BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF046E04

Length=555
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP19007.1|  unnamed protein product                                317   7e-106   Coffea canephora [robusta coffee]
ref|XP_009365212.1|  PREDICTED: chlorophyll a-b binding protein 1...    312   7e-104   Pyrus x bretschneideri [bai li]
ref|XP_002321186.1|  chlorophyll a/b-binding family protein             311   7e-104   Populus trichocarpa [western balsam poplar]
ref|XP_002301582.1|  chlorophyll a/b-binding family protein             310   3e-103   Populus trichocarpa [western balsam poplar]
gb|ABK96530.1|  unknown                                                 310   3e-103   Populus trichocarpa x Populus deltoides
ref|XP_011005408.1|  PREDICTED: chlorophyll a-b binding protein 1...    310   4e-103   Populus euphratica
gb|ACX54226.1|  chlorophyll A/B binding protein                         309   4e-103   Jatropha curcas
gb|KDP29912.1|  hypothetical protein JCGZ_18481                         309   5e-103   Jatropha curcas
gb|AFO67217.1|  putative chlorophyll a/b binding protein                309   6e-103   Aralia elata
ref|XP_004144543.1|  PREDICTED: chlorophyll a-b binding protein 1...    309   7e-103   Cucumis sativus [cucumbers]
gb|AFJ25031.1|  chlorophyll a/b binding protein                         308   9e-103   Lonicera japonica [Japanese honeysuckle]
ref|XP_011039316.1|  PREDICTED: chlorophyll a-b binding protein 5...    308   1e-102   Populus euphratica
ref|XP_002531690.1|  chlorophyll A/B binding protein, putative          308   1e-102   Ricinus communis
ref|XP_008462084.1|  PREDICTED: chlorophyll a-b binding protein 1...    308   2e-102   Cucumis melo [Oriental melon]
ref|XP_009630805.1|  PREDICTED: chlorophyll a-b binding protein 3...    308   2e-102   Nicotiana tomentosiformis
ref|XP_008379987.1|  PREDICTED: chlorophyll a-b binding protein 1...    307   3e-102   
dbj|BAE46383.1|  chlorophyll a/b binding protein                        307   3e-102   Panax ginseng [Asiatic ginseng]
gb|AEY78525.1|  chlorophyll a/b-binding protein                         307   3e-102   Tagetes erecta [big marigold]
gb|EYU42755.1|  hypothetical protein MIMGU_mgv1a011961mg                307   4e-102   Erythranthe guttata [common monkey flower]
sp|P12062.1|CB26_PETSP  RecName: Full=Chlorophyll a-b binding pro...    306   6e-102   Petunia sp.
ref|XP_007215825.1|  hypothetical protein PRUPE_ppa010078mg             306   9e-102   Prunus persica
ref|XP_010270182.1|  PREDICTED: chlorophyll a-b binding protein 1...    306   9e-102   Nelumbo nucifera [Indian lotus]
ref|XP_009802594.1|  PREDICTED: chlorophyll a-b binding protein 3...    306   1e-101   Nicotiana sylvestris
ref|XP_009343482.1|  PREDICTED: chlorophyll a-b binding protein 1...    306   1e-101   
ref|XP_010252708.1|  PREDICTED: chlorophyll a-b binding protein 1...    306   1e-101   Nelumbo nucifera [Indian lotus]
ref|XP_010112785.1|  Chlorophyll a-b binding protein 151                306   1e-101   Morus notabilis
ref|XP_009626274.1|  PREDICTED: chlorophyll a-b binding protein 3...    305   1e-101   Nicotiana tomentosiformis
sp|P27494.1|CB23_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    305   1e-101   Nicotiana tabacum [American tobacco]
ref|XP_008342193.1|  PREDICTED: chlorophyll a-b binding protein 1...    305   2e-101   Malus domestica [apple tree]
ref|XP_009136161.1|  PREDICTED: chlorophyll a-b binding protein 1...    305   2e-101   Brassica rapa
ref|NP_001234739.1|  chlorophyll a-b binding protein 4, chloropla...    305   3e-101   Solanum lycopersicum
ref|XP_010467054.1|  PREDICTED: chlorophyll a-b binding protein 1...    305   3e-101   Camelina sativa [gold-of-pleasure]
emb|CDY15050.1|  BnaC03g44110D                                          305   3e-101   Brassica napus [oilseed rape]
ref|WP_039311140.1|  hypothetical protein                               302   3e-101   
ref|XP_011100602.1|  PREDICTED: chlorophyll a-b binding protein 5...    305   3e-101   Sesamum indicum [beniseed]
ref|XP_006296728.1|  hypothetical protein CARUB_v10014404mg             305   3e-101   Capsella rubella
gb|KDO58421.1|  hypothetical protein CISIN_1g024579mg                   305   4e-101   Citrus sinensis [apfelsine]
gb|AHC95482.1|  chlorophyll A/B binding protein                         304   5e-101   Ziziphus jujuba [Chinese jujube]
ref|XP_008229895.1|  PREDICTED: chlorophyll a-b binding protein 1...    304   5e-101   Prunus mume [ume]
gb|AAO62942.1|  chlorophyll a/b binding protein                         303   8e-101   Nicotiana tabacum [American tobacco]
ref|XP_004293460.1|  PREDICTED: chlorophyll a-b binding protein 1...    303   9e-101   Fragaria vesca subsp. vesca
emb|CAA52750.1|  chlorophyll a/b binding protein                        303   9e-101   Amaranthus hypochondriacus [prince's feather]
gb|AAD28771.1|AF134124_1  Lhcb2 protein                                 303   9e-101   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178585.1|  photosystem II light harvesting complex protein...    303   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009618965.1|  PREDICTED: chlorophyll a-b binding protein 3...    303   1e-100   Nicotiana tomentosiformis
ref|XP_002885789.1|  Lhcb2 protein                                      303   1e-100   Arabidopsis lyrata subsp. lyrata
gb|AAC34983.1|  light harvesting chlorophyll A/B binding protein        303   1e-100   Prunus persica
ref|XP_002271687.1|  PREDICTED: chlorophyll a-b binding protein 1...    303   1e-100   Vitis vinifera
ref|XP_006447758.1|  hypothetical protein CICLE_v10016280mg             303   1e-100   Citrus clementina [clementine]
gb|AFK45982.1|  unknown                                                 303   1e-100   Lotus japonicus
ref|XP_010412501.1|  PREDICTED: chlorophyll a-b binding protein 1...    302   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_004251540.1|  PREDICTED: chlorophyll a-b binding protein 5...    302   3e-100   
gb|AAL29886.1|M97171_1  chlorophyll a/b binding protein type II         302   3e-100   Glycine max [soybeans]
ref|XP_006352013.1|  PREDICTED: chlorophyll a-b binding protein 3...    302   3e-100   Solanum tuberosum [potatoes]
gb|AEK26372.1|  chloroplast photosystem II chlorophyll a/b bindin...    302   3e-100   Sedum alfredii
gb|AAD28769.1|AF134122_1  Lhcb2 protein                                 302   4e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111582.1|  PREDICTED: chlorophyll a-b binding protein 3...    301   4e-100   Brassica rapa
ref|XP_009792415.1|  PREDICTED: chlorophyll a-b binding protein 3...    301   5e-100   Nicotiana sylvestris
ref|XP_006363015.1|  PREDICTED: chlorophyll a-b binding protein 4...    301   5e-100   Solanum tuberosum [potatoes]
emb|CAA84525.1|  chlorophyll a,b binding protein type I                 301   5e-100   Solanum tuberosum [potatoes]
gb|AII25433.1|  light-harvesting chlorophyll a/b binding protein        301   5e-100   Sedum alfredii
ref|XP_010412415.1|  PREDICTED: chlorophyll a-b binding protein, ...    298   6e-100   Camelina sativa [gold-of-pleasure]
gb|ACJ84374.1|  unknown                                                 301   9e-100   Medicago truncatula
