KDME  +++GNGTETGQII TTVGGRNG+ KQ++SYMAERVVGTGSF
Sbjct  62   DDKNTNHDE-KDMEAAIVSGNGTETGQIIATTVGGRNGQPKQIISYMAERVVGTGSF  117



>ref|XP_002872933.1| hypothetical protein ARALYDRAFT_490498 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49192.1| hypothetical protein ARALYDRAFT_490498 [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 108/154 (70%), Gaps = 3/154 (2%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGD ++KR K+ Q+ D   A   + ++  +   M +A  
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYALKRAKLDQENDNLCADPMQVDQNSSCFEM-KADI  59

Query  322  TSQEDASGISLV-ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETG  498
             S E  +G S V A SEK+  ++LP+ M +M+I+D+++ N+   KDME  V+ G+GTETG
Sbjct  60   LSHESVAGTSNVPAASEKTVDDQLPEVMIDMRIRDERNANREE-KDMETTVVNGSGTETG  118

Query  499  QIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            Q+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  119  QVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  152



>ref|XP_011023408.1| PREDICTED: shaggy-related protein kinase NtK-1-like isoform X1 
[Populus euphratica]
Length=454

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 96/132 (73%), Gaps = 4/132 (3%)
 Frame = +1

Query  205  GGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAASTSQEDA---SGISLVARSEKS  375
            GGD   KR KV Q+ ++++  +    E   T      ASTSQE+A   S I+ VAR+EKS
Sbjct  8    GGDVGTKRAKVDQEIERKVDQESYLVERSVTDQEQHMASTSQENAASTSNITSVARTEKS  67

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            GY++LPKEMH+MKI+D+K+   +  K++E V+++GNGTETGQII TTVGGRNG+ KQ +S
Sbjct  68   GYDQLPKEMHQMKIRDEKTTFHDE-KEVEAVIVSGNGTETGQIIATTVGGRNGQPKQTIS  126

Query  556  YMAERVVGTGSF  591
            YMAE +VGTGSF
Sbjct  127  YMAEHMVGTGSF  138



>ref|XP_010933863.1| PREDICTED: shaggy-related protein kinase epsilon-like [Elaeis 
guineensis]
Length=469

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 103/161 (64%), Gaps = 15/161 (9%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQD-----F--DQRIAGKPESEEICTTA  300
            M +MRRLKS+ASGRSS+SDP GGD   KR K  QD     F     +A K  S +  TT+
Sbjct  1    MQMMRRLKSIASGRSSISDP-GGDPGTKRPKFDQDGAGEVFTGPHLVADKAISVDKNTTS  59

Query  301  P-MHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVIT  477
              +H  A+ S  D+S     AR+  +  ++LP EMH M I+DDK +  N  K+ E  ++ 
Sbjct  60   THLHLDANMSNGDSS-----ARTGHAAVDQLPNEMHVMTIRDDKVEGHNE-KETEGTMVN  113

Query  478  GNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GNGTETGQII TT+GGRNGE KQ +SYMAE VVGTGSF  V
Sbjct  114  GNGTETGQIIATTIGGRNGEPKQTISYMAEHVVGTGSFGVV  154



>ref|XP_008657609.1| PREDICTED: shaggy-related protein kinase alpha-like [Zea mays]
 tpg|DAA45977.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=473

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 103/154 (67%), Gaps = 6/154 (4%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P   E        E++S
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGSKRPKFEQDGAGDIVMEPHLTEDKPVRIDQESSS  59

Query  322  TSQEDASGISLVA----RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGT  489
            TS  DA   +  +    ++E++G + LPKEM+ M I DDK+D  N+ K+ E V + G GT
Sbjct  60   TSNRDAEASTSTSMKPVKTEEAGADLLPKEMNIMTISDDKADGHND-KEGEGVTLDGTGT  118

Query  490  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            ETGQIIVTT+GG NG+ KQ +SYMAE VVGTGSF
Sbjct  119  ETGQIIVTTIGGHNGKPKQKVSYMAELVVGTGSF  152



>ref|XP_008660602.1| PREDICTED: shaggy-related protein kinase alpha-like [Zea mays]
 gb|AFW89914.1| putative glycogen synthase kinase family protein [Zea mays]
Length=470

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 104/154 (68%), Gaps = 6/154 (4%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P   E        E++S
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGSKRPKFEQDGAGDIVIEPHLTEAKPVRIDQESSS  59

Query  322  TSQEDASGISLVA----RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGT  489
            +S  DA   +  +    ++E+   + LPKE+++M I DDK+D+ N+ K+ E V + GNG 
Sbjct  60   SSNRDAEASTSTSMKPVKTEEPVADLLPKELNDMTISDDKADDHND-KEGEGVTLDGNGA  118

Query  490  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            ETGQIIVTT+GG NG+ KQ +SYMAERVVGTGSF
Sbjct  119  ETGQIIVTTIGGHNGKPKQKVSYMAERVVGTGSF  152



>gb|KJB22348.1| hypothetical protein B456_004G042400 [Gossypium raimondii]
Length=469

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 108/157 (69%), Gaps = 13/157 (8%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESE----EICTTAPMH  309
            MNVMRRLKS+ASGRSS+S   GGDSS KR KV Q+     +G+   E    E  T++  H
Sbjct  1    MNVMRRLKSIASGRSSISSDPGGDSSSKRAKVDQE-----SGRSRRESNLVESSTSSREH  55

Query  310  EAASTSQE---DASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  480
              ASTSQE     S +  VAR +    ++LP EM EM+I+D+K+ + ++ KD E  VI G
Sbjct  56   NMASTSQETVASTSRVPSVARQQNLVVDQLPNEMREMRIRDEKTVSHDD-KDPEATVING  114

Query  481  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            NGTETGQII TTVGG+NG+ KQ +SYMAERVVGTGSF
Sbjct  115  NGTETGQIISTTVGGQNGQPKQTMSYMAERVVGTGSF  151



>ref|XP_006661970.1| PREDICTED: shaggy-related protein kinase theta-like [Oryza brachyantha]
Length=469

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 105/159 (66%), Gaps = 11/159 (7%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMH--EA  315
            M +MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P    +    PM   + 
Sbjct  1    MIMMRRLKSIASGRSSVSDP-GGDSGTKRPKFDQDGAGDIVIEPH---LTDDKPMRVDQE  56

Query  316  ASTSQEDASGISLVA----RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGN  483
             S+S  DA   +  +    R+E++G   LPKEM++M I DDK D +N+ K+ E +++ G 
Sbjct  57   PSSSHRDAEASTSTSKNPGRTEEAGANILPKEMNDMTISDDKVDGRND-KESEGIIVNGT  115

Query  484  GTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            G ETGQIIVTT+GG+NG+ KQ +SYMAERVVGTGSF  V
Sbjct  116  GAETGQIIVTTIGGQNGKPKQKVSYMAERVVGTGSFGVV  154



>ref|XP_007051909.1| Shaggy-like protein kinase 32 isoform 2 [Theobroma cacao]
 gb|EOX96066.1| Shaggy-like protein kinase 32 isoform 2 [Theobroma cacao]
Length=436

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 90/133 (68%), Gaps = 4/133 (3%)
 Frame = +1

Query  202  QGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAASTSQEDA---SGISLVARSEK  372
            QGGDS  KR KV Q  + ++  +    E  TT      ASTS E     S ++ VAR EK
Sbjct  18   QGGDSGTKRAKVDQQAECKVHEESNLVERSTTGLEQHMASTSLETVASTSNVTSVARMEK  77

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            SG ++LP EMHEM+I+D+K+ N +  KD+E  VI GNGTETGQII T VGGRNG+ KQ +
Sbjct  78   SGVDQLPNEMHEMRIRDEKTANHDE-KDVEATVINGNGTETGQIISTVVGGRNGQPKQTI  136

Query  553  SYMAERVVGTGSF  591
            SYMAERVVGTGSF
Sbjct  137  SYMAERVVGTGSF  149



>ref|XP_004983886.1| PREDICTED: LOW QUALITY PROTEIN: shaggy-related protein kinase 
theta-like [Setaria italica]
Length=470

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 106/160 (66%), Gaps = 12/160 (8%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPM---HE  312
            M++MRRLKS+ASGRSSVSDP GGDS  KR K  QD    I  +P    +    PM    E
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDSGSKRPKFEQDGAGDIVIEPH---LTDDKPMRIDQE  56

Query  313  AASTSQEDASGISLVA----RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  480
            ++S+S  DA   +  +    ++E+ G + LPKEM++M I DDK+D  N+ K    ++  G
Sbjct  57   SSSSSNRDAEASTSTSMKPVKTEEPGTDLLPKEMNDMTISDDKADGHND-KRGGGLLFDG  115

Query  481  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            NGTETG+IIVTT+GG NG+ KQ +SYMAERVVGTGSF  V
Sbjct  116  NGTETGKIIVTTIGGHNGKPKQKVSYMAERVVGTGSFGVV  155



>ref|XP_010424046.1| PREDICTED: shaggy-related protein kinase theta-like [Camelina 
sativa]
Length=199

 Score =   125 bits (314),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 106/162 (65%), Gaps = 14/162 (9%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTA-------  300
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ Q+ D   A   + ++  +++       
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGMKRAKLDQENDNLCADPMQVDQTSSSSSSDIKPD  60

Query  301  --PMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVI  474
              P+   A TS    +G  L  +     + +LP+ M +M+I+DD++ ++++ K+ME  ++
Sbjct  61   IFPLESVAGTS----NGHPLSDKPVDDHHHQLPEVMTDMRIRDDRNAHRDD-KEMETTIV  115

Query  475  TGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
             G+GTETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  116  NGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  157



>ref|XP_010053665.1| PREDICTED: shaggy-related protein kinase epsilon [Eucalyptus 
grandis]
 gb|KCW78017.1| hypothetical protein EUGRSUZ_D02249 [Eucalyptus grandis]
Length=468

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 100/155 (65%), Gaps = 4/155 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQR--IAGKPESEEICTTAPMHEA  315
            MN+MRR+KS+ASGR+S+S   GGDS  KRVKV Q+   R  +     S E   T      
Sbjct  1    MNMMRRIKSIASGRTSISSEPGGDSGTKRVKVDQEAHHRDNVDQLLHSVERGATGLEQHM  60

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            ASTS E  +G S  +   K   +++ +  HE +IKDDK+ + +  KD EP VI G+GTET
Sbjct  61   ASTSLEAVAGTSSKSSVSKHSDDQVHRGGHETRIKDDKAFHDD--KDCEPAVINGHGTET  118

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            G II TTVGGR+G+ KQ +SYMAERVVGTGSF  V
Sbjct  119  GHIITTTVGGRDGQPKQTISYMAERVVGTGSFGVV  153



>gb|ABR17117.1| unknown [Picea sitchensis]
Length=424

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 97/161 (60%), Gaps = 25/161 (16%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRL+S+ASGRSSV+DP GGD+  KR K   +            E  T+ P+   A 
Sbjct  1    MNVMRRLRSLASGRSSVTDP-GGDAGTKRAKFELE-----------READTSEPLGVVAR  48

Query  322  TS-----QEDASGIS------LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPV  468
            TS     Q+   G+       LV   E    + LPKEMHEMKIKDD  +N    K++ P 
Sbjct  49   TSEASHQQDVVVGLKGTLRNILVPEFENVDVDWLPKEMHEMKIKDDNVNNGG--KEIIPG  106

Query  469  VITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            V+ GNG ETG II TT+GG NG+ KQ +SYMAERVVGTGSF
Sbjct  107  VVNGNGMETGHIIATTIGGLNGQPKQTISYMAERVVGTGSF  147



>gb|ABK24428.1| unknown [Picea sitchensis]
Length=471

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 97/161 (60%), Gaps = 25/161 (16%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRL+S+ASGRSSV+DP GGD+  KR K   +            E  T+ P+   A 
Sbjct  1    MNVMRRLRSLASGRSSVTDP-GGDAGTKRAKFELE-----------READTSEPLGVVAR  48

Query  322  TS-----QEDASGIS------LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPV  468
            TS     Q+   G+       LV   E    + LPKEMHEMKIKDD  +N    K++ P 
Sbjct  49   TSEASHQQDVVVGLKGTLRNILVPEFENVDVDWLPKEMHEMKIKDDNVNNGG--KEIIPG  106

Query  469  VITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            V+ GNG ETG II TT+GG NG+ KQ +SYMAERVVGTGSF
Sbjct  107  VVNGNGMETGHIIATTIGGLNGQPKQTISYMAERVVGTGSF  147



>ref|XP_009134534.1| PREDICTED: shaggy-related protein kinase theta [Brassica rapa]
Length=468