gb|AFK45300.1|  unknown                                                 301   9e-100   Medicago truncatula
ref|XP_003617948.1|  Chlorophyll a/b binding protein                    301   1e-99    Medicago truncatula
ref|NP_178582.1|  photosystem II light harvesting complex protein...    301   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010045878.1|  PREDICTED: chlorophyll a-b binding protein 3...    301   1e-99    Eucalyptus grandis [rose gum]
gb|AAD48017.1|AF165529_1  chlorophyll a/b binding protein               301   1e-99    Rumex palustris
ref|NP_001240183.1|  uncharacterized protein LOC100793702               300   1e-99    Glycine max [soybeans]
gb|AFW90566.1|  chlorophyll a/b-binding protein                         300   2e-99    Solanum tuberosum [potatoes]
ref|XP_010665939.1|  PREDICTED: chlorophyll a-b binding protein 5...    300   2e-99    Beta vulgaris subsp. vulgaris [field beet]
gb|KFK23428.1|  hypothetical protein AALP_AAs45999U001400               300   2e-99    Arabis alpina [alpine rockcress]
emb|CDX83726.1|  BnaC07g24660D                                          300   2e-99    
gb|AGZ15385.1|  chlorophyll a/b-binding protein (LHCII type II)         298   3e-99    Phaseolus vulgaris [French bean]
emb|CDY13732.1|  BnaA06g31910D                                          300   3e-99    Brassica napus [oilseed rape]
ref|XP_009151928.1|  PREDICTED: chlorophyll a-b binding protein 5...    300   4e-99    Brassica rapa
ref|XP_006395408.1|  hypothetical protein EUTSA_v10004777mg             299   4e-99    Eutrema salsugineum [saltwater cress]
ref|XP_007142492.1|  hypothetical protein PHAVU_008G285100g             299   4e-99    Phaseolus vulgaris [French bean]
ref|NP_001241179.1|  uncharacterized protein LOC100815789               299   6e-99    Glycine max [soybeans]
ref|XP_010502775.1|  PREDICTED: chlorophyll a-b binding protein 5...    299   6e-99    Camelina sativa [gold-of-pleasure]
emb|CDY03989.1|  BnaC02g37040D                                          298   7e-99    
ref|XP_007049308.1|  Photosystem II light harvesting complex gene...    298   8e-99    Theobroma cacao [chocolate]
emb|CDY00149.1|  BnaC09g01520D                                          298   1e-98    
gb|KJB06589.1|  hypothetical protein B456_001G192000                    298   2e-98    Gossypium raimondii
ref|XP_004491575.1|  PREDICTED: chlorophyll a-b binding protein 2...    298   2e-98    Cicer arietinum [garbanzo]
gb|KJB06801.1|  hypothetical protein B456_001G192300                    298   2e-98    Gossypium raimondii
gb|ABO20852.1|  chlorophyll a/b binding protein of LHCII type I         298   2e-98    Lilium longiflorum [Easter lily]
ref|XP_006291684.1|  hypothetical protein CARUB_v10017845mg             298   2e-98    Capsella rubella
ref|XP_010514479.1|  PREDICTED: chlorophyll a-b binding protein 5...    297   3e-98    Camelina sativa [gold-of-pleasure]
gb|AAF89205.1|AF279248_1  LHCII type II chlorophyll a/b-binding p...    297   4e-98    Vigna radiata [mung bean]
gb|KFK33682.1|  hypothetical protein AALP_AA5G045900                    297   4e-98    Arabis alpina [alpine rockcress]
gb|AEO51757.1|  chloroplast chlorophyll A/B binding protein             296   4e-98    Dimocarpus longan [longan]
ref|XP_006291597.1|  hypothetical protein CARUB_v10017751mg             298   5e-98    Capsella rubella
gb|KJB10748.1|  hypothetical protein B456_001G220900                    296   5e-98    Gossypium raimondii
gb|AAW31512.1|  light-harvesting chlorophyll-a/b binding protein ...    296   5e-98    Pisum sativum [garden pea]
ref|XP_002875397.1|  LHCB2:4                                            296   5e-98    
ref|XP_009397219.1|  PREDICTED: chlorophyll a-b binding protein 1...    296   6e-98    Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK33681.1|  hypothetical protein AALP_AA5G045800                    296   6e-98    Arabis alpina [alpine rockcress]
sp|P12332.2|CB21_SILPR  RecName: Full=Chlorophyll a-b binding pro...    294   8e-98    Silene latifolia subsp. alba [white campion]
ref|XP_010557706.1|  PREDICTED: chlorophyll a-b binding protein 5...    296   9e-98    Tarenaya hassleriana [spider flower]
sp|P27518.2|CB21_GOSHI  RecName: Full=Chlorophyll a-b binding pro...    296   1e-97    Gossypium hirsutum [American cotton]
sp|P27520.1|CB215_PEA  RecName: Full=Chlorophyll a-b binding prot...    295   1e-97    Pisum sativum [garden pea]
ref|NP_189406.1|  photosystem II light harvesting complex protein...    295   1e-97    Arabidopsis thaliana [mouse-ear cress]
gb|KFK33683.1|  hypothetical protein AALP_AA5G046000                    294   3e-97    Arabis alpina [alpine rockcress]
sp|P12328.1|CB21_LEMGI  RecName: Full=Chlorophyll a-b binding pro...    294   5e-97    Lemna gibba
ref|XP_008810536.1|  PREDICTED: chlorophyll a-b binding protein 5...    294   5e-97    
gb|ABD92879.1|  chloroplast chlorophyll a/b binding protein             293   8e-97    Pachysandra terminalis
ref|XP_002875398.1|  LHCB2:4                                            293   2e-96    Arabidopsis lyrata subsp. lyrata
gb|AEZ49172.1|  chlorophyll a/b binding protein of LHCII type I         290   1e-95    Wolffia australiana
ref|XP_010908796.1|  PREDICTED: chlorophyll a-b binding protein 5...    290   2e-95    Elaeis guineensis
ref|XP_006836754.1|  hypothetical protein AMTR_s00088p00153020          289   5e-95    Amborella trichopoda
gb|ABK21429.1|  unknown                                                 286   7e-94    Picea sitchensis
gb|ABR17665.1|  unknown                                                 286   9e-94    Picea sitchensis
gb|ABK21859.1|  unknown                                                 284   5e-93    Picea sitchensis
gb|ABK21323.1|  unknown                                                 284   5e-93    Picea sitchensis
gb|ABQ02464.1|  chloroplast chlorophyll a/b binding protein             284   5e-93    Phyllostachys edulis [kikko-chiku]
gb|AAC15992.1|  chlorophyll a/b binding protein                         283   1e-92    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050586.1|  Os03g0592500                                       282   2e-92    
gb|ABK22382.1|  unknown                                                 282   2e-92    Picea sitchensis
ref|XP_006664981.1|  PREDICTED: chlorophyll a-b binding protein, ...    282   2e-92    Oryza brachyantha
dbj|BAA00537.1|  type II light-harvesting chlorophyll a/b-binding...    281   3e-92    Oryza sativa Japonica Group [Japonica rice]
prf||1707316B  chlorophyll a/b binding protein 2                        281   4e-92 
gb|AFV34723.1|  light harvesting chlorophyll a/b-binding protein 2-1    281   4e-92    Dendrocalamus latiflorus [sweet bamboo]
gb|ACO06085.1|  chlorophyll a-b binding protein                         278   7e-92    Triticum aestivum [Canadian hard winter wheat]
emb|CAA43907.1|  chlorophyll a/b-binding protein                        280   2e-91    Pinus thunbergii [green pine]
gb|ACE88963.1|  chloroplast chlorophyll a/b binding protein             277   2e-91    Phyllostachys edulis [kikko-chiku]
gb|EMS46868.1|  Chlorophyll a-b binding protein, chloroplastic          279   3e-91    Triticum urartu
gb|ABK21446.1|  unknown                                                 279   3e-91    Picea sitchensis
gb|ABQ02463.1|  chloroplast chlorophyll a/b binding protein             279   4e-91    Phyllostachys edulis [kikko-chiku]
gb|AEW70716.1|  light harvesting chlorophyll a-b binding protein 2-1    278   5e-91    Phyllostachys edulis [kikko-chiku]
gb|ACO06088.1|  chlorophyll a-b binding protein                         278   6e-91    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003562323.1|  PREDICTED: chlorophyll a-b binding protein, ...    278   7e-91    Brachypodium distachyon [annual false brome]
gb|ABO10493.1|  light-harvesting chlorophyll a/b binding protein        277   1e-90    Bambusa oldhamii
gb|AAV74408.1|  chloroplast chlorophyll A/B binding protein             276   2e-90    Manihot esculenta [manioc]
gb|AAB19040.1|  type 2 light-harvesting chlorophyll a/b-binding p...    276   2e-90    Pinus palustris [longleaf pine]
gb|ABR25974.1|  chloroplast chlorophyll a-b binding protein precu...    276   2e-90    Oryza sativa Indica Group [Indian rice]
gb|ABK22497.1|  unknown                                                 276   4e-90    Picea sitchensis
ref|NP_001148271.1|  chlorophyll a-b binding protein                    275   7e-90    Zea mays [maize]
gb|ACG30954.1|  chlorophyll a-b binding protein                         275   1e-89    Zea mays [maize]
sp|P10049.1|CB21_PINTH  RecName: Full=Chlorophyll a-b binding pro...    275   2e-89    Pinus thunbergii [green pine]
ref|XP_002986911.1|  light-harvesting complex                           274   4e-89    Selaginella moellendorffii
ref|XP_004982492.1|  PREDICTED: chlorophyll a-b binding protein, ...    273   5e-89    Setaria italica
ref|XP_002466863.1|  hypothetical protein SORBIDRAFT_01g015400          273   9e-89    Sorghum bicolor [broomcorn]
gb|ABK23816.1|  unknown                                                 265   4e-87    Picea sitchensis
emb|CAA89823.1|  light-harvesting chlorophyll a/b binding protein...    267   7e-87    Pseudotsuga menziesii
gb|AAB82142.1|  chlorophyll a-b binding protein                         268   7e-87    Oryza sativa Indica Group [Indian rice]
gb|KDO58422.1|  hypothetical protein CISIN_1g024579mg                   265   2e-86    Citrus sinensis [apfelsine]
gb|EMT32028.1|  Chlorophyll a-b binding protein, chloroplastic          265   3e-86    
sp|P14279.1|CB25_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    265   6e-86    Solanum lycopersicum
ref|XP_001757271.1|  predicted protein                                  265   9e-86    
gb|ACO06086.1|  chlorophyll a-b binding protein                         262   4e-85    Triticum aestivum [Canadian hard winter wheat]
emb|CAA48641.1|  type II light-harvesting chlorophyll a /b-bindin...    262   5e-85    Zea mays [maize]
ref|XP_001755762.1|  predicted protein                                  258   6e-83    
gb|AAA60965.1|  light-harvesting chlorophyll a/b binding protein ...    258   6e-83    Ginkgo biloba [ginkgo]
gb|ACI90635.1|  chloroplast light harvesting chlorophyll a/b bind...    256   3e-82    Pinus yunnanensis [Yunnan pine]
ref|XP_001762089.1|  predicted protein                                  256   4e-82    
gb|ACI90632.1|  chloroplast light harvesting chlorophyll a/b bind...    254   8e-82    Pinus tabuliformis var. henryi
emb|CAC38830.1|  chlorophyll a/b binding protein                        254   2e-81    Pinus contorta
gb|ACI90631.1|  chloroplast light harvesting chlorophyll a/b bind...    253   6e-81    Pinus bungeana [lacebark pine]
emb|CAA47950.1|  chlorophyll a/b binding protein                        253   7e-81    Pinus contorta
gb|ACY66805.1|  chlorophyll a/b-binding protein                         253   1e-80    Pinus massoniana [Chinese red pine]
emb|CAA57408.1|  light harvesting chlorophyll a /b-binding protei...    253   1e-80    Picea abies
gb|ABK20976.1|  unknown                                                 253   1e-80    Picea sitchensis
emb|CAA57409.1|  light harvesting chlorophyll a /b-binding protei...    252   1e-80    Picea abies
ref|XP_001774812.1|  predicted protein                                  251   3e-80    
sp|P15194.1|CB2B_PINSY  RecName: Full=Chlorophyll a-b binding pro...    251   4e-80    Pinus sylvestris [Scotch pine]
gb|ABK22798.1|  unknown                                                 250   4e-80    Picea sitchensis
ref|XP_001751426.1|  predicted protein                                  250   6e-80    
gb|AAC78690.1|  chlorophyll a/b-binding protein                         251   7e-80    Pinus thunbergii [green pine]
gb|ACN40194.1|  unknown                                                 251   7e-80    Picea sitchensis
sp|P24006.1|CB2A_PYRPY  RecName: Full=Chlorophyll a-b binding pro...    251   7e-80    Pyrus pyrifolia [sha li]
ref|XP_001761868.1|  predicted protein                                  250   1e-79    
ref|XP_001779318.1|  predicted protein                                  250   1e-79    
sp|P15193.1|CB2A_PINSY  RecName: Full=Chlorophyll a-b binding pro...    250   1e-79    Pinus sylvestris [Scotch pine]
gb|AAU89261.1|  chloroplast light harvesting chlorophyll a/b bind...    249   1e-79    Pinus monophylla [singleleaf pinyon pine]
gb|ABK22510.1|  unknown                                                 250   2e-79    Picea sitchensis
ref|XP_001774452.1|  predicted protein                                  249   2e-79    
gb|AAU89262.1|  chloroplast light harvesting chlorophyll a/b bind...    249   2e-79    Pinus remota
gb|AAU89257.1|  chloroplast light harvesting chlorophyll a/b bind...    249   2e-79    Pinus flexilis [limber pine]
ref|XP_002960494.1|  light-harvesting complex                           249   3e-79    Selaginella moellendorffii
gb|AAY81730.1|  chloroplast putative light harvesting chlorophyll...    248   3e-79    Pinus krempfii
gb|AAA33636.1|  major chlorophyll binding protein                       249   3e-79    Physcomitrella patens
gb|AAU89264.1|  chloroplast light harvesting chlorophyll a/b bind...    248   3e-79    Pinus nelsonii
gb|AAU89250.1|  chloroplast light harvesting chlorophyll a/b bind...    248   4e-79    Pinus echinata [shortleaf pine]
gb|AIW07979.1|  chloroplast light harvesting chlorophyll a/b bind...    248   4e-79    Pinus krempfii
gb|AHB24928.1|  chloroplast chlorophyll a-b binding protein 2/3         248   4e-79    Sedum alfredii
gb|AAU89251.1|  chloroplast light harvesting chlorophyll a/b bind...    248   5e-79    Pinus ponderosa [Pacific ponderosa pine]
gb|AAU89253.1|  chloroplast light harvesting chlorophyll a/b bind...    248   5e-79    Pinus contorta
gb|AAU89254.1|  chloroplast light harvesting chlorophyll a/b bind...    248   5e-79    Pinus merkusii [Mindoro pine]
gb|AIW08054.1|  chloroplast light harvesting chlorophyll a/b bind...    248   5e-79    Pinus krempfii
gb|AAU89255.1|  chloroplast light harvesting chlorophyll a/b bind...    248   5e-79    Pinus roxburghii [chir pine]
ref|XP_002967230.1|  light-harvesting complex                           248   5e-79    
gb|AAU89265.1|  chloroplast light harvesting chlorophyll a/b bind...    247   7e-79    Picea sitchensis