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 103/157 (66%), Gaps = 13/157 (8%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   G DSS+KR K+ QD D   +G  +  ++  T  M     
Sbjct  1    MNVMRRLKSIASGRTSISSDPGVDSSLKRPKLDQDNDYLSSGGDDPMQVDQTTDM-----  55

Query  322  TSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNL----KDMEPVVITGNGT  489
             SQ+  +G S V        ++LP+ M++M++++++  + N      KDMEP ++ G GT
Sbjct  56   VSQDSVAGTSNVPPPA----DQLPEVMNDMRLREEEPPHANRRGHEDKDMEPPIVNGCGT  111

Query  490  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            ETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  112  ETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  148



>emb|CDX74346.1| BnaA03g27010D [Brassica napus]
Length=468

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 103/157 (66%), Gaps = 13/157 (8%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   G DSS+KR K+ QD D   +G  +  ++  T  M     
Sbjct  1    MNVMRRLKSIASGRTSISSDPGVDSSLKRPKLDQDNDYLSSGGDDPMQVDQTTDM-----  55

Query  322  TSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNL----KDMEPVVITGNGT  489
             SQ+  +G S V        ++LP+ M++M++++++  + N      KDMEP ++ G GT
Sbjct  56   VSQDSVAGTSNVPPPA----DQLPEVMNDMRLREEEPPHANRRGEEDKDMEPPIVNGCGT  111

Query  490  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            ETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  112  ETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  148



>emb|CAA58595.1| Petunia Shaggy kinase 6 [Petunia x hybrida]
Length=414

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 79/95 (83%), Gaps = 3/95 (3%)
 Frame = +1

Query  316  ASTSQED--ASGISLVARSEKSGYEELPKEMHEMKIKDDKSD-NQNNLKDMEPVVITGNG  486
            ASTS++   AS  ++  R E S  +ELPKE+HEMKIKD+++D +++NLKDMEP V++GNG
Sbjct  2    ASTSKDTTTASTSTMDTRPENSEVDELPKELHEMKIKDERTDSHEDNLKDMEPAVVSGNG  61

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
             ETGQIIVTTV GRNG+QKQ LSYMAERVVGTGSF
Sbjct  62   AETGQIIVTTVSGRNGQQKQTLSYMAERVVGTGSF  96



>ref|XP_010419626.1| PREDICTED: shaggy-related protein kinase theta-like [Camelina 
sativa]
Length=305

 Score =   125 bits (314),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 106/162 (65%), Gaps = 14/162 (9%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTA-------  300
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ Q+ D   A   + ++  +++       
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGMKRAKLDQENDNLCADPMQVDQTSSSSSSDIKPD  60

Query  301  --PMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVI  474
              P+   A TS    +G  L  +     + +LP+ M +M+I+DD++ ++++ K+ME  ++
Sbjct  61   IFPLESVAGTS----NGHPLSDKPVDDHHHQLPEVMTDMRIRDDRNAHRDD-KEMETTIV  115

Query  475  TGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
             G+GTETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  116  NGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  157



>emb|CDY07202.1| BnaCnng02170D [Brassica napus]
Length=471

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 102/150 (68%), Gaps = 2/150 (1%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ QD D+      +  ++  T+    ++S
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGLKRAKLDQDNDKLCTAGDDPMQVDQTS-SSSSSS  59

Query  322  TSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQ  501
                  S +   A +  +   +LP+ M +M+I+D+++ N+ + KDMEP V+ G+GTETGQ
Sbjct  60   QCVAGTSNVPPPAAAAATVDAQLPEVMTDMRIRDERNANRED-KDMEPTVVNGSGTETGQ  118

Query  502  IIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            +I TTVGGR+G+ KQ +SYMA+RVVGTGSF
Sbjct  119  VITTTVGGRDGKPKQTISYMAQRVVGTGSF  148



>ref|XP_010427333.1| PREDICTED: shaggy-related protein kinase theta-like [Camelina 
sativa]
Length=483

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 102/164 (62%), Gaps = 12/164 (7%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTA-------  300
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ Q+ D   A  P   +  +++       
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGMKRAKLDQENDNMCAADPMQVDQTSSSSSSSDIK  60

Query  301  ----PMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPV  468
                P+   A TS   A     V       + +LP+ M +M+I+DD++ N++  K+ME  
Sbjct  61   PDIFPLESVAGTSNGHALSDKTVDDHHHHHHHQLPEVMTDMRIRDDRNANRDE-KEMETT  119

Query  469  VITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            ++ G+GTETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  120  IVNGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  163



>ref|XP_010255499.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Nelumbo 
nucifera]
Length=460

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 86/123 (70%), Gaps = 4/123 (3%)
 Frame = +1

Query  232  KVAQDFDQRIAGKPESEEICTTAPMHEAASTSQE---DASGISLVARSEKSGYEELPKEM  402
            KV Q+ +Q    +    E  +       ASTS E     S IS+ +++EKSGY++LPKEM
Sbjct  21   KVDQEMEQNATNETHLMEKTSIGLEQHVASTSIETDVSTSNISITSKTEKSGYDQLPKEM  80

Query  403  HEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGT  582
            HEMKI+DDK++N ++ KD E  ++ GNGTE GQII TT+GGRNG+ KQ +SYMAERVVGT
Sbjct  81   HEMKIRDDKTENHDD-KDAEATIVNGNGTEAGQIIATTIGGRNGQPKQTISYMAERVVGT  139

Query  583  GSF  591
            GSF
Sbjct  140  GSF  142



>ref|XP_009111468.1| PREDICTED: shaggy-related protein kinase theta [Brassica rapa]
Length=476

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 101/160 (63%), Gaps = 11/160 (7%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAP------  303
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ QD D+      +  ++  T+       
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGLKRAKLDQDNDKLCTAGDDPMQVDQTSSSSSSSR  60

Query  304  -MHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  480
             M      SQE  +G S V     +   +   ++ E+ I+D+++ N+ + KDMEP V+ G
Sbjct  61   EMRNTDMVSQECVAGTSNVPPPAAATVND---QLPEVMIRDERNANRED-KDMEPTVVNG  116

Query  481  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            +GTETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  117  SGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  156



>ref|XP_006289072.1| hypothetical protein CARUB_v10002475mg [Capsella rubella]
 gb|EOA21970.1| hypothetical protein CARUB_v10002475mg [Capsella rubella]
Length=469

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 102/157 (65%), Gaps = 12/157 (8%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTT---APMHE  312
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ Q+ D   A   + ++  ++    P   
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDCGLKRAKLDQETDNFCADPMQVDQTSSSFDILPKES  60

Query  313  AASTSQEDASGISLVARSEKS-GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGT  489
             A TS   A        SEK+    +LP+ M +M+I+D+++ N+   KDME  ++ G+GT
Sbjct  61   VAGTSNGHAV-------SEKTVDDHQLPEVMTDMRIRDERNANREE-KDMETTIVNGSGT  112

Query  490  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            ETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  113  ETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  149



>gb|ACJ84778.1| unknown [Medicago truncatula]
Length=108

 Score =   117 bits (294),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = +1

Query  361  RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQ  540
            + EKSG+++LPKE+HEMKIKDDKS N NN KDME  V+ GNGTETGQII T++GGR+G+ 
Sbjct  7    KPEKSGFDQLPKELHEMKIKDDKSKN-NNEKDMEATVVNGNGTETGQIITTSIGGRDGQP  65

Query  541  KQVLSYMAERVVGTGSFWSV  600
            K+++SYMAERVVGTGSF  V
Sbjct  66   KRIISYMAERVVGTGSFGVV  85



>emb|CDY51144.1| BnaA09g51790D [Brassica napus]
Length=478

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 101/160 (63%), Gaps = 9/160 (6%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAP------  303
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ QD D+      +  ++  T+       
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGLKRAKLDQDNDKLCTAGDDPMQVDQTSSSSSSSR  60

Query  304  -MHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  480
             M      SQE  +G S V     +    +  ++ E+ I+D+++ N+ + KDMEP V+ G
Sbjct  61   EMRNTDMVSQECVAGTSNVPPPAAAA-ATVDTQLPEVMIRDERNANRED-KDMEPTVVNG  118

Query  481  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            +GTETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  119  SGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  158



>ref|XP_009393923.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=476

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 98/152 (64%), Gaps = 4/152 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            M++MRRLKS+ASGRSSVSDP GGD   KR K  Q+  + +  +   E+  +T     +  
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDLGTKRAKFDQEGGEILTERHLVEDKVSTMDQRISLY  59

Query  322  TSQEDASGISL--VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
                DAS  S    AR E +  ++LP+EMH M I++DK D  N  K+++  +  G GT T
Sbjct  60   HLDLDASTSSTDPPARFEAATMDQLPREMHGMTIREDKPDGHNE-KELDGSMTNGKGTMT  118

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            GQII TT+GGR+G+ KQ +SYMAER+VGTGSF
Sbjct  119  GQIIATTIGGRDGQPKQTISYMAERIVGTGSF  150



>ref|XP_009393922.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=480

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 98/152 (64%), Gaps = 4/152 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            M++MRRLKS+ASGRSSVSDP GGD   KR K  Q+  + +  +   E+  +T     +  
Sbjct  1    MHMMRRLKSIASGRSSVSDP-GGDLGTKRAKFDQEGGEILTERHLVEDKVSTMDQRISLY  59

Query  322  TSQEDASGISL--VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
                DAS  S    AR E +  ++LP+EMH M I++DK D  N  K+++  +  G GT T
Sbjct  60   HLDLDASTSSTDPPARFEAATMDQLPREMHGMTIREDKPDGHNE-KELDGSMTNGKGTMT  118

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            GQII TT+GGR+G+ KQ +SYMAER+VGTGSF
Sbjct  119  GQIIATTIGGRDGQPKQTISYMAERIVGTGSF  150



>ref|XP_004306833.1| PREDICTED: shaggy-related protein kinase theta-like [Fragaria 
vesca subsp. vesca]
Length=470

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 107/155 (69%), Gaps = 8/155 (5%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTT-----APM  306
            MN+MRRLKS+ASGRSSVS   GGDSS KR K  Q  ++++ G+    E   T     +  
Sbjct  1    MNMMRRLKSIASGRSSVSSDPGGDSSSKRSKFDQQTEKKVIGQSNGVERSATDQNTKSTS  60

Query  307  HEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  486
             E+A+++   +S   + A+ EKS  ++LPK+MH+MKI+D  + ++   KDME  +I+GNG
Sbjct  61   MESAASTSSASSIAKIEAKEEKSTVDQLPKDMHQMKIRDVHNHDE---KDMEETIISGNG  117

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TETG II TTVGGRNG+ KQ +SYMAE VVGTGSF
Sbjct  118  TETGHIIATTVGGRNGQPKQTISYMAECVVGTGSF  152



>ref|XP_009400715.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=471

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 102/157 (65%), Gaps = 13/157 (8%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESE-----EICTTAPM  306
            M++M+RLKS+ASGRSSVSDP GGD + KR K    FDQ   G+   E     ++ +T  +
Sbjct  1    MHMMQRLKSIASGRSSVSDP-GGDLTTKRAK----FDQEGGGEILVERHMVDDVASTVDL  55

Query  307  HEAASTSQEDASGISL--VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  480
            H ++S    DAS ++    AR E +  ++LP+EMH M I+D K+D      + +  +I G
Sbjct  56   HISSSHLNFDASTLTTEPPARFEGATMDQLPREMHGMTIRDIKTDGHIE-TEFDGTMING  114

Query  481  NGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
             GT TGQI+ T +GGR+G+ KQ +SYMAER+VGTGSF
Sbjct  115  KGTMTGQILATVIGGRDGQPKQTISYMAERIVGTGSF  151



>sp|O04160.2|KSGT_BRANA RecName: Full=Shaggy-related protein kinase theta; AltName: Full=ASK-theta 
[Brassica napus]
 emb|CAA73214.1| shaggy-like protein kinase tetha [Brassica napus]
Length=468

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 102/155 (66%), Gaps = 9/155 (6%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+S+S   G DSS+KR K+ QD D   +   +  ++  +  M     
Sbjct  1    MNVMRRLKSIASGRTSISSDPGVDSSLKRPKLDQDNDNLSSRGDDPMQVDQSTDM---VV  57

Query  322  TSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDK--SDNQNNLKDMEPVVITGNGTET  495
             SQ+  +G S V        ++LP+ M++M++++D+  ++     KDMEP ++ G GTET
Sbjct  58   VSQDTVAGTSNVPPPP----DQLPEVMNDMRLREDEPHANRGEEDKDMEPPIVNGCGTET  113

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  114  GQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  148