gb|AAY81729.1|  chloroplast putative light harvesting chlorophyll...    247   9e-79    Pinus gerardiana
ref|XP_001751359.1|  predicted protein                                  247   9e-79    
gb|AAU89256.1|  chloroplast light harvesting chlorophyll a/b bind...    247   1e-78    Pinus chiapensis
prf||1615137A  chlorophyll a/b binding protein P25                      246   1e-78 
gb|AAU89252.1|  chloroplast light harvesting chlorophyll a/b bind...    246   3e-78    Pinus radiata
gb|ACN40044.1|  unknown                                                 246   5e-78    Picea sitchensis
sp|P12329.1|CB21_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    245   7e-78    Zea mays [maize]
ref|XP_001754234.1|  predicted protein                                  245   1e-77    
ref|XP_001751602.1|  predicted protein                                  244   1e-77    
ref|NP_565786.1|  photosystem II light harvesting complex protein...    244   2e-77    Arabidopsis thaliana [mouse-ear cress]
emb|CAA57407.1|  light harvesting chlorophyll a /b-binding protei...    244   2e-77    Picea abies
ref|XP_002306927.1|  Chlorophyll a-b binding protein 2                  244   2e-77    Populus trichocarpa [western balsam poplar]
ref|XP_001754307.1|  predicted protein                                  244   2e-77    
gb|ACN40027.1|  unknown                                                 244   3e-77    Picea sitchensis
ref|XP_011045092.1|  PREDICTED: chlorophyll a-b binding protein o...    243   3e-77    Populus euphratica
ref|XP_002307725.1|  Chlorophyll a-b binding protein 2                  243   3e-77    Populus trichocarpa [western balsam poplar]
ref|NP_001147639.1|  chlorophyll a-b binding protein 1, chloropla...    243   3e-77    
gb|ABK22330.1|  unknown                                                 244   3e-77    Picea sitchensis
gb|ABK26071.1|  unknown                                                 244   3e-77    Picea sitchensis
ref|XP_006295385.1|  hypothetical protein CARUB_v10024479mg             243   3e-77    Capsella rubella
ref|XP_011045093.1|  PREDICTED: chlorophyll a-b binding protein o...    243   4e-77    Populus euphratica
gb|EPS64140.1|  chlorophyll a-b binding protein 21, chloroplastic       243   4e-77    Genlisea aurea
gb|ABK23849.1|  unknown                                                 244   4e-77    Picea sitchensis
ref|XP_006844081.1|  hypothetical protein AMTR_s00006p00251360          243   4e-77    Amborella trichopoda
ref|XP_010509756.1|  PREDICTED: chlorophyll a-b binding protein 1...    243   5e-77    Camelina sativa [gold-of-pleasure]
gb|AAA80591.1|  chlorophyll a/b binding protein                         243   5e-77    Solanum tuberosum [potatoes]
ref|XP_002460622.1|  hypothetical protein SORBIDRAFT_02g032040          243   6e-77    Sorghum bicolor [broomcorn]
ref|XP_004957570.1|  PREDICTED: chlorophyll a-b binding protein 1...    242   8e-77    Setaria italica
ref|XP_008644669.1|  PREDICTED: chlorophyll a-b binding protein, ...    242   8e-77    
ref|XP_008229463.1|  PREDICTED: chlorophyll a-b binding protein, ...    241   8e-77    Prunus mume [ume]
ref|XP_010504897.1|  PREDICTED: chlorophyll a-b binding protein 1...    243   1e-76    
gb|AAU89263.1|  chloroplast light harvesting chlorophyll a/b bind...    241   1e-76    Pinus longaeva [western bristlecone pine]
ref|XP_006368026.1|  PREDICTED: chlorophyll a-b binding protein 1...    242   1e-76    Solanum tuberosum [potatoes]
ref|XP_006365572.1|  PREDICTED: chlorophyll a-b binding protein 1...    242   1e-76    Solanum tuberosum [potatoes]
ref|XP_004233096.1|  PREDICTED: chlorophyll a-b binding protein 1...    242   1e-76    
ref|XP_004293579.1|  PREDICTED: chlorophyll a-b binding protein o...    242   1e-76    Fragaria vesca subsp. vesca
ref|XP_002316737.1|  Chlorophyll a-b binding protein 2                  242   2e-76    Populus trichocarpa [western balsam poplar]
ref|XP_001765456.1|  predicted protein                                  242   2e-76    
ref|XP_004145734.1|  PREDICTED: chlorophyll a-b binding protein, ...    241   2e-76    Cucumis sativus [cucumbers]
ref|XP_008229430.1|  PREDICTED: chlorophyll a-b binding protein o...    241   2e-76    Prunus mume [ume]
gb|AAT08668.1|  chloroplast chlorophyll A-B binding protein 40          240   2e-76    Hyacinthus orientalis [common hyacinth]
ref|XP_010316911.1|  PREDICTED: chlorophyll a-b binding protein 1...    241   2e-76    
ref|XP_010052095.1|  PREDICTED: chlorophyll a-b binding protein o...    241   2e-76    Eucalyptus grandis [rose gum]
gb|ABF97414.1|  Chlorophyll a-b binding protein, chloroplast prec...    239   3e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002515206.1|  chlorophyll A/B binding protein, putative          241   3e-76    Ricinus communis
ref|XP_010316912.1|  PREDICTED: chlorophyll a-b binding protein 1...    241   3e-76    
ref|XP_006365573.1|  PREDICTED: chlorophyll a-b binding protein 1...    241   3e-76    
ref|XP_006365560.1|  PREDICTED: chlorophyll a-b binding protein 1...    241   3e-76    Solanum tuberosum [potatoes]
ref|XP_004233101.1|  PREDICTED: chlorophyll a-b binding protein 1...    241   4e-76    
gb|AAA80593.1|  chlorophyll a/b binding protein                         241   4e-76    Solanum tuberosum [potatoes]
ref|XP_007217260.1|  hypothetical protein PRUPE_ppa010015mg             241   5e-76    Prunus persica
ref|XP_008229429.1|  PREDICTED: chlorophyll a-b binding protein o...    240   5e-76    Prunus mume [ume]
prf||1204205B  protein 1B,chlorophyll binding                           240   5e-76 
gb|AHB24929.1|  chloroplast light-harvesting complex II chlorophy...    240   6e-76    Sedum alfredii
gb|ABW70800.1|  chloroplast light harvesting chlorophyll a/b bind...    240   6e-76    Populus euphratica
ref|XP_008358195.1|  PREDICTED: chlorophyll a-b binding protein o...    240   6e-76    Malus domestica [apple tree]
gb|ACL50948.1|  putative chloroplast chlorophyll a/b binding protein    239   6e-76    Solanum nigrum
gb|KCW75954.1|  hypothetical protein EUGRSUZ_D00322                     243   7e-76    Eucalyptus grandis [rose gum]
ref|XP_008364191.1|  PREDICTED: chlorophyll a-b binding protein o...    240   7e-76    
ref|XP_011011531.1|  PREDICTED: chlorophyll a-b binding protein o...    240   7e-76    Populus euphratica
ref|XP_007215816.1|  hypothetical protein PRUPE_ppa010034mg             240   7e-76    Prunus persica
gb|AAC25775.1|  chlorophyll a/b binding protein                         240   8e-76    Medicago sativa [alfalfa]
ref|XP_001775090.1|  predicted protein                                  240   8e-76    
ref|XP_006856963.1|  hypothetical protein AMTR_s00189p00032350          240   9e-76    Amborella trichopoda
gb|AAA80594.1|  chlorophyll a/b binding protein                         239   9e-76    Solanum tuberosum [potatoes]
ref|XP_004170962.1|  PREDICTED: chlorophyll a-b binding protein o...    239   1e-75    
ref|XP_008456347.1|  PREDICTED: chlorophyll a-b binding protein o...    239   1e-75    Cucumis melo [Oriental melon]
ref|XP_004134608.1|  PREDICTED: chlorophyll a-b binding protein o...    239   1e-75    