>ref|XP_010456251.1| PREDICTED: shaggy-related protein kinase theta [Camelina sativa]
Length=479

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 105/162 (65%), Gaps = 12/162 (7%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTA-------  300
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ Q+ D   A   + ++  +++       
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGMKRAKLDQENDNLCADPMQVDQTSSSSSSDIKPD  60

Query  301  --PMHEAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVI  474
              P+   A TS  +   +S     +   + +LP+ M +M+I+DD++  +++ K+ME  ++
Sbjct  61   IFPLESVAGTS--NGHPLSDKPVDDHHHHHQLPEVMTDMRIRDDRNAYRDD-KEMETTIV  117

Query  475  TGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
             G+GTETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  118  NGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  159



>gb|KJB41234.1| hypothetical protein B456_007G096100 [Gossypium raimondii]
Length=470

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 101/153 (66%), Gaps = 4/153 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGRSS S    GD+  KR KV Q+ + ++       E  TT      AS
Sbjct  1    MNVMRRLKSIASGRSSSSSDPSGDTGTKRAKVDQESECKVNEASNFVERSTTDREKHMAS  60

Query  322  TSQEDASGISLV---ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            +S E  +  S V   AR+EK   + LP EMHEM+I+D+K+ + +  KDME  VI GNGTE
Sbjct  61   SSLETVASTSYVTSVARTEKPDVDLLPNEMHEMRIRDEKTADPDE-KDMEAPVINGNGTE  119

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TGQII  T+GGR+G+ KQ +SYMAERV+G GSF
Sbjct  120  TGQIISATIGGRDGKPKQTISYMAERVIGRGSF  152



>emb|CDX91895.1| BnaC03g31970D [Brassica napus]
Length=466

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 104/158 (66%), Gaps = 17/158 (11%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+ASGR+SVS   G DSS+KR K+ QD D  ++ + +        PM    S
Sbjct  1    MNVMRRLKSIASGRTSVSSDPGVDSSLKRPKLDQDNDN-LSSRGDD-------PMQVDQS  52

Query  322  T---SQEDASGISLVARSEKSGYEELPKEMHEMKIKDDK--SDNQNNLKDMEPVVITGNG  486
            T   SQ+  +G S V        ++LP+ M++M++++++  ++     KDMEP ++ G G
Sbjct  53   TDMVSQDSVAGTSNVPPPA----DQLPEVMNDMRLREEEPHANRGEEDKDMEPPIVNGCG  108

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  109  TETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  146



>gb|KFK30649.1| hypothetical protein AALP_AA6G009500 [Arabis alpina]
Length=471

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 103/164 (63%), Gaps = 25/164 (15%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMH----  309
            MNVMRRLKS+ASGR+S+S   GGD  +KR K+ Q          E+E   ++ PM     
Sbjct  1    MNVMRRLKSIASGRTSISSDPGGDYGLKRAKLDQ----------ENESSSSSDPMQVDQN  50

Query  310  ---EAASTSQEDASG---ISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPV-  468
               +    SQE  +G   + +VA  +    ++LP+ M +M+I+D++++     KDME   
Sbjct  51   SEMKTEMVSQESVAGTSNVPVVANVD----DQLPEVMIDMRIRDERNNANREEKDMETTT  106

Query  469  VITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            V+ G+GTETGQ+I TTVGGR+G+ KQ +SYMA+RVVGTGSF  V
Sbjct  107  VVNGSGTETGQVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVV  150



>ref|XP_002301334.1| hypothetical protein POPTR_0002s15640g [Populus trichocarpa]
 gb|EEE80607.1| hypothetical protein POPTR_0002s15640g [Populus trichocarpa]
Length=412

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 80/95 (84%), Gaps = 4/95 (4%)
 Frame = +1

Query  316  ASTSQEDA---SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  486
            ASTSQE+A   S I+ V R+EKSGY++LPKEMH+MKI+D+K+ + +  K++E  +++GNG
Sbjct  2    ASTSQENAASTSNITSVTRTEKSGYDQLPKEMHQMKIRDEKTTSHDE-KEVEAAIVSGNG  60

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TETGQII TTVGG++G+ KQ +SY+AER+VGTGSF
Sbjct  61   TETGQIIATTVGGQDGQPKQTISYVAERMVGTGSF  95



>ref|XP_008344049.1| PREDICTED: shaggy-related protein kinase epsilon-like [Malus 
domestica]
Length=460

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 91/136 (67%), Gaps = 8/136 (6%)
 Frame = +1

Query  205  GGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAASTSQEDASGISLV-------AR  363
            G DS+ KR K+ QD +++   +P + E   T       STS E A+  S V        +
Sbjct  8    GIDSATKRAKMDQDNEKKANKQPNTVERSATGLEQHMTSTSVETAASTSSVSSVAKTETK  67

Query  364  SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQK  543
              KS Y++LPKEMHEMKI+D+K+++ ++ KDME  +I GNGTETG II TTVGG+NG+ K
Sbjct  68   EVKSSYDQLPKEMHEMKIRDEKANHHDD-KDMEETIINGNGTETGHIIATTVGGQNGQPK  126

Query  544  QVLSYMAERVVGTGSF  591
            Q +SYMAERVVGTGSF
Sbjct  127  QTISYMAERVVGTGSF  142



>ref|XP_009412822.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=471

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            M++MRRLKS+ SGR S SDP GGD   K+ KV QD   +I  +P   E  +    H +A 
Sbjct  1    MHMMRRLKSITSGRPSSSDP-GGDYGTKKTKVDQDGGGKILVEPHMSEKKSIELDHCSAL  59

Query  322  TSQE-DASGISL--VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
                 DAS  S     + +++  ++LPKEM++M IK DK ++ +  K+ + +++ GNGTE
Sbjct  60   NQMNFDASSSSSDPPMKIQEATVDQLPKEMNDMTIKVDKVNDHDE-KENDGIMVNGNGTE  118

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TGQ IV T+GGRNG+ KQ +SYMAERVVGTGSF  V
Sbjct  119  TGQTIVITIGGRNGQPKQTISYMAERVVGTGSFGMV  154



>ref|XP_009412821.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=477

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 101/156 (65%), Gaps = 5/156 (3%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            M++MRRLKS+ SGR S SDP GGD   K+ KV QD   +I  +P   E  +    H +A 
Sbjct  1    MHMMRRLKSITSGRPSSSDP-GGDYGTKKTKVDQDGGGKILVEPHMSEKKSIELDHCSAL  59

Query  322  TSQE-DASGISL--VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
                 DAS  S     + +++  ++LPKEM++M IK DK ++ +  K+ + +++ GNGTE
Sbjct  60   NQMNFDASSSSSDPPMKIQEATVDQLPKEMNDMTIKVDKVNDHDE-KENDGIMVNGNGTE  118

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TGQ IV T+GGRNG+ KQ +SYMAERVVGTGSF  V
Sbjct  119  TGQTIVITIGGRNGQPKQTISYMAERVVGTGSFGMV  154



>ref|XP_002991115.1| hypothetical protein SELMODRAFT_451471 [Selaginella moellendorffii]
 ref|XP_002991645.1| hypothetical protein SELMODRAFT_186226 [Selaginella moellendorffii]
 gb|EFJ07216.1| hypothetical protein SELMODRAFT_186226 [Selaginella moellendorffii]
 gb|EFJ07923.1| hypothetical protein SELMODRAFT_451471 [Selaginella moellendorffii]
Length=456

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 91/151 (60%), Gaps = 23/151 (15%)
 Frame = +1

Query  148  VMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAASTS  327
            +M+RL+++ASG SS +D Q G +  KR KV Q  +Q +A                    S
Sbjct  1    MMQRLRNLASGWSSTADTQLGGAGTKRAKVEQGEEQGMA--------------------S  40

Query  328  QEDASGISLVARSEKSG---YEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETG  498
               A+G+    R+        ++LP EMHEMKI+DDK+    + K++E  VI GNGTETG
Sbjct  41   SVSAAGLIANPRAATVNSNVVDQLPDEMHEMKIRDDKAATHIDEKEVEAAVIDGNGTETG  100

Query  499  QIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
             II TT+GGRNG+ KQ +SY+AERVVGTGSF
Sbjct  101  HIIATTIGGRNGQPKQTISYVAERVVGTGSF  131



>gb|KJB41237.1| hypothetical protein B456_007G096100 [Gossypium raimondii]
Length=458

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 84/131 (64%), Gaps = 4/131 (3%)
 Frame = +1

Query  208  GDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAASTSQEDASGISLV---ARSEKSG  378
            GD+  KR KV Q+ + ++       E  TT      AS+S E  +  S V   AR+EK  
Sbjct  11   GDTGTKRAKVDQESECKVNEASNFVERSTTDREKHMASSSLETVASTSYVTSVARTEKPD  70

Query  379  YEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSY  558
             + LP EMHEM+I+D+K+ + +  KDME  VI GNGTETGQII  T+GGR+G+ KQ +SY
Sbjct  71   VDLLPNEMHEMRIRDEKTADPDE-KDMEAPVINGNGTETGQIISATIGGRDGKPKQTISY  129

Query  559  MAERVVGTGSF  591
            MAERV+G GSF
Sbjct  130  MAERVIGRGSF  140



>gb|KHG02100.1| Shaggy-related protein kinase theta [Gossypium arboreum]
Length=416

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 101/158 (64%), Gaps = 7/158 (4%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+AS RSS+SD  G   + KR KV Q+ + +  G+    +  T+ P H  AS
Sbjct  1    MNVMRRLKSIASSRSSISDSGGDSFT-KRAKVDQEAEFKATGESNISDRSTSGPEHHMAS  59

Query  322  TSQEDASGISLVAR-----SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  486
            TS E A+  S  A      +EK   ++LP EMHEM+I+D+K+    + KD+   VI GNG
Sbjct  60   TSSETAASTSNAASSSSNITEKLDLDQLPNEMHEMRIRDEKTTGHYD-KDVGSNVINGNG  118

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TE GQII T VGGR G  KQ +SYMAERVVGTGSF  V
Sbjct  119  TEAGQIITTVVGGRGGHPKQTISYMAERVVGTGSFGVV  156



>gb|KHG02099.1| Shaggy-related protein kinase theta [Gossypium arboreum]
Length=471

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 101/158 (64%), Gaps = 7/158 (4%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+AS RSS+SD  G   + KR KV Q+ + +  G+    +  T+ P H  AS
Sbjct  1    MNVMRRLKSIASSRSSISDSGGDSFT-KRAKVDQEAEFKATGESNISDRSTSGPEHHMAS  59

Query  322  TSQEDASGISLVAR-----SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  486
            TS E A+  S  A      +EK   ++LP EMHEM+I+D+K+    + KD+   VI GNG
Sbjct  60   TSSETAASTSNAASSSSNITEKLDLDQLPNEMHEMRIRDEKTTGHYD-KDVGSNVINGNG  118

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TE GQII T VGGR G  KQ +SYMAERVVGTGSF  V
Sbjct  119  TEAGQIITTVVGGRGGHPKQTISYMAERVVGTGSFGVV  156



>gb|KJB24672.1| hypothetical protein B456_004G156700 [Gossypium raimondii]
Length=409

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 98/155 (63%), Gaps = 7/155 (5%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+AS RSS+SD  G   + KR KV Q+ + +  G+    +  T  P H  AS
Sbjct  1    MNVMRRLKSIASSRSSISDSGGDSFT-KRAKVDQESEFKATGESNISDRSTPGPEHHMAS  59

Query  322  TSQEDASGISLVAR-----SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  486
            TS E  +  S  A      +EK   ++LP EMHEM+I+D+K+    + KD+   VI GNG
Sbjct  60   TSSETVASTSNAASSSSNITEKLDLDQLPNEMHEMRIRDEKTTGHYD-KDVGSNVINGNG  118

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TE GQII T VGGR G  KQ +SYMAERVVGTGSF
Sbjct  119  TEAGQIITTVVGGRGGHPKQTISYMAERVVGTGSF  153



>gb|KJB24673.1| hypothetical protein B456_004G156700 [Gossypium raimondii]
Length=422

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 98/155 (63%), Gaps = 7/155 (5%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+AS RSS+SD  G   + KR KV Q+ + +  G+    +  T  P H  AS
Sbjct  1    MNVMRRLKSIASSRSSISDSGGDSFT-KRAKVDQESEFKATGESNISDRSTPGPEHHMAS  59

Query  322  TSQEDASGISLVAR-----SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  486
            TS E  +  S  A      +EK   ++LP EMHEM+I+D+K+    + KD+   VI GNG
Sbjct  60   TSSETVASTSNAASSSSNITEKLDLDQLPNEMHEMRIRDEKTTGHYD-KDVGSNVINGNG  118