ref|XP_004134603.1|  PREDICTED: chlorophyll a-b binding protein o...    239   1e-75    
ref|XP_004303877.1|  PREDICTED: chlorophyll a-b binding protein o...    239   1e-75    Fragaria vesca subsp. vesca
gb|AFK40061.1|  unknown                                                 239   1e-75    Medicago truncatula
gb|KFK44818.1|  hypothetical protein AALP_AA1G306800                    239   1e-75    Arabis alpina [alpine rockcress]
ref|XP_006361530.1|  PREDICTED: chlorophyll a-b binding protein 3...    239   1e-75    Solanum tuberosum [potatoes]
gb|AFK40204.1|  unknown                                                 237   1e-75    Lotus japonicus
sp|P92919.1|CB23_APIGR  RecName: Full=Chlorophyll a-b binding pro...    239   1e-75    Apium graveolens
dbj|BAJ87356.1|  predicted protein                                      238   1e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAA80592.1|  chlorophyll a/b binding protein                         239   2e-75    Solanum tuberosum [potatoes]
ref|XP_004294267.1|  PREDICTED: chlorophyll a-b binding protein o...    239   2e-75    Fragaria vesca subsp. vesca
sp|P27490.1|CB28_PEA  RecName: Full=Chlorophyll a-b binding prote...    239   2e-75    Pisum sativum [garden pea]
gb|AAW31511.1|  light-harvesting chlorophyll-a/b binding protein ...    239   2e-75    Pisum sativum [garden pea]
gb|EYU28184.1|  hypothetical protein MIMGU_mgv1a011918mg                239   2e-75    Erythranthe guttata [common monkey flower]
ref|XP_009377344.1|  PREDICTED: chlorophyll a-b binding protein o...    239   2e-75    Pyrus x bretschneideri [bai li]
gb|ABN49454.2|  chloroplast chlorophyll a/b binding protein             239   2e-75    Pisum sativum [garden pea]
dbj|BAA25389.1|  light harvesting chlorophyll a/b-binding protein       239   2e-75    Nicotiana sylvestris
sp|P08221.1|CB21_CUCSA  RecName: Full=Chlorophyll a-b binding pro...    238   2e-75    Cucumis sativus [cucumbers]
gb|AFW90594.1|  chloroplast chlorophyll a/b binding protein             239   2e-75    Solanum tuberosum [potatoes]
ref|XP_004302854.1|  PREDICTED: chlorophyll a-b binding protein o...    239   2e-75    
gb|ABQ32304.1|  chloroplast light-harvesting chlorophyll a/b-bind...    238   2e-75    
ref|XP_010460769.1|  PREDICTED: chlorophyll a-b binding protein 1...    239   2e-75    
ref|XP_004148579.1|  PREDICTED: chlorophyll a-b binding protein 3...    239   2e-75    
ref|NP_001266111.1|  chlorophyll a-b binding protein AB80, chloro...    239   2e-75    
ref|XP_010549470.1|  PREDICTED: chlorophyll a-b binding protein 1...    239   2e-75    
ref|XP_009363087.1|  PREDICTED: chlorophyll a-b binding protein o...    239   2e-75    
sp|P15195.1|CB23_POLMU  RecName: Full=Chlorophyll a-b binding pro...    239   2e-75    
ref|XP_010097596.1|  Chlorophyll a-b binding protein 40                 238   3e-75    
gb|AAT08651.1|  chloroplast chlorophyll A-B binding protein             238   3e-75    
gb|ABK26463.1|  unknown                                                 238   3e-75    
ref|XP_009395692.1|  PREDICTED: chlorophyll a-b binding protein o...    238   3e-75    
sp|P07371.1|CB22_PEA  RecName: Full=Chlorophyll a-b binding prote...    239   3e-75    
ref|XP_008356026.1|  PREDICTED: chlorophyll a-b binding protein o...    238   3e-75    
ref|XP_009597417.1|  PREDICTED: chlorophyll a-b binding protein 5...    238   3e-75    
ref|XP_009782922.1|  PREDICTED: chlorophyll a-b binding protein 5...    238   3e-75    
ref|XP_009775650.1|  PREDICTED: chlorophyll a-b binding protein 2...    238   3e-75    
gb|ACR08639.1|  chloroplast chlorophyll A/B binding protein             238   3e-75    
ref|XP_006840304.1|  hypothetical protein AMTR_s00045p00069900          238   3e-75    
sp|P27496.1|CB25_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    238   3e-75    
ref|XP_009630190.1|  PREDICTED: chlorophyll a-b binding protein 2...    238   3e-75    
ref|XP_009598574.1|  PREDICTED: chlorophyll a-b binding protein 2...    238   3e-75    
ref|XP_006415534.1|  hypothetical protein EUTSA_v10008479mg             238   4e-75    
gb|ACD64978.1|  chloroplast chlorophyll a/b-binding protein             238   4e-75    
gb|EYU28185.1|  hypothetical protein MIMGU_mgv1a012021mg                238   4e-75    
gb|EYU28183.1|  hypothetical protein MIMGU_mgv1a012019mg                238   4e-75    
ref|XP_009618330.1|  PREDICTED: chlorophyll a-b binding protein 4...    238   4e-75    
ref|XP_010275593.1|  PREDICTED: chlorophyll a-b binding protein o...    238   4e-75    
emb|CDX84316.1|  BnaC04g10780D                                          238   4e-75    
ref|XP_002283566.1|  PREDICTED: chlorophyll a-b binding protein o...    238   4e-75    
ref|XP_009782921.1|  PREDICTED: chlorophyll a-b binding protein 5...    238   4e-75    
ref|XP_009598577.1|  PREDICTED: chlorophyll a-b binding protein 2...    238   4e-75    
ref|NP_174286.1|  chlorophyll A/B binding protein 1                     238   5e-75    
ref|XP_007221496.1|  hypothetical protein PRUPE_ppa010066mg             238   5e-75    
ref|XP_011460161.1|  PREDICTED: chlorophyll a-b binding protein o...    238   5e-75    
ref|XP_010499509.1|  PREDICTED: chlorophyll a-b binding protein 1...    238   5e-75    
ref|XP_010478366.1|  PREDICTED: chlorophyll a-b binding protein 1...    238   5e-75    
ref|XP_009396492.1|  PREDICTED: chlorophyll a-b binding protein o...    238   5e-75    
ref|XP_008800689.1|  PREDICTED: chlorophyll a-b binding protein o...    238   5e-75    
ref|XP_004147416.1|  PREDICTED: chlorophyll a-b binding protein 4...    238   5e-75    
gb|AIR93785.1|  chloroplast light harvesting chlorophyll A/B bind...    238   6e-75    
gb|EYU28187.1|  hypothetical protein MIMGU_mgv1a009948mg                239   6e-75    
gb|KCW75953.1|  hypothetical protein EUGRSUZ_D00321                     239   6e-75    
ref|NP_564339.1|  chlorophyll A/B binding protein 3                     238   6e-75    
gb|EYU19649.1|  hypothetical protein MIMGU_mgv1a011927mg                238   6e-75    
ref|XP_010243713.1|  PREDICTED: chlorophyll a-b binding protein o...    238   6e-75    
ref|XP_010499505.1|  PREDICTED: chlorophyll a-b binding protein 2...    238   6e-75    
gb|AAL38341.1|  chlorophyll a/b-binding protein                         238   6e-75    
ref|XP_009143778.1|  PREDICTED: chlorophyll a-b binding protein 1...    238   6e-75    
emb|CDY17247.1|  BnaA05g09410D                                          238   7e-75    
gb|ABF17940.1|  putative chloroplast chlorophyll a/b-binding protein    238   7e-75    
gb|AEV59638.1|  chloroplast photosystem II light harvesting compl...    236   7e-75    
gb|AAB87573.1|  chlorophyll a/b binding protein of LHCII type I p...    238   7e-75    
ref|XP_008366007.1|  PREDICTED: chlorophyll a-b binding protein o...    237   7e-75    
gb|KEH25005.1|  light-harvesting complex I chlorophyll A/B-bindin...    237   8e-75    
ref|XP_010247422.1|  PREDICTED: chlorophyll a-b binding protein o...    238   8e-75    
ref|XP_006449644.1|  hypothetical protein CICLE_v10016074mg             238   8e-75    
gb|AIB04243.1|  chloroplast light harvesting chlorophyll a/b bind...    236   9e-75    
ref|XP_011085268.1|  PREDICTED: chlorophyll a-b binding protein 2...    237   9e-75    
gb|EYU38943.1|  hypothetical protein MIMGU_mgv1a012024mg                237   9e-75    
gb|AFK39586.1|  unknown                                                 237   9e-75    
ref|XP_010916097.1|  PREDICTED: chlorophyll a-b binding protein o...    237   1e-74    
ref|XP_009795314.1|  PREDICTED: chlorophyll a-b binding protein 1...    237   1e-74    
ref|XP_010056879.1|  PREDICTED: chlorophyll a-b binding protein o...    237   1e-74    
ref|XP_009775645.1|  PREDICTED: chlorophyll a-b binding protein 2...    237   1e-74    
gb|AGU28449.1|  chlorophyll A/B binding protein 1                       234   1e-74    
ref|XP_002273106.2|  PREDICTED: chlorophyll a-b binding protein o...    237   1e-74    
gb|AAT08694.1|  chloroplast chlorophyll A-B binding protein 40          235   1e-74    
gb|ACI90636.1|  chloroplast light harvesting chlorophyll a/b bind...    236   1e-74    
ref|XP_009782923.1|  PREDICTED: chlorophyll a-b binding protein 5...    237   1e-74    
gb|AAG52048.1|AC022455_2  chlorophyll A-B-binding protein 2 precu...    236   1e-74    
ref|XP_009377335.1|  PREDICTED: chlorophyll a-b binding protein o...    237   1e-74    
ref|XP_009772885.1|  PREDICTED: chlorophyll a-b binding protein 5...    237   1e-74    
gb|AAR10886.1|  chlorophyll a/b binding protein                         237   1e-74    
ref|XP_010538237.1|  PREDICTED: chlorophyll a-b binding protein 1...    237   1e-74    
gb|AES74698.2|  light-harvesting complex I chlorophyll A/B-bindin...    237   1e-74    
ref|XP_010052093.1|  PREDICTED: chlorophyll a-b binding protein o...    237   1e-74    
ref|XP_011096521.1|  PREDICTED: chlorophyll a-b binding protein 2...    238   1e-74    
sp|P04782.1|CB24_PETSP  RecName: Full=Chlorophyll a-b binding pro...    237   1e-74    
gb|KFK44817.1|  hypothetical protein AALP_AA1G306700                    237   1e-74    
sp|P07369.1|CB2G_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    237   1e-74    
gb|EYU28462.1|  hypothetical protein MIMGU_mgv1a012008mg                237   1e-74    
gb|KEH25006.1|  light-harvesting complex I chlorophyll A/B-bindin...    237   1e-74    
ref|XP_006305533.1|  hypothetical protein CARUB_v10010022mg             237   1e-74    
ref|XP_008343203.1|  PREDICTED: chlorophyll a-b binding protein o...    239   1e-74    
ref|XP_010317413.1|  PREDICTED: chlorophyll a-b binding protein 3...    237   1e-74    
gb|AEV59641.1|  chloroplast photosystem II light harvesting compl...    236   1e-74    
gb|ABK23263.1|  unknown                                                 237   1e-74    
gb|AEV59640.1|  chloroplast photosystem II light harvesting compl...    236   1e-74    
ref|XP_008439658.1|  PREDICTED: chlorophyll a-b binding protein o...    236   1e-74    
ref|XP_008447450.1|  PREDICTED: chlorophyll a-b binding protein o...    236   2e-74    
ref|XP_009775649.1|  PREDICTED: chlorophyll a-b binding protein 2...    236   2e-74    
ref|XP_006415537.1|  hypothetical protein EUTSA_v10008476mg             237   2e-74    
gb|ACU23816.1|  unknown                                                 236   2e-74    
gb|AAA34148.1|  chlorophyll a/b-binding protein Cab-3C                  236   2e-74    
gb|AEV59642.1|  chloroplast photosystem II light harvesting compl...    236   2e-74    
ref|XP_009598575.1|  PREDICTED: chlorophyll a-b binding protein 2...    236   2e-74    
gb|EYU28186.1|  hypothetical protein MIMGU_mgv1a012011mg                236   2e-74    
gb|AHM26643.1|  a-b binding protein                                     236   2e-74    
ref|XP_002893588.1|  hypothetical protein ARALYDRAFT_473203             236   2e-74    
ref|XP_003548104.1|  PREDICTED: chlorophyll a-b binding protein 2...    236   2e-74    
ref|XP_004303878.1|  PREDICTED: chlorophyll a-b binding protein o...    236   2e-74    
gb|AFI60242.1|  light harvesting chlorophyll a/b binding protein        236   2e-74    
ref|XP_009628757.1|  PREDICTED: chlorophyll a-b binding protein 1...    236   2e-74    
ref|NP_001240146.1|  chlorophyll a-b binding protein 21, chloropl...    236   2e-74    
gb|AEV59639.1|  chloroplast photosystem II light harvesting compl...    235   2e-74    
ref|XP_002881334.1|  chlorophyll A-B-binding protein 2 precursor        235   2e-74    
gb|AFW90512.1|  chlorophyll a/b-binding protein                         236   2e-74    
ref|XP_011096520.1|  PREDICTED: chlorophyll a-b binding protein 2...    236   2e-74    
ref|XP_010924306.1|  PREDICTED: chlorophyll a-b binding protein o...    236   2e-74    
ref|XP_009593856.1|  PREDICTED: chlorophyll a-b binding protein 4...    236   2e-74    
ref|XP_008444193.1|  PREDICTED: chlorophyll a-b binding protein o...    236   3e-74    
sp|P13851.1|CB21_SINAL  RecName: Full=Chlorophyll a-b binding pro...    236   3e-74    
ref|XP_007211869.1|  hypothetical protein PRUPE_ppa010099mg             236   3e-74    
emb|CDX79562.1|  BnaC03g18980D                                          236   3e-74    
emb|CDY17248.1|  BnaA05g09400D                                          236   3e-74    
gb|AAL67432.1|AF458406_1  chlorophyll a/b binding protein               236   3e-74    
ref|XP_010904844.1|  PREDICTED: chlorophyll a-b binding protein o...    236   3e-74    
gb|AFC91647.1|  chloroplast chlorophyll A/B binding protein             236   3e-74    
ref|XP_006356078.1|  PREDICTED: chlorophyll a-b binding protein 3...    236   3e-74    
gb|ABF70112.1|  chlorophyll A-B binding protein (CAB), putative         236   3e-74    
emb|CDY26306.1|  BnaA09g26570D                                          236   3e-74    
gb|KFK36334.1|  hypothetical protein AALP_AA4G109200                    236   3e-74    
gb|EYU43289.1|  hypothetical protein MIMGU_mgv11b019945mg               236   3e-74    
gb|AGV54498.1|  LHCII type I chlorophyll a/b-binding protein            236   3e-74    
emb|CDX98158.1|  BnaC07g09400D                                          236   3e-74    
gb|ADI88502.1|  protoporphyrin IX magnesium chelatase                   236   3e-74    
gb|AHA84197.1|  chlorophyll a/b-binding protein                         236   3e-74    
gb|AEQ67395.1|  chloroplast chlorophyll A/B binding protein             236   3e-74    
ref|XP_009606800.1|  PREDICTED: chlorophyll a-b binding protein 5...    236   3e-74    
gb|AAB61236.1|  chlorophyll a/b-binding protein                         236   3e-74    
ref|XP_009377327.1|  PREDICTED: chlorophyll a-b binding protein o...    236   3e-74    
ref|XP_006356077.1|  PREDICTED: chlorophyll a-b binding protein 3...    236   3e-74    
ref|XP_009795316.1|  PREDICTED: chlorophyll a-b binding protein 4...    236   4e-74    
ref|XP_010460768.1|  PREDICTED: chlorophyll a-b binding protein 2...    236   4e-74    
gb|KJB69716.1|  hypothetical protein B456_011G041600                    236   4e-74    
ref|XP_008371583.1|  PREDICTED: chlorophyll a-b binding protein o...    236   4e-74    
ref|XP_009102798.1|  PREDICTED: chlorophyll a-b binding protein 1...    236   4e-74    
gb|EYU35814.1|  hypothetical protein MIMGU_mgv1a011908mg                236   4e-74    
gb|AIB04244.1|  chloroplast light harvesting chlorophyll a/b bind...    234   4e-74    