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TE GQII T VGGR G  KQ +SYMAERVVGTGSF
Sbjct  119  TEAGQIITTVVGGRGGHPKQTISYMAERVVGTGSF  153



>gb|KJB24671.1| hypothetical protein B456_004G156700 [Gossypium raimondii]
Length=471

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 99/158 (63%), Gaps = 7/158 (4%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMHEAAS  321
            MNVMRRLKS+AS RSS+SD  G   + KR KV Q+ + +  G+    +  T  P H  AS
Sbjct  1    MNVMRRLKSIASSRSSISDSGGDSFT-KRAKVDQESEFKATGESNISDRSTPGPEHHMAS  59

Query  322  TSQEDASGISLVAR-----SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  486
            TS E  +  S  A      +EK   ++LP EMHEM+I+D+K+    + KD+   VI GNG
Sbjct  60   TSSETVASTSNAASSSSNITEKLDLDQLPNEMHEMRIRDEKTTGHYD-KDVGSNVINGNG  118

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TE GQII T VGGR G  KQ +SYMAERVVGTGSF  V
Sbjct  119  TEAGQIITTVVGGRGGHPKQTISYMAERVVGTGSFGVV  156



>ref|XP_002987888.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
 ref|XP_002994033.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ04915.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ10962.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
Length=423

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = +1

Query  352  LVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRN  531
            +V++   SG ++LP+EMHEMKI+DDK+D+ ++ K++E  V+ GNGTETG II TT+GGRN
Sbjct  20   VVSKVGGSGVDQLPEEMHEMKIRDDKTDHSDD-KELEATVVDGNGTETGHIIATTIGGRN  78

Query  532  GEQKQVLSYMAERVVGTGSF  591
            G+ KQ +SY+AERVVGTGSF
Sbjct  79   GQPKQTISYVAERVVGTGSF  98



>gb|KJB41235.1| hypothetical protein B456_007G096100 [Gossypium raimondii]
 gb|KJB41236.1| hypothetical protein B456_007G096100 [Gossypium raimondii]
Length=413

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 69/95 (73%), Gaps = 4/95 (4%)
 Frame = +1

Query  316  ASTSQEDASGISLV---ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNG  486
            AS+S E  +  S V   AR+EK   + LP EMHEM+I+D+K+ + +  KDME  VI GNG
Sbjct  2    ASSSLETVASTSYVTSVARTEKPDVDLLPNEMHEMRIRDEKTADPDE-KDMEAPVINGNG  60

Query  487  TETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TETGQII  T+GGR+G+ KQ +SYMAERV+G GSF
Sbjct  61   TETGQIISATIGGRDGKPKQTISYMAERVIGRGSF  95



>ref|XP_001762052.1| predicted protein [Physcomitrella patens]
 gb|EDQ73156.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 8/99 (8%)
 Frame = +1

Query  316  ASTSQEDASGISLV-------ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVI  474
            AS +    SG +++        ++  SG E LPKEMHEMK++DDK D+ ++ K++E  V+
Sbjct  2    ASATAAAVSGTNMIGGGRAAPTKAGSSGVELLPKEMHEMKLRDDKVDHGDD-KEIEATVV  60

Query  475  TGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
             GNGTETG II TT+GGRNG+ KQ +SY AERVVGTGSF
Sbjct  61   DGNGTETGHIIATTIGGRNGQPKQTISYSAERVVGTGSF  99



>gb|AAQ23109.1| shaggy-related protein kinase 4 [Physcomitrella patens]
Length=424

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 71/99 (72%), Gaps = 8/99 (8%)
 Frame = +1

Query  316  ASTSQEDASGISLV-------ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVI  474
            AS++    SG +++        ++  SG E LPKEMHEMK++DDK D+ ++ K++E  V+
Sbjct  2    ASSTAGAVSGTNMIGGGRAAPTKAGSSGVELLPKEMHEMKLRDDKVDHGDD-KEIEATVV  60

Query  475  TGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
             GNGTETG II TT+GGRNG+ KQ +SY AERVVGTGSF
Sbjct  61   DGNGTETGHIIATTIGGRNGQPKQTISYSAERVVGTGSF  99



>emb|CDY19757.1| BnaA09g04100D [Brassica napus]
Length=406

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 61/78 (78%), Gaps = 8/78 (10%)
 Frame = +1

Query  358  ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGE  537
            AR   +G ++LP+EM++MK++DDK        +MEPVV+ GNGTETG IIVTT+GGRNG+
Sbjct  12   ARDSTTGLDKLPEEMNDMKLRDDK--------EMEPVVVDGNGTETGHIIVTTIGGRNGQ  63

Query  538  QKQVLSYMAERVVGTGSF  591
             KQ +SYMAERVVG GSF
Sbjct  64   PKQTISYMAERVVGQGSF  81



>ref|XP_001763270.1| predicted protein [Physcomitrella patens]
 gb|AAQ23106.1| shaggy-related protein kinase 1 [Physcomitrella patens]
 gb|EDQ71800.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 67/93 (72%), Gaps = 1/93 (1%)
 Frame = +1

Query  313  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            A  TS  +  G     ++  SG E LPKEMH+MK++D+K D+ ++ K++E  V+ GNGTE
Sbjct  6    AGVTSSTNMIGGGAPIKAGSSGVESLPKEMHDMKLRDEKVDHSDD-KEIEASVVAGNGTE  64

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TG II TT+GGRNG+ KQ +SY AERVVGTGSF
Sbjct  65   TGHIIATTIGGRNGQPKQTISYCAERVVGTGSF  97



>emb|CDX87033.1| BnaC09g03480D [Brassica napus]
Length=406

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 61/78 (78%), Gaps = 8/78 (10%)
 Frame = +1

Query  358  ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGE  537
            AR   +G ++LP+EM++MK++DDK        +MEP+V+ GNGTETG IIVTT+GGRNG+
Sbjct  12   ARDSTTGLDKLPEEMNDMKLRDDK--------EMEPIVVDGNGTETGHIIVTTIGGRNGQ  63

Query  538  QKQVLSYMAERVVGTGSF  591
             KQ +SYMAERVVG GSF
Sbjct  64   PKQTISYMAERVVGQGSF  81



>gb|AAQ23111.1| shaggy-related protein kinase 1 [Physcomitrella patens]
Length=410

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            SG E LPKEMH+MK++D+K D+ ++ K++E  V+ GNGTETG II TT+GGRNG+ KQ +
Sbjct  14   SGVESLPKEMHDMKLRDEKVDHSDD-KEIEASVVAGNGTETGHIIATTIGGRNGQPKQTI  72

Query  553  SYMAERVVGTGSF  591
            SY AERVVGTGSF
Sbjct  73   SYCAERVVGTGSF  85



>gb|ABR68632.1| RIM11-like protein [Oryza sativa Japonica Group]
Length=419

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 6/95 (6%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            ASTS     G     R+E++G + LPKEM+EM I DDK D  N+ K+ E V++  NGTET
Sbjct  16   ASTSTSKNPG-----RTEEAGADILPKEMNEMTISDDKVDGHND-KESEGVIVNANGTET  69

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            GQIIVT++GG+NG+ KQ +SYMAERVVGTGSF  V
Sbjct  70   GQIIVTSIGGQNGKPKQKVSYMAERVVGTGSFGVV  104



>ref|XP_001781582.1| predicted protein [Physcomitrella patens]
 gb|EDQ53633.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            SG E LPKEMH+MK++DDK D+ ++ K++E  ++ GNGTETG II TT+GGRNG+ KQ +
Sbjct  27   SGVELLPKEMHDMKLRDDKVDHSDD-KEIEASIVDGNGTETGHIIATTIGGRNGQPKQTI  85

Query  553  SYMAERVVGTGSF  591
            SY AERVVGTGSF
Sbjct  86   SYSAERVVGTGSF  98



>gb|AAQ23108.1| shaggy-related protein kinase 3 [Physcomitrella patens]
 gb|AAQ23113.1| shaggy-related protein kinase 3 [Physcomitrella patens]
Length=423

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            SG E LPKEMH+MK++DDK D+ ++ K++E  ++ GNGTETG II TT+GGRNG+ KQ +
Sbjct  27   SGVELLPKEMHDMKLRDDKVDHSDD-KEIEASIVDGNGTETGHIIATTIGGRNGQPKQTI  85

Query  553  SYMAERVVGTGSF  591
            SY AERVVGTGSF
Sbjct  86   SYSAERVVGTGSF  98



>ref|XP_001765207.1| predicted protein [Physcomitrella patens]
 gb|EDQ69935.1| predicted protein [Physcomitrella patens]
Length=424

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 58/73 (79%), Gaps = 1/73 (1%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            SG E LPKEMH MK++DDK D+ ++ K+ E  V+ GNGTETG II TT+GGRNG+ KQ +
Sbjct  28   SGVESLPKEMHGMKLRDDKVDHSDD-KEFEATVVDGNGTETGHIIATTIGGRNGQPKQTI  86

Query  553  SYMAERVVGTGSF  591
            SY AERVVGTGSF
Sbjct  87   SYSAERVVGTGSF  99



>ref|XP_011079505.1| PREDICTED: shaggy-related protein kinase alpha-like [Sesamum 
indicum]
Length=413

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 9/88 (10%)
 Frame = +1

Query  337  ASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTT  516
            ASG+   +R +  G ++LP EM+EMK++DDK        DMEP VI GNGTETG IIVTT
Sbjct  9    ASGVRDPSR-KAGGLDKLPDEMNEMKLRDDK--------DMEPAVIDGNGTETGHIIVTT  59

Query  517  VGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            +GGRNG+ KQ +SYMAER+VG GSF  V
Sbjct  60   IGGRNGQPKQTISYMAERIVGQGSFGVV  87



>gb|AAQ23107.1| shaggy-related protein kinase 2 [Physcomitrella patens]
 gb|AAQ23112.1| shaggy-related protein kinase 2 [Physcomitrella patens]
Length=423

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            SG E LPKEMH+MK++DDK D+ ++ K++E  V+ GNGTETG II TT+GG+NG+ KQ +
Sbjct  27   SGVESLPKEMHDMKLRDDKVDHSDD-KEIEASVVDGNGTETGHIIATTIGGKNGQPKQTI  85

Query  553  SYMAERVVGTGSF  591
            SY AERVVGTGSF
Sbjct  86   SYSAERVVGTGSF  98



>ref|XP_001763265.1| predicted protein [Physcomitrella patens]
 gb|EDQ71795.1| predicted protein [Physcomitrella patens]
Length=423

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            SG E LPKEMH+MK++DDK D+ ++ K++E  V+ GNGTETG II TT+GG+NG+ KQ +
Sbjct  27   SGVESLPKEMHDMKLRDDKVDHSDD-KEIEASVVDGNGTETGHIIATTIGGKNGQPKQTI  85

Query  553  SYMAERVVGTGSF  591
            SY AERVVGTGSF
Sbjct  86   SYSAERVVGTGSF  98



>ref|XP_009111716.1| PREDICTED: shaggy-related protein kinase alpha-like [Brassica 
rapa]
Length=406

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 8/78 (10%)
 Frame = +1

Query  358  ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGE  537
            AR   +  ++LP+EM++MK++DDK        +MEP+V+ GNGTETG IIVTT+GGRNG+
Sbjct  12   ARDSTTSLDKLPEEMNDMKLRDDK--------EMEPIVVDGNGTETGHIIVTTIGGRNGQ  63

Query  538  QKQVLSYMAERVVGTGSF  591
             KQ +SYMAERVVG GSF
Sbjct  64   PKQTISYMAERVVGQGSF  81



>gb|KJB22347.1| hypothetical protein B456_004G042400 [Gossypium raimondii]
Length=442

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 68/93 (73%), Gaps = 6/93 (6%)
 Frame = +1

Query  313  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
             ASTS+     +  VAR +    ++LP EM EM+I+D+K+ + ++ KD E  VI GNGTE
Sbjct  38   VASTSR-----VPSVARQQNLVVDQLPNEMREMRIRDEKTVSHDD-KDPEATVINGNGTE  91

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TGQII TTVGG+NG+ KQ +SYMAERVVGTGSF
Sbjct  92   TGQIISTTVGGQNGQPKQTMSYMAERVVGTGSF  124



>ref|XP_001781586.1| predicted protein [Physcomitrella patens]
 gb|EDQ53637.1| predicted protein [Physcomitrella patens]
Length=424

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 1/73 (1%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            SG E LPKEMH MK++DDK D+ ++ K++E  V+ GNGTETG II TT+GG+NG+ KQ +
Sbjct  27   SGVESLPKEMHGMKLRDDKVDHSDD-KEIEASVVDGNGTETGHIIATTIGGKNGQPKQTI  85

Query  553  SYMAERVVGTGSF  591
            SY AERVVGTGSF
Sbjct  86   SYSAERVVGTGSF  98



>ref|XP_010674528.1| PREDICTED: shaggy-related protein kinase alpha [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674529.1| PREDICTED: shaggy-related protein kinase alpha [Beta vulgaris 
subsp. vulgaris]
Length=407

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 57/75 (76%), Gaps = 8/75 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G + LP+EM++MKI+DDK        DMEP V+ GNGTETG IIVTT+GG+NG+ KQ +S
Sbjct  19   GVDRLPEEMNDMKIRDDK--------DMEPTVVDGNGTETGHIIVTTIGGKNGQPKQTIS  70

Query  556  YMAERVVGTGSFWSV  600
            YMAERVVG GSF  V
Sbjct  71   YMAERVVGQGSFGVV  85



>gb|KJB45482.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=275

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 64/95 (67%), Gaps = 11/95 (12%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS      SG+     S  +G E+LP+EM++MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVGMVPTSGLR---ESSTAGVEKLPEEMNDMKIRDDK--------EMEATVVDGNGTET  50

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSF  V
Sbjct  51   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVV  85



>gb|KDP23349.1| hypothetical protein JCGZ_23182 [Jatropha curcas]
Length=408

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 64/96 (67%), Gaps = 15/96 (16%)
 Frame = +1

Query  313  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
             A T   +ASG         +G ++LP+EM+EMKI+DDK        +ME  V+ GNGTE
Sbjct  6    VAPTGLREASG-------HNAGVDKLPEEMNEMKIRDDK--------EMEATVVDGNGTE  50

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            TG IIVTT+GGRNG+ KQ +SYMAERVVG GSF  V
Sbjct  51   TGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVV  86



>gb|EPS63877.1| hypothetical protein M569_10905 [Genlisea aurea]
Length=409

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 8/75 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G + LP EM+EMK++DDK        D+EP V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GLDRLPDEMNEMKLRDDK--------DIEPAVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  556  YMAERVVGTGSFWSV  600
            YMAER+VG GSF  V
Sbjct  73   YMAERIVGQGSFGVV  87



>ref|XP_008803035.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Phoenix dactylifera]
Length=443

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 84/132 (64%), Gaps = 14/132 (11%)
 Frame = +1

Query  220  IKRVKVAQDFDQRIAGKPES--------EEICTTAPMHEAASTSQEDASGISLVARSEKS  375
            +K+VKV QD + +   +           E++ T+A +   ASTS +  +      R + +
Sbjct  1    MKKVKVEQDVEGKECTEHSVVENKAMGLEQLTTSAHLDSDASTSSKGPT-----TRLKNA  55

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G ++L KEMHEM I++DK+D  N+ K+++  VI G  TETG +I TT+GG+NG+ KQ +S
Sbjct  56   GIDQLSKEMHEMTIRNDKADGHND-KNVKATVIKGKSTETGHLITTTIGGQNGQPKQTIS  114

Query  556  YMAERVVGTGSF  591
            YMA+RVVGTGSF
Sbjct  115  YMADRVVGTGSF  126



>gb|ABK93098.1| unknown [Populus trichocarpa]
Length=409

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 8/76 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G ++LP+EM++MKI+DDK        DME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDKLPEEMNDMKIRDDK--------DMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  553  SYMAERVVGTGSFWSV  600
            SYMAERVVG GSF  V
Sbjct  72   SYMAERVVGNGSFGVV  87



>ref|XP_002319468.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
 gb|EEE95391.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
Length=409

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 8/76 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G ++LP+EM++MKI+DDK        DME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDKLPEEMNDMKIRDDK--------DMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  553  SYMAERVVGTGSFWSV  600
            SYMAERVVG GSF  V
Sbjct  72   SYMAERVVGNGSFGVV  87



>ref|XP_009400716.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=451

 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 88/142 (62%), Gaps = 13/142 (9%)
 Frame = +1

Query  142  MNVMRRLKSVASGRSSVSDPQGGDSSIKRVKVAQDFDQRIAGKPESE-----EICTTAPM  306
            M++M+RLKS+ASGRSSVSDP GGD + KR K    FDQ   G+   E     ++ +T  +
Sbjct  1    MHMMQRLKSIASGRSSVSDP-GGDLTTKRAK----FDQEGGGEILVERHMVDDVASTVDL  55

Query  307  HEAASTSQEDASGISL--VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITG  480
            H ++S    DAS ++    AR E +  ++LP+EMH M I+D K+D      + +  +I G
Sbjct  56   HISSSHLNFDASTLTTEPPARFEGATMDQLPREMHGMTIRDIKTDGHIE-TEFDGTMING  114

Query  481  NGTETGQIIVTTVGGRNGEQKQ  546
             GT TGQI+ T +GGR+G+ KQ
Sbjct  115  KGTMTGQILATVIGGRDGQPKQ  136



>gb|KJB45480.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=332

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 63/92 (68%), Gaps = 11/92 (12%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS      SG+     S  +G E+LP+EM++MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVGMVPTSGLR---ESSTAGVEKLPEEMNDMKIRDDK--------EMEATVVDGNGTET  50

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSF
Sbjct  51   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  82



>gb|KJB45479.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
 gb|KJB45481.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=407

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 64/95 (67%), Gaps = 11/95 (12%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS      SG+     S  +G E+LP+EM++MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVGMVPTSGLR---ESSTAGVEKLPEEMNDMKIRDDK--------EMEATVVDGNGTET  50

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSF  V
Sbjct  51   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVV  85



>ref|XP_007031229.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
 gb|EOY11731.1| Shaggy-related kinase 11, 11 isoform 1 [Theobroma cacao]
Length=407

 Score = 95.5 bits (236),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 61/81 (75%), Gaps = 8/81 (10%)
 Frame = +1

Query  349  SLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGR  528
            S++  S  +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGR
Sbjct  10   SVLRESNAAGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGR  61

Query  529  NGEQKQVLSYMAERVVGTGSF  591
            NG+ KQ +SYMAERVVG GSF
Sbjct  62   NGQPKQTISYMAERVVGHGSF  82



>emb|CAL07991.1| shaggy/glycogen synthase kinase-3 like protein [Platanus x acerifolia]
Length=109

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 8/73 (11%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            + LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DRLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQAISYM  74

Query  562  AERVVGTGSFWSV  600
            AERVVG GSF  V
Sbjct  75   AERVVGHGSFGIV  87



>ref|XP_006382290.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 ref|XP_006382291.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 ref|XP_006382292.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
 gb|ERP60087.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60088.1| hypothetical protein POPTR_0005s00710g [Populus trichocarpa]
 gb|ERP60089.1| Glycogen synthase kinase-3 MsK-1 family protein [Populus trichocarpa]
Length=409

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 59/78 (76%), Gaps = 8/78 (10%)
 Frame = +1

Query  358  ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGE  537
            A +  +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+
Sbjct  15   ASAHNAGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQ  66

Query  538  QKQVLSYMAERVVGTGSF  591
             KQ +SYMAERVVG GSF
Sbjct  67   PKQTISYMAERVVGHGSF  84



>ref|XP_010455024.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010455025.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 8/73 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G E+LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  23   TGVEKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  74

Query  553  SYMAERVVGTGSF  591
            SYMAERVVG GSF
Sbjct  75   SYMAERVVGHGSF  87



>ref|XP_006289925.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
 gb|EOA22823.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
Length=409

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 8/76 (11%)
 Frame = +1

Query  364  SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQK  543
            +  SG ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ K
Sbjct  17   AHASGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPK  68

Query  544  QVLSYMAERVVGTGSF  591
            Q +SYMAERVVG GSF
Sbjct  69   QTISYMAERVVGHGSF  84



>gb|EMT29598.1| Shaggy-related protein kinase theta [Aegilops tauschii]
Length=513

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 84/137 (61%), Gaps = 13/137 (9%)
 Frame = +1

Query  205  GGDSSIKRVKVAQDFDQRIAGKPESEEICTTAPMH-------EAASTSQEDASGISL-VA  360
            GGDS  KR K  QD    I  +P   +     PMH        ++    E ++  S+  A
Sbjct  64   GGDSGSKRPKFDQDGLGDIVIQPHLSD---DKPMHLDQESSSSSSHRDAEASTSTSMNPA  120

Query  361  RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQ  540
            ++E++G  +LPK M++M I DDK    NN K+ E V + GNGTE GQIIVTT+GG+NG+ 
Sbjct  121  KAEETG-ADLPKGMNDMTISDDKV-GHNNDKEAEGVTVDGNGTEAGQIIVTTIGGQNGKP  178

Query  541  KQVLSYMAERVVGTGSF  591
            KQ +SYMAERVVGTGSF
Sbjct  179  KQKVSYMAERVVGTGSF  195



>gb|EYU46859.1| hypothetical protein MIMGU_mgv1a007395mg [Erythranthe guttata]
 gb|EYU46860.1| hypothetical protein MIMGU_mgv1a007395mg [Erythranthe guttata]
Length=409

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 63/95 (66%), Gaps = 9/95 (9%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS S   + G+    R   S  + LP EM+EMK++D+K        DMEP V+ GNGTET
Sbjct  2    ASVSVAPSLGVRDPGRKTGS-LDRLPDEMNEMKLRDEK--------DMEPAVVDGNGTET  52

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            G IIVTT+GGRNG+ KQ +SYMAER+VG GSF  V
Sbjct  53   GHIIVTTIGGRNGQPKQTISYMAERIVGQGSFGVV  87



>gb|EPS68300.1| hypothetical protein M569_06467 [Genlisea aurea]
Length=411

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 8/73 (11%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            + LP EM+EMKI+DDK        D+EP V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  24   DRLPDEMNEMKIRDDK--------DIEPAVVDGNGTETGHIIVTTIGGRNGQPKQKISYM  75

Query  562  AERVVGTGSFWSV  600
            AER+VG GSF  V
Sbjct  76   AERIVGQGSFGVV  88



>ref|XP_002512564.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF50016.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=383

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 62/93 (67%), Gaps = 15/93 (16%)
 Frame = +1

Query  313  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
             A T   +ASG          G ++LP+EM++MKI+DDK        +ME  V+ GNGTE
Sbjct  6    VAPTGLREASG-------HNVGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTE  50

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TG IIVTT+GGRNG+ KQ +SYMAERVVG GSF
Sbjct  51   TGHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  83



>ref|XP_010660897.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Vitis 
vinifera]
Length=393

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 5/70 (7%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKI+DDK +     K+ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  4    DKLPEEINEMKIRDDKVE-----KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  58

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  59   AERVVGQGSF  68



>ref|XP_007031504.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 ref|XP_007031505.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02430.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02431.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
Length=412

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 57/70 (81%), Gaps = 5/70 (7%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKIKD+K +     K+ME  V+ GNGTETG IIVTT+GGRNGE KQ +SYM
Sbjct  23   DKLPEEINEMKIKDEKVE-----KEMEATVVDGNGTETGHIIVTTIGGRNGEPKQTISYM  77

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  78   AERVVGQGSF  87



>ref|XP_010660896.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Vitis 
vinifera]
 emb|CBI34900.3| unnamed protein product [Vitis vinifera]
Length=412

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 57/70 (81%), Gaps = 5/70 (7%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKI+DDK +     K+ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DKLPEEINEMKIRDDKVE-----KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  77

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  78   AERVVGQGSF  87



>ref|XP_007031506.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
 gb|EOY02432.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
Length=413

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 57/70 (81%), Gaps = 5/70 (7%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKIKD+K +     K+ME  V+ GNGTETG IIVTT+GGRNGE KQ +SYM
Sbjct  23   DKLPEEINEMKIKDEKVE-----KEMEATVVDGNGTETGHIIVTTIGGRNGEPKQTISYM  77

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  78   AERVVGQGSF  87



>ref|XP_010524830.1| PREDICTED: shaggy-related protein kinase alpha-like [Tarenaya 
hassleriana]
Length=409

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 63/93 (68%), Gaps = 15/93 (16%)
 Frame = +1

Query  313  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
            A ++   D++G         SG + LP+EM++MKI+DDK        +ME  V+ GNGTE
Sbjct  7    APTSGARDSTG-------HASGVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTE  51

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TG IIVTT+GGRNG+ KQ +SYMAERVVG GSF
Sbjct  52   TGHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  84



>gb|AEQ94143.1| putative Glycogen synthase kinase 3 [Elaeis guineensis]
Length=231

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 55/75 (73%), Gaps = 8/75 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G + LP EM+EMKI+DDK        ++E  VI GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDRLPDEMNEMKIRDDK--------EVEATVIDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  556  YMAERVVGTGSFWSV  600
            YMAERVVG GSF  V
Sbjct  73   YMAERVVGHGSFGVV  87