ref|XP_006356073.1|  PREDICTED: chlorophyll a-b binding protein 3...    236   4e-74    
ref|XP_007158464.1|  hypothetical protein PHAVU_002G154500g             235   4e-74    
ref|XP_010097597.1|  Chlorophyll a-b binding protein 40                 235   4e-74    
emb|CDY66768.1|  BnaAnng22920D                                          235   5e-74    
sp|P12470.1|CB25_NICPL  RecName: Full=Chlorophyll a-b binding pro...    235   5e-74    
gb|AGV54521.1|  LHCII type I chlorophyll a/b-binding protein            235   5e-74    
gb|ABB55370.1|  chlorophyll a-b binding protein 3C-like                 235   5e-74    
ref|XP_006356074.1|  PREDICTED: chlorophyll a-b binding protein 3...    235   5e-74    
ref|XP_009628755.1|  PREDICTED: chlorophyll a-b binding protein 4...    235   5e-74    
gb|KDP37945.1|  hypothetical protein JCGZ_04588                         235   5e-74    
ref|XP_006304391.1|  hypothetical protein CARUB_v10010908mg             235   5e-74    
ref|XP_009782924.1|  PREDICTED: chlorophyll a-b binding protein 5...    235   5e-74    
ref|XP_003548106.1|  PREDICTED: chlorophyll a/b-binding protein p...    235   5e-74    
ref|XP_009790934.1|  PREDICTED: chlorophyll a-b binding protein 4...    235   6e-74    
sp|P27492.1|CB21_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    235   6e-74    
gb|AAF26741.1|AF220527_1  chlorophyll a/b binding protein precursor     235   6e-74    
ref|XP_006356076.1|  PREDICTED: chlorophyll a-b binding protein 3...    235   6e-74    
ref|WP_037445947.1|  hypothetical protein                               232   6e-74    
dbj|BAD90930.1|  chlorophyll a/b-binding protein                        233   6e-74    
emb|CDP06329.1|  unnamed protein product                                235   6e-74    
ref|XP_009790936.1|  PREDICTED: chlorophyll a-b binding protein 4...    235   6e-74    
sp|P04781.1|CB23_PETSP  RecName: Full=Chlorophyll a-b binding pro...    235   6e-74    
gb|KCW75952.1|  hypothetical protein EUGRSUZ_D00320                     235   6e-74    
gb|AAB61238.1|  chlorophyll a/b-binding protein                         235   6e-74    
gb|AGU28448.1|  light-harvesting chlorophyll-protein complex II s...    235   7e-74    
ref|XP_009795315.1|  PREDICTED: chlorophyll a-b binding protein 4...    235   7e-74    
ref|XP_009759685.1|  PREDICTED: chlorophyll a-b binding protein 4...    235   7e-74    
ref|XP_009628754.1|  PREDICTED: chlorophyll a-b binding protein 1...    235   7e-74    
sp|P09756.1|CB23_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    235   7e-74    
ref|XP_007211864.1|  hypothetical protein PRUPE_ppa010081mg             235   7e-74    
ref|XP_002285646.1|  PREDICTED: chlorophyll a-b binding protein o...    235   7e-74    
gb|ACO51067.1|  chloroplast chlorophyll A-B binding protein             235   7e-74    
ref|XP_009389379.1|  PREDICTED: chlorophyll a-b binding protein o...    235   7e-74    
ref|XP_008784387.1|  PREDICTED: chlorophyll a-b binding protein o...    235   7e-74    
gb|AEY85026.1|  light-harvesting complex II protein                     235   7e-74    
ref|XP_002890838.1|  hypothetical protein ARALYDRAFT_473204             234   8e-74    
gb|AAA18529.1|  chlorophyll A/B binding protein                         235   8e-74    
ref|NP_001241277.1|  uncharacterized protein LOC100805310               234   8e-74    
dbj|BAF95850.1|  putative chloroplast chlorophyll a/b binding pro...    234   8e-74    
emb|CDP06328.1|  unnamed protein product                                235   8e-74    
emb|CDY35271.1|  BnaC03g59520D                                          235   8e-74    
ref|XP_009421488.1|  PREDICTED: chlorophyll a-b binding protein o...    235   8e-74    
ref|XP_008779641.1|  PREDICTED: chlorophyll a-b binding protein o...    235   8e-74    
ref|XP_006356075.1|  PREDICTED: chlorophyll a-b binding protein 3...    235   8e-74    
ref|XP_008371581.1|  PREDICTED: chlorophyll a-b binding protein o...    234   9e-74    
ref|XP_006364025.1|  PREDICTED: chlorophyll a-b binding protein 5...    234   9e-74    
ref|XP_008356022.1|  PREDICTED: chlorophyll a-b binding protein o...    234   1e-73    
ref|XP_009618329.1|  PREDICTED: chlorophyll a-b binding protein 4...    234   1e-73    
ref|XP_008364187.1|  PREDICTED: chlorophyll a-b binding protein o...    234   1e-73    
ref|XP_010926397.1|  PREDICTED: chlorophyll a-b binding protein o...    234   1e-73    
ref|XP_006356080.1|  PREDICTED: chlorophyll a-b binding protein 3...    234   1e-73    
gb|KHN28981.1|  Chlorophyll a-b binding protein 3, chloroplastic        234   1e-73    
ref|XP_002302798.2|  hypothetical protein POPTR_0002s19010g             234   1e-73    
gb|EYU19613.1|  hypothetical protein MIMGU_mgv1a011885mg                234   1e-73    
ref|XP_007151992.1|  hypothetical protein PHAVU_004G0927000g            232   1e-73    
ref|XP_009132986.1|  PREDICTED: chlorophyll a-b binding protein 1...    234   1e-73    
gb|AFV34722.1|  light harvesting chlorophyll a/b-binding protein 1-1    234   1e-73    
ref|XP_007158961.1|  hypothetical protein PHAVU_002G196400g             234   1e-73    
gb|KEH25007.1|  light-harvesting complex I chlorophyll A/B-bindin...    234   1e-73    
gb|AAB61237.1|  chlorophyll a/b-binding protein                         234   1e-73    
sp|P08963.1|CB22_HORVU  RecName: Full=Chlorophyll a-b binding pro...    234   1e-73    
ref|XP_006410587.1|  hypothetical protein EUTSA_v10017088mg             234   1e-73    
gb|AEV59643.1|  chloroplast photosystem II light harvesting compl...    233   1e-73    
emb|CDX99866.1|  BnaC05g22880D                                          234   1e-73    
sp|P12333.1|CB2A_SPIOL  RecName: Full=Chlorophyll a-b binding pro...    234   1e-73    
ref|XP_002524616.1|  chlorophyll A/B binding protein, putative          234   2e-73    
ref|XP_008439659.1|  PREDICTED: chlorophyll a-b binding protein o...    236   2e-73    
gb|AEV59645.1|  chloroplast photosystem II light harvesting compl...    233   2e-73    
gb|AEO51755.1|  chloroplast chlorophyll A/B binding protein             234   2e-73    
ref|NP_001235283.1|  chlorophyll a/b-binding protein                    234   2e-73    
gb|AAO45885.1|  chlorophyll a/b-binding protein precursor               232   2e-73    
ref|XP_009611577.1|  PREDICTED: chlorophyll a-b binding protein 4...    233   2e-73    
gb|AHA84168.1|  chlorophyll a/b-binding protein                         233   2e-73    
gb|ACU23974.1|  unknown                                                 233   2e-73    
ref|XP_009606802.1|  PREDICTED: chlorophyll a-b binding protein 1...    233   2e-73    
ref|XP_010509751.1|  PREDICTED: chlorophyll a-b binding protein 1...    233   2e-73    
ref|XP_004961193.1|  PREDICTED: chlorophyll a-b binding protein M...    233   2e-73    
gb|AAD21625.1|  putative chlorophyll a/b-binding protein                234   3e-73    
gb|ABK24790.1|  unknown                                                 229   3e-73    
gb|ABD38707.1|  chloroplast chlorophyll a/b binding protein             233   3e-73    
gb|EYU43278.1|  hypothetical protein MIMGU_mgv1a011933mg                233   3e-73    