>ref|XP_003554602.1| PREDICTED: shaggy-related protein kinase alpha-like isoform 1 
[Glycine max]
Length=406

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 8/75 (11%)
 Frame = +1

Query  367  EKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQ  546
            E SG + LP+EM++M+I+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ
Sbjct  15   ESSGVDRLPEEMNDMRIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQ  66

Query  547  VLSYMAERVVGTGSF  591
             +SYMAER+VG GSF
Sbjct  67   TISYMAERIVGHGSF  81



>ref|XP_006394905.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
 gb|ESQ32191.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
Length=409

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 59/76 (78%), Gaps = 8/76 (11%)
 Frame = +1

Query  364  SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQK  543
            ++ +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ K
Sbjct  17   AQATGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPK  68

Query  544  QVLSYMAERVVGTGSF  591
            Q +SYMAERVVG GSF
Sbjct  69   QTISYMAERVVGHGSF  84



>ref|NP_001242406.1| uncharacterized protein LOC100788612 [Glycine max]
 gb|ACU21024.1| unknown [Glycine max]
Length=406

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 8/75 (11%)
 Frame = +1

Query  367  EKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQ  546
            E SG + LP+EM++M+I+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ
Sbjct  15   ESSGVDRLPEEMNDMRIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQ  66

Query  547  VLSYMAERVVGTGSF  591
             +SYMAER+VG GSF
Sbjct  67   TISYMAERIVGHGSF  81



>ref|XP_011023844.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011023845.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
Length=409

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 8/73 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G ++LP+EM++MKI+D+K        DME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDKLPEEMNDMKIRDEK--------DMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  553  SYMAERVVGTGSF  591
            SYMAERVVG GSF
Sbjct  72   SYMAERVVGNGSF  84



>ref|XP_006576226.1| PREDICTED: uncharacterized protein LOC100788612 isoform X1 [Glycine 
max]
 gb|KHN14222.1| Shaggy-related protein kinase alpha [Glycine soja]
Length=406

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 8/75 (11%)
 Frame = +1

Query  367  EKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQ  546
            E SG + LP+EM++M+I+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ
Sbjct  15   ESSGVDRLPEEMNDMRIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQ  66

Query  547  VLSYMAERVVGTGSF  591
             +SYMAER+VG GSF
Sbjct  67   TISYMAERIVGHGSF  81



>ref|XP_011039006.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039008.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039009.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039010.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
 ref|XP_011039011.1| PREDICTED: shaggy-related protein kinase alpha [Populus euphratica]
Length=409

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 58/78 (74%), Gaps = 8/78 (10%)
 Frame = +1

Query  358  ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGE  537
            A    +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+
Sbjct  15   ASVHNAGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQ  66

Query  538  QKQVLSYMAERVVGTGSF  591
             KQ +SYMAERVVG GSF
Sbjct  67   PKQTISYMAERVVGHGSF  84



>gb|EPS73818.1| hypothetical protein M569_00937, partial [Genlisea aurea]
Length=408

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 65/95 (68%), Gaps = 9/95 (9%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            A+TS + +SG+    + +  G + LP EM+EMK++DDK        D+EP V+ GN TET
Sbjct  2    AATSVDSSSGVRDPTK-KPGGMDRLPDEMNEMKLRDDK--------DIEPAVVDGNVTET  52

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            G IIVTT+GGRNG+ KQ + YMAER+VG GSF  V
Sbjct  53   GHIIVTTIGGRNGQPKQTIGYMAERIVGQGSFGVV  87



>ref|XP_004495628.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X4 [Cicer arietinum]
Length=410

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 63/95 (66%), Gaps = 8/95 (8%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS      SG+   +    +G + LP+EM++MKI+DD+        +ME  V+ GNGTET
Sbjct  2    ASVGVAPTSGLRETSGHAAAGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTET  53

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSF  V
Sbjct  54   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVV  88



>gb|AEQ94156.1| shaggy-related protein kinase [Elaeis guineensis]
Length=216

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 55/75 (73%), Gaps = 8/75 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G + LP EM+EMKI+DDK        ++E  VI GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDRLPDEMNEMKIRDDK--------EVEATVIDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  556  YMAERVVGTGSFWSV  600
            YMAERVVG GSF  V
Sbjct  73   YMAERVVGHGSFGVV  87



>emb|CAA53181.1| shaggy related kinase [Arabidopsis thaliana]
 emb|CAA48538.1| serine /threonine protein kinase [Arabidopsis thaliana]
Length=405

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 8/75 (11%)
 Frame = +1

Query  367  EKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQ  546
            + +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ
Sbjct  14   DSTGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQ  65

Query  547  VLSYMAERVVGTGSF  591
             +SYMAERVVG GSF
Sbjct  66   TISYMAERVVGHGSF  80



>ref|XP_004495625.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004495626.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X2 [Cicer arietinum]
 ref|XP_004495627.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-1-like isoform 
X3 [Cicer arietinum]
Length=434

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 63/95 (66%), Gaps = 8/95 (8%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS      SG+   +    +G + LP+EM++MKI+DD+        +ME  V+ GNGTET
Sbjct  2    ASVGVAPTSGLRETSGHAAAGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTET  53

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSF  V
Sbjct  54   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVV  88



>emb|CAA04265.1| shaggy-like kinase alpha [Arabidopsis thaliana]
Length=405

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 8/75 (11%)
 Frame = +1

Query  367  EKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQ  546
            + +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ
Sbjct  14   DSTGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQ  65

Query  547  VLSYMAERVVGTGSF  591
             +SYMAERVVG GSF
Sbjct  66   TISYMAERVVGHGSF  80



>emb|CAA58594.1| Petunia Shaggy kinase 4 [Petunia x hybrida]
Length=409

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 65/89 (73%), Gaps = 9/89 (10%)
 Frame = +1

Query  337  ASGISLVA----RSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQI  504
            ASGI   A    R++    ++LP+E++EMKI+DDK++     K+ME  V+ GNGTE G I
Sbjct  2    ASGIMPSAGGKHRTDAMLVDKLPEEINEMKIRDDKAE-----KEMEAAVVDGNGTEKGHI  56

Query  505  IVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            IVTT+GG+NGE KQ +SYMAERVVG GSF
Sbjct  57   IVTTIGGKNGEPKQTISYMAERVVGQGSF  85



>ref|NP_568486.1| Shaggy-related protein kinase alpha [Arabidopsis thaliana]
 sp|P43288.3|KSG1_ARATH RecName: Full=Shaggy-related protein kinase alpha; AltName: Full=ASK-alpha 
[Arabidopsis thaliana]
 gb|AAL16257.1|AF428327_1 AT5g26750/F2P16_10 [Arabidopsis thaliana]
 gb|AAK76698.1| putative shaggy kinase alpha [Arabidopsis thaliana]
 gb|AAN13164.1| putative shaggy kinase alpha [Arabidopsis thaliana]
 gb|AED93596.1| Shaggy-related protein kinase alpha [Arabidopsis thaliana]
Length=405

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 8/75 (11%)
 Frame = +1

Query  367  EKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQ  546
            + +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ
Sbjct  14   DSTGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQ  65

Query  547  VLSYMAERVVGTGSF  591
             +SYMAERVVG GSF
Sbjct  66   TISYMAERVVGHGSF  80



>ref|XP_010493927.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
 ref|XP_010493928.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
Length=412

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 8/73 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  23   TGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  74

Query  553  SYMAERVVGTGSF  591
            SYMAERVVG GSF
Sbjct  75   SYMAERVVGHGSF  87



>ref|XP_010421531.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010421533.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 8/73 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  23   TGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  74

Query  553  SYMAERVVGTGSF  591
            SYMAERVVG GSF
Sbjct  75   SYMAERVVGHGSF  87



>gb|KHG02936.1| Shaggy-related protein kinase alpha [Gossypium arboreum]
 gb|KHG22311.1| Shaggy-related protein kinase alpha [Gossypium arboreum]
Length=407

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 62/92 (67%), Gaps = 11/92 (12%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS      SG+     S  +  E+LP+EM++MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVGMVPTSGLR---ESSTASVEKLPEEMNDMKIRDDK--------EMEATVVDGNGTET  50

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSF
Sbjct  51   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  82



>ref|XP_010546768.1| PREDICTED: shaggy-related protein kinase alpha [Tarenaya hassleriana]
Length=399

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 59/79 (75%), Gaps = 8/79 (10%)
 Frame = +1

Query  355  VARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNG  534
            V  +  SG ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GG+NG
Sbjct  4    VGVAPASGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGKNG  55

Query  535  EQKQVLSYMAERVVGTGSF  591
            + KQ +SYMAERVVG GSF
Sbjct  56   QPKQTISYMAERVVGHGSF  74



>ref|XP_011092192.1| PREDICTED: shaggy-related protein kinase alpha [Sesamum indicum]
Length=409

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 8/81 (10%)
 Frame = +1

Query  358  ARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGE  537
            A S   G + LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+
Sbjct  15   AGSHAVGVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQ  66

Query  538  QKQVLSYMAERVVGTGSFWSV  600
             KQ +SYMAER+VG GSF  V
Sbjct  67   PKQTISYMAERIVGQGSFGVV  87



>ref|XP_006840718.1| hypothetical protein AMTR_s00096p00102520 [Amborella trichopoda]
 gb|ERN02393.1| hypothetical protein AMTR_s00096p00102520 [Amborella trichopoda]
Length=356

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 57/72 (79%), Gaps = 8/72 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G ++LP+E++EMKIKDDK        +ME  V+ GNGTETGQIIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEINEMKIKDDK--------EMEANVVDGNGTETGQIIVTTIGGRNGQPKQNIS  72

Query  556  YMAERVVGTGSF  591
            YMAERVVG GSF
Sbjct  73   YMAERVVGHGSF  84



>gb|KDO45355.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=371

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 8/72 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  556  YMAERVVGTGSF  591
            YMAER+VG GSF
Sbjct  73   YMAERIVGQGSF  84



>gb|KCW84977.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
Length=293

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 65/102 (64%), Gaps = 20/102 (20%)
 Frame = +1

Query  301  PMHEAAST-----SQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEP  465
            P+H  AS      S  + SG S+       G + LP+EM+EMKI+DDK        +ME 
Sbjct  2    PVHLMASVGIAPNSVREPSGQSV-------GVDRLPEEMNEMKIRDDK--------EMET  46

Query  466  VVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
             V+ GNGTE G IIVTT+GGRNG+ KQ +SYMAERVVG GSF
Sbjct  47   TVVDGNGTEAGHIIVTTIGGRNGQPKQTISYMAERVVGQGSF  88



>ref|XP_002280673.1| PREDICTED: shaggy-related protein kinase alpha [Vitis vinifera]
Length=409

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 8/73 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G + LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  553  SYMAERVVGTGSF  591
            SYMAERVVG GSF
Sbjct  72   SYMAERVVGHGSF  84



>gb|KDO45354.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=353

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 8/72 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  556  YMAERVVGTGSF  591
            YMAER+VG GSF
Sbjct  73   YMAERIVGQGSF  84



>emb|CDX80585.1| BnaC07g28590D [Brassica napus]
Length=402

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 61/84 (73%), Gaps = 8/84 (10%)
 Frame = +1

Query  340  SGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTV  519
            + +S+    + +G ++LP+EM++MKI+DDK        +ME  V+ GN TETG IIVTT+
Sbjct  2    ASVSIPPPRDSTGVDKLPEEMNDMKIRDDK--------EMEATVVDGNSTETGHIIVTTI  53

Query  520  GGRNGEQKQVLSYMAERVVGTGSF  591
            GGRNG+ KQ +SYMAERVVG GSF
Sbjct  54   GGRNGQPKQTISYMAERVVGHGSF  77



>gb|KJB24670.1| hypothetical protein B456_004G156700 [Gossypium raimondii]
Length=415

 Score = 92.8 bits (229),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = +1

Query  364  SEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQK  543
            +EK   ++LP EMHEM+I+D+K+    + KD+   VI GNGTE GQII T VGGR G  K
Sbjct  23   TEKLDLDQLPNEMHEMRIRDEKTTGHYD-KDVGSNVINGNGTEAGQIITTVVGGRGGHPK  81

Query  544  QVLSYMAERVVGTGSF  591
            Q +SYMAERVVGTGSF
Sbjct  82   QTISYMAERVVGTGSF  97



>ref|XP_007205270.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 ref|XP_007205271.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 ref|XP_007205272.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06469.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06470.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
 gb|EMJ06471.1| hypothetical protein PRUPE_ppa006473mg [Prunus persica]
Length=410

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 8/72 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  556  YMAERVVGTGSF  591
            YMAERVVG GSF
Sbjct  73   YMAERVVGHGSF  84



>gb|KDO45353.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=409

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 8/72 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  556  YMAERVVGTGSF  591
            YMAER+VG GSF
Sbjct  73   YMAERIVGQGSF  84



>ref|XP_002874323.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50582.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 56/72 (78%), Gaps = 8/72 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  556  YMAERVVGTGSF  591
            YMAERVVG GSF
Sbjct  73   YMAERVVGHGSF  84



>ref|XP_004252662.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Solanum 
lycopersicum]
 ref|XP_010314527.1| PREDICTED: shaggy-related protein kinase epsilon isoform X2 [Solanum 
lycopersicum]
Length=392

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 57/70 (81%), Gaps = 5/70 (7%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKI+DDK++     K+ME  V+ GNGTE G IIVTT+GG+NGE KQ +SYM
Sbjct  4    DKLPEEINEMKIRDDKAE-----KEMEAAVVDGNGTEKGHIIVTTIGGKNGEPKQTISYM  58

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  59   AERVVGQGSF  68



>gb|KCW78018.1| hypothetical protein EUGRSUZ_D02249 [Eucalyptus grandis]
Length=409

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 2/92 (2%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            ASTS E  +G S  +   K   +++ +  HE +IKDDK+ + +  KD EP VI G+GTET
Sbjct  2    ASTSLEAVAGTSSKSSVSKHSDDQVHRGGHETRIKDDKAFHDD--KDCEPAVINGHGTET  59

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            G II TTVGGR+G+ KQ +SYMAERVVGTGSF
Sbjct  60   GHIITTTVGGRDGQPKQTISYMAERVVGTGSF  91



>ref|XP_006480288.1| PREDICTED: shaggy-related protein kinase alpha-like [Citrus sinensis]
Length=409

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 8/72 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  556  YMAERVVGTGSF  591
            YMAER+VG GSF
Sbjct  73   YMAERIVGQGSF  84



>ref|XP_004252661.1| PREDICTED: shaggy-related protein kinase epsilon isoform X1 [Solanum 
lycopersicum]
Length=410

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 57/70 (81%), Gaps = 5/70 (7%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKI+DDK++     K+ME  V+ GNGTE G IIVTT+GG+NGE KQ +SYM
Sbjct  22   DKLPEEINEMKIRDDKAE-----KEMEAAVVDGNGTEKGHIIVTTIGGKNGEPKQTISYM  76

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  77   AERVVGQGSF  86



>ref|XP_006364003.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006364004.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Solanum tuberosum]
Length=410

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 57/70 (81%), Gaps = 5/70 (7%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKI+DDK++     K+ME  V+ GNGTE G IIVTT+GG+NGE KQ +SYM
Sbjct  22   DKLPEEINEMKIRDDKAE-----KEMEAAVVDGNGTEKGHIIVTTIGGKNGEPKQTISYM  76

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  77   AERVVGQGSF  86



>ref|XP_010042192.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 ref|XP_010042197.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 ref|XP_010042204.1| PREDICTED: shaggy-related protein kinase alpha [Eucalyptus grandis]
 gb|KCW84972.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84973.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84974.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
 gb|KCW84975.1| hypothetical protein EUGRSUZ_B01797 [Eucalyptus grandis]
Length=413

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 65/102 (64%), Gaps = 20/102 (20%)
 Frame = +1

Query  301  PMHEAAST-----SQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEP  465
            P+H  AS      S  + SG S+       G + LP+EM+EMKI+DDK        +ME 
Sbjct  2    PVHLMASVGIAPNSVREPSGQSV-------GVDRLPEEMNEMKIRDDK--------EMET  46

Query  466  VVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
             V+ GNGTE G IIVTT+GGRNG+ KQ +SYMAERVVG GSF
Sbjct  47   TVVDGNGTEAGHIIVTTIGGRNGQPKQTISYMAERVVGQGSF  88



>ref|XP_011003165.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
 ref|XP_011003166.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 62/92 (67%), Gaps = 9/92 (10%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS S   ASG+    R   +G ++LP EM+ MKI DDK        +ME  V+ GNGTET
Sbjct  2    ASVSVVPASGLR-DTRGNTTGIDKLPDEMNGMKISDDK--------EMEAAVVDGNGTET  52

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSF
Sbjct  53   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSF  84



>ref|XP_010276519.1| PREDICTED: shaggy-related protein kinase alpha [Nelumbo nucifera]
 ref|XP_010276520.1| PREDICTED: shaggy-related protein kinase alpha [Nelumbo nucifera]
Length=409

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 8/75 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G + LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  556  YMAERVVGTGSFWSV  600
            YMAERVVG GSF  V
Sbjct  73   YMAERVVGHGSFGVV  87



>gb|ABY60447.1| serine/threonine protein kinase [Adonis aestivalis var. palaestina]
Length=409

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 61/92 (66%), Gaps = 9/92 (10%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS S    SG+         G + LP+EM++MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVSMAPPSGLR-DPTGNAGGADRLPEEMNDMKIRDDK--------EMEATVVDGNGTET  52

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSF
Sbjct  53   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  84



>ref|XP_008781189.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
 ref|XP_008781190.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 62/93 (67%), Gaps = 15/93 (16%)
 Frame = +1

Query  313  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
              S+  ++ SG S+       G + LP EM+EMKI+DDK        ++E  VI GNGTE
Sbjct  7    VPSSRMKNTSGTSV-------GVDRLPDEMNEMKIRDDK--------EVEATVIDGNGTE  51

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TG IIVTT+GGRNG+ KQ +SYMAERVVG GSF
Sbjct  52   TGHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  84



>ref|XP_006841582.1| hypothetical protein AMTR_s00003p00196730 [Amborella trichopoda]
 gb|ERN03257.1| hypothetical protein AMTR_s00003p00196730 [Amborella trichopoda]
Length=409

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 65/92 (71%), Gaps = 9/92 (10%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS S   A+G   ++ S   G ++LP+EM++MKI+DDK        ++E  V+ GNGTET
Sbjct  2    ASVSVVPATGFRELSGS-TMGVDKLPEEMNDMKIRDDK--------EVEATVVDGNGTET  52

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSF
Sbjct  53   GHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  84



>ref|XP_010270906.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010270907.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
Length=409

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 62/92 (67%), Gaps = 9/92 (10%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS S   ASG+         G ++LP+EM+ MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVSIVPASGVK-EPSGNCVGVDKLPEEMNGMKIRDDK--------EMEATVVDGNGTET  52

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            G IIVTT+GGRNG+ KQ +SYMAERVVG GSF
Sbjct  53   GHIIVTTIGGRNGQPKQTISYMAERVVGNGSF  84



>ref|XP_010270905.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 
[Nelumbo nucifera]
Length=434

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 9/94 (10%)
 Frame = +1

Query  310  EAASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGT  489
            + AS S   ASG+         G ++LP+EM+ MKI+DDK        +ME  V+ GNGT
Sbjct  25   QMASVSIVPASGVK-EPSGNCVGVDKLPEEMNGMKIRDDK--------EMEATVVDGNGT  75

Query  490  ETGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            ETG IIVTT+GGRNG+ KQ +SYMAERVVG GSF
Sbjct  76   ETGHIIVTTIGGRNGQPKQTISYMAERVVGNGSF  109



>gb|KHN16033.1| Glycogen synthase kinase-3 like MsK-1 [Glycine soja]
Length=411

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 56/73 (77%), Gaps = 8/73 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G + LP+EM++MKI+DD+        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  21   AGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  72

Query  553  SYMAERVVGTGSF  591
            SYMAERVVG GSF
Sbjct  73   SYMAERVVGHGSF  85



>ref|XP_010097328.1| Shaggy-related protein kinase alpha [Morus notabilis]
 gb|EXB67560.1| Shaggy-related protein kinase alpha [Morus notabilis]
Length=522

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 8/73 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  19   AGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  70

Query  553  SYMAERVVGTGSF  591
            SYMAERVVG GSF
Sbjct  71   SYMAERVVGHGSF  83



>gb|ACQ91102.1| glycogen synthase kinase [Glycine max]
Length=410

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 8/76 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G + LP+EM++MKI+DD+        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  21   AGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  72

Query  553  SYMAERVVGTGSFWSV  600
            SYMAERVVG GSF  V
Sbjct  73   SYMAERVVGHGSFGVV  88



>ref|XP_010910596.1| PREDICTED: shaggy-related protein kinase alpha-like [Elaeis guineensis]
Length=409

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 8/72 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G + LP EM+EMKI+DDK        ++E  VI GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDRLPDEMNEMKIRDDK--------EVEATVIDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  556  YMAERVVGTGSF  591
            YMAERVVG GSF
Sbjct  73   YMAERVVGHGSF  84



>ref|XP_006588432.1| PREDICTED: glycogen synthase kinase-3 isoform X1 [Glycine max]
Length=410

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 8/76 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G + LP+EM++MKI+DD+        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  21   AGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  72

Query  553  SYMAERVVGTGSFWSV  600
            SYMAERVVG GSF  V
Sbjct  73   SYMAERVVGHGSFGVV  88



>ref|NP_001242661.1| glycogen synthase kinase-3 [Glycine max]
 gb|ACU18223.1| unknown [Glycine max]
Length=410

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 8/76 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G + LP+EM++MKI+DD+        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  21   AGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  72

Query  553  SYMAERVVGTGSFWSV  600
            SYMAERVVG GSF  V
Sbjct  73   SYMAERVVGHGSFGVV  88



>ref|XP_009775930.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
sylvestris]
 ref|XP_009775931.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
sylvestris]
Length=409

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 8/76 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G + LP+EM++M+I+DDK        +ME  ++ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDRLPEEMNDMRIRDDK--------EMEAAIVDGNGTETGHIIVTTIGGRNGQAKQTI  71

Query  553  SYMAERVVGTGSFWSV  600
            SYMAERVVG GSF  V
Sbjct  72   SYMAERVVGQGSFGVV  87



>ref|XP_009629200.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
 ref|XP_009629201.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
Length=409

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 8/76 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G + LP+EM++M+I+DDK        +ME  ++ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDRLPEEMNDMRIRDDK--------EMEAAIVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  553  SYMAERVVGTGSFWSV  600
            SYMAERVVG GSF  V
Sbjct  72   SYMAERVVGQGSFGVV  87



>ref|XP_004230343.1| PREDICTED: shaggy-related protein kinase NtK-1 [Solanum lycopersicum]
Length=409

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 8/76 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G + LP+EM++M+I+DDK        +ME  ++ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDRLPEEMNDMRIRDDK--------EMEAAIVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  553  SYMAERVVGTGSFWSV  600
            SYMAERVVG GSF  V
Sbjct  72   SYMAERVVGQGSFGVV  87



>ref|XP_010921357.1| PREDICTED: shaggy-related protein kinase alpha [Elaeis guineensis]
Length=409

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 55/75 (73%), Gaps = 8/75 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G + LP EM+EMKI+DDK        ++E  VI GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDRLPDEMNEMKIRDDK--------EVEATVIDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  556  YMAERVVGTGSFWSV  600
            YMAERVVG GSF  V
Sbjct  73   YMAERVVGHGSFGVV  87



>gb|AFH00876.1| glycogen synthase kinase-3 [Glycine soja]
Length=410

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 8/76 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G + LP+EM++MKI+DD+        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  21   AGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  72

Query  553  SYMAERVVGTGSFWSV  600
            SYMAERVVG GSF  V
Sbjct  73   SYMAERVVGHGSFGVV  88



>ref|XP_007145031.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 ref|XP_007145032.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 gb|ESW17025.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
 gb|ESW17026.1| hypothetical protein PHAVU_007G204000g [Phaseolus vulgaris]
Length=410

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 8/76 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G + LP+EM++MKI+DD+        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  21   AGVDRLPEEMNDMKIRDDR--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTI  72

Query  553  SYMAERVVGTGSFWSV  600
            SYMAERVVG GSF  V
Sbjct  73   SYMAERVVGHGSFGVV  88



>ref|XP_002302794.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
 gb|EEE82067.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
Length=409

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 63/92 (68%), Gaps = 9/92 (10%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS S   ASG+        +G ++LP+EM++MKI DDK        +ME  V+ GNGTET
Sbjct  2    ASVSVVPASGLR-DTLGNTTGVDKLPEEMNDMKISDDK--------EMEAAVVDGNGTET  52

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSF
Sbjct  53   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSF  84



>ref|XP_006338576.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Solanum tuberosum]
Length=410