>emb|CDP19007.1| unnamed protein product [Coffea canephora]
Length=265

 Score =   317 bits (811),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+ GIQQSAFAGQ+ALK Q +LLRKVGS G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSGIQQSAFAGQTALKPQNELLRKVGSFGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>ref|XP_009365212.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Pyrus x bretschneideri]
Length=287

 Score =   312 bits (800),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 145/172 (84%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = +1

Query  37   KLRRAEESSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWY  216
            KL+  ++  +MA+  IQQSAFAGQ+ALK   +L+RK+G  G  RF+MRRTVKSAPQSIWY
Sbjct  13   KLQTEKKQQAMATSAIQQSAFAGQTALKQSNELVRKIGGLGGGRFSMRRTVKSAPQSIWY  72

Query  217  GPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGAL  396
            GPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGAL
Sbjct  73   GPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGAL  132

Query  397  GCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            GCVFPEILS+NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  133  GCVFPEILSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  184



>ref|XP_002321186.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
 gb|EEE99501.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
Length=265

 Score =   311 bits (798),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RKVGSSG  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGSSGDGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>ref|XP_002301582.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
 gb|ABK95270.1| unknown [Populus trichocarpa]
 gb|ABK95825.1| unknown [Populus trichocarpa]
 gb|EEE80855.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
Length=265

 Score =   310 bits (793),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   DL+RKVGS G  R TMRRTVKSAPQSIWYGPDRPK+LGP
Sbjct  1    MAASAIQQSAFAGQTALKQPNDLVRKVGSFGGGRVTMRRTVKSAPQSIWYGPDRPKFLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGE+VWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVKFGESVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>gb|ABK96530.1| unknown [Populus trichocarpa x Populus deltoides]
Length=265

 Score =   310 bits (793),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   DL+RKVGS G  R TMRRTVKSAPQSIWYGPDRPK+LGP
Sbjct  1    MAASAIQQSAFAGQTALKQPNDLVRKVGSFGGGRVTMRRTVKSAPQSIWYGPDRPKFLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGE+VWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVKFGESVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>ref|XP_011005408.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Populus euphratica]
Length=265

 Score =   310 bits (793),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RKVG SG  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGCSGDGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>gb|ACX54226.1| chlorophyll A/B binding protein [Jatropha curcas]
Length=261

 Score =   309 bits (792),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RKVGS G  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGSFGGGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>gb|KDP29912.1| hypothetical protein JCGZ_18481 [Jatropha curcas]
Length=265

 Score =   309 bits (792),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RKVGS G  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGSFGGGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>gb|AFO67217.1| putative chlorophyll a/b binding protein [Aralia elata]
Length=265

 Score =   309 bits (792),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK Q +L+RKVGS G    TMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKPQNELVRKVGSFGGGHITMRRTVKSAPESIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWAS
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAS  163



>ref|XP_004144543.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164056.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Cucumis sativus]
 gb|KGN43422.1| Chlorophyll A/B binding protein [Cucumis sativus]
Length=265

 Score =   309 bits (791),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RKVG+ G ARFTMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGALGGARFTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+L+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>gb|AFJ25031.1| chlorophyll a/b binding protein [Lonicera japonica]
Length=265

 Score =   308 bits (790),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQ SAFAGQ+ LK Q +L+RKVGS GS+R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQHSAFAGQTVLKQQNELVRKVGSFGSSRTTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWAS
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAS  163



>ref|XP_011039316.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Populus 
euphratica]
Length=265

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   DL+RKVGS G  R TMRRTVKSAPQSIWYGPDRPK+LGP
Sbjct  1    MAASAIQQSAFAGQTALKQPNDLVRKVGSFGGGRVTMRRTVKSAPQSIWYGPDRPKFLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>ref|XP