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 5/70 (7%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            + LPKE++EMKI DDK       K+ME  V+ GNGTETG IIVTT+GG+NG+ KQ +SYM
Sbjct  22   DNLPKEINEMKINDDKEG-----KEMEATVVDGNGTETGHIIVTTIGGKNGQPKQTISYM  76

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  77   AERVVGQGSF  86



>ref|XP_008793304.1| PREDICTED: shaggy-related protein kinase alpha-like [Phoenix 
dactylifera]
Length=409

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 63/93 (68%), Gaps = 15/93 (16%)
 Frame = +1

Query  313  AASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTE  492
              S+  ++ASG S+       G + LP EM++MKI+DDK        ++E  V+ GNGTE
Sbjct  7    VTSSGMKNASGTSV-------GMDRLPDEMNDMKIRDDK--------EVEATVVDGNGTE  51

Query  493  TGQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            TG IIVTT+GGRNG+ KQ +SYMAERVVG GSF
Sbjct  52   TGHIIVTTIGGRNGQPKQTISYMAERVVGHGSF  84



>ref|XP_006338577.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Solanum tuberosum]
Length=404

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 5/70 (7%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            + LPKE++EMKI DDK       K+ME  V+ GNGTETG IIVTT+GG+NG+ KQ +SYM
Sbjct  16   DNLPKEINEMKINDDKEG-----KEMEATVVDGNGTETGHIIVTTIGGKNGQPKQTISYM  70

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  71   AERVVGQGSF  80



>ref|XP_006446534.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 ref|XP_006446536.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59774.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59776.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
Length=429

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 57/70 (81%), Gaps = 5/70 (7%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKIKD++ +     K+ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  40   DKLPEEINEMKIKDERVE-----KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  94

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  95   AERVVGQGSF  104



>ref|NP_001274855.1| Shaggy-like protein kinase NtK-1 [Solanum tuberosum]
 ref|XP_006344811.1| PREDICTED: shaggy-related protein kinase NtK-1 [Solanum tuberosum]
 gb|ABB87119.1| NtK-1-like [Solanum tuberosum]
Length=409

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 8/76 (11%)
 Frame = +1

Query  373  SGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVL  552
            +G + LP+EM++M+I+DDK        +ME  ++ GNGTETG IIVTT+GGRNG+ KQ +
Sbjct  20   AGVDRLPEEMNDMRIRDDK--------EMEATIVDGNGTETGHIIVTTIGGRNGQPKQTI  71

Query  553  SYMAERVVGTGSFWSV  600
            SYMAERVVG GSF  V
Sbjct  72   SYMAERVVGQGSFGVV  87



>ref|XP_006428242.1| hypothetical protein CICLE_v10013624mg [Citrus clementina]
 gb|ESR41482.1| hypothetical protein CICLE_v10013624mg [Citrus clementina]
Length=453

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 8/72 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  556  YMAERVVGTGSF  591
            YMAER+VG GSF
Sbjct  73   YMAERIVGQGSF  84



>ref|XP_008246288.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
 ref|XP_008246289.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
 ref|XP_008246290.1| PREDICTED: shaggy-related protein kinase alpha [Prunus mume]
Length=410

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 8/72 (11%)
 Frame = +1

Query  376  GYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLS  555
            G ++LP+E+++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +S
Sbjct  21   GVDKLPEELNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS  72

Query  556  YMAERVVGTGSF  591
            YMAERVVG GSF
Sbjct  73   YMAERVVGHGSF  84



>gb|ACJ83284.1| unknown [Medicago truncatula]
Length=172

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 8/71 (11%)
 Frame = +1

Query  388  LPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAE  567
            LP+EM +MKI+DD+        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYMAE
Sbjct  27   LPEEMSDMKIRDDR--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAE  78

Query  568  RVVGTGSFWSV  600
            RVVG GSF  V
Sbjct  79   RVVGHGSFGVV  89



>ref|XP_008381452.1| PREDICTED: glycogen synthase kinase-3 homolog MsK-3 [Malus domestica]
Length=409

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 61/92 (66%), Gaps = 9/92 (10%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS S   ASG+        +G + LP EM++MKI+DDK        +ME  V+ GNGTE 
Sbjct  2    ASVSVVPASGLR-EPXGNAAGVDNLPNEMNDMKIRDDK--------EMEATVVNGNGTEA  52

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSF
Sbjct  53   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSF  84



>ref|XP_010091400.1| Glycogen synthase kinase-3-MsK-3-like protein [Morus notabilis]
 gb|EXB44437.1| Glycogen synthase kinase-3-MsK-3-like protein [Morus notabilis]
Length=412

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 63/92 (68%), Gaps = 8/92 (9%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS S   ASG+   +    +G + LP EM++MKI+D+K        ++E  ++ GNGTET
Sbjct  2    ASVSVVPASGVVRESSGNAAGVDRLPDEMNDMKIRDEK--------EVEATIVDGNGTET  53

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSF
Sbjct  54   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSF  85



>ref|XP_010251221.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X4 [Nelumbo nucifera]
Length=350

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 8/70 (11%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DKLPEEINEMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  74

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  75   AERVVGHGSF  84



>ref|XP_009759533.1| PREDICTED: shaggy-related protein kinase epsilon [Nicotiana sylvestris]
Length=410

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 5/70 (7%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKI+DDK +     K+ME  V+ GNGTE G IIVTT+GG+NGE KQ +SYM
Sbjct  22   DKLPEEINEMKIRDDKVE-----KEMEAAVVDGNGTEKGHIIVTTIGGKNGEPKQTISYM  76

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  77   AERVVGQGSF  86



>ref|XP_011040636.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 64/92 (70%), Gaps = 9/92 (10%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS S   A G+    R+  +G ++LP EM++M+I+DDK        +ME  V+ GNGTET
Sbjct  2    ASVSVVPAPGLRDRNRNS-TGVDKLPDEMNDMRIRDDK--------EMEATVVDGNGTET  52

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSF  591
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSF
Sbjct  53   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSF  84



>ref|XP_002279596.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Vitis 
vinifera]
 emb|CAN75652.1| hypothetical protein VITISV_017659 [Vitis vinifera]
Length=409

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 9/95 (9%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS S   ASG+         G + LP EM++MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVSIAPASGLR-EPNGNTVGVDRLPDEMNDMKIRDDK--------EMEDTVVDGNGTET  52

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSF  V
Sbjct  53   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVV  87



>ref|XP_009598967.1| PREDICTED: shaggy-related protein kinase epsilon [Nicotiana tomentosiformis]
Length=410

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 56/70 (80%), Gaps = 5/70 (7%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKI+DDK +     K+ME  V+ GNGTE G IIVTT+GG+NGE KQ +SYM
Sbjct  22   DKLPEEINEMKIRDDKVE-----KEMEAAVVDGNGTEKGHIIVTTIGGKNGEPKQTISYM  76

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  77   AERVVGQGSF  86



>ref|XP_011097427.1| PREDICTED: shaggy-related protein kinase epsilon-like [Sesamum 
indicum]
Length=407

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 57/70 (81%), Gaps = 5/70 (7%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKIKD+K +     K+ME  V+ GNGTETG IIVTT+GG+NG+ KQ +SYM
Sbjct  19   DKLPEEINEMKIKDEKVE-----KEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYM  73

Query  562  AERVVGTGSF  591
            AER+VG GSF
Sbjct  74   AERIVGQGSF  83



>ref|XP_010251217.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X1 [Nelumbo nucifera]
Length=409

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 8/70 (11%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DKLPEEINEMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  74

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  75   AERVVGHGSF  84



>ref|XP_007031230.1| Shaggy-related kinase 11, 11 isoform 2 [Theobroma cacao]
 gb|EOY11732.1| Shaggy-related kinase 11, 11 isoform 2 [Theobroma cacao]
Length=409

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 61/82 (74%), Gaps = 9/82 (11%)
 Frame = +1

Query  349  SLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGR  528
            S++  S  +G ++LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGR
Sbjct  10   SVLRESNAAGVDKLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGR  61

Query  529  NGEQK-QVLSYMAERVVGTGSF  591
            NG+ K Q +SYMAERVVG GSF
Sbjct  62   NGQPKQQTISYMAERVVGHGSF  83



>ref|XP_010251218.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Nelumbo nucifera]
Length=392

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 8/70 (11%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DKLPEEINEMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  74

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  75   AERVVGHGSF  84



>ref|XP_002515218.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF47202.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=409

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 9/95 (9%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS S    SGI        +G + LP EM++MKI+DDK        +ME  V+ GNGTET
Sbjct  2    ASVSVAPTSGIR-DPGGNAAGVDRLPDEMNDMKIRDDK--------EMEATVVDGNGTET  52

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSF  V
Sbjct  53   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVV  87



>gb|EYU38392.1| hypothetical protein MIMGU_mgv1a007572mg [Erythranthe guttata]
Length=403

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 56/75 (75%), Gaps = 8/75 (11%)
 Frame = +1

Query  367  EKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQ  546
            E  G + LP+EM++MKI+DDK        +ME  V+ GNGTETG IIVTT+GGR+G+ KQ
Sbjct  12   EAVGVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRSGQPKQ  63

Query  547  VLSYMAERVVGTGSF  591
             +SYMAER+VG GSF
Sbjct  64   TISYMAERIVGQGSF  78



>ref|XP_008795404.1| PREDICTED: shaggy-related protein kinase theta-like isoform X1 
[Phoenix dactylifera]
Length=381

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +1

Query  400  MHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMAERVVG  579
            MHEM I+DDK + +N  KD E  ++ GNGTETGQII TT+GGR+G+ KQ +SYMAERVVG
Sbjct  1    MHEMTIRDDKVEGRNE-KDTEGTMVNGNGTETGQIIATTIGGRHGQPKQTISYMAERVVG  59

Query  580  TGSF  591
            TGSF
Sbjct  60   TGSF  63



>gb|EYU34726.1| hypothetical protein MIMGU_mgv1a007335mg [Erythranthe guttata]
Length=407

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 56/69 (81%), Gaps = 5/69 (7%)
 Frame = +1

Query  385  ELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYMA  564
            +LP+E++EMKIKD+K +     K+ME  V+ GNGTETG IIVTT+GG+NG+ KQ +SYMA
Sbjct  20   KLPEEINEMKIKDEKVE-----KEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMA  74

Query  565  ERVVGTGSF  591
            ER+VG GSF
Sbjct  75   ERIVGQGSF  83



>gb|KDO66111.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=210

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 5/73 (7%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKIK ++ +     K+ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  40   DKLPEEINEMKIKGERVE-----KEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  94

Query  562  AERVVGTGSFWSV  600
            AERVVG GSF  V
Sbjct  95   AERVVGQGSFGIV  107



>gb|KDO86865.1| hypothetical protein CISIN_1g015632mg [Citrus sinensis]
Length=296

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 63/95 (66%), Gaps = 15/95 (16%)
 Frame = +1

Query  316  ASTSQEDASGISLVARSEKSGYEELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTET  495
            AS S   ASG ++       G + LP+EM++MKI+DDK        +ME  V+ GNGTE 
Sbjct  2    ASVSVVPASGNTV-------GVDRLPEEMNDMKIRDDK--------EMEATVVDGNGTEA  46

Query  496  GQIIVTTVGGRNGEQKQVLSYMAERVVGTGSFWSV  600
            G IIVTT+GG+NG+ KQ +SYMAERVVG GSF  V
Sbjct  47   GHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVV  81



>emb|CAN64359.1| hypothetical protein VITISV_041427 [Vitis vinifera]
Length=442

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 8/70 (11%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKI+DDK        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DKLPEEINEMKIRDDK--------EMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYM  74

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  75   AERVVGQGSF  84



>ref|XP_007215466.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
 gb|EMJ16665.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
Length=409

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 8/70 (11%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKIKD+K        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DKLPEEINEMKIKDEK--------EMETAVVNGNGTETGHIIVTTIGGRNGQPKQTISYM  74

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  75   AERVVGQGSF  84



>ref|XP_008230580.1| PREDICTED: shaggy-related protein kinase epsilon [Prunus mume]
Length=409

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 55/70 (79%), Gaps = 8/70 (11%)
 Frame = +1

Query  382  EELPKEMHEMKIKDDKSDNQNNLKDMEPVVITGNGTETGQIIVTTVGGRNGEQKQVLSYM  561
            ++LP+E++EMKIKD+K        +ME  V+ GNGTETG IIVTT+GGRNG+ KQ +SYM
Sbjct  23   DKLPEEINEMKIKDEK--------EMETAVVNGNGTETGHIIVTTIGGRNGQPKQTISYM  74

Query  562  AERVVGTGSF  591
            AERVVG GSF
Sbjct  75   AERVVGQGSF  84



Lambda      K        H        a         alpha
   0.308    0.125    0.346    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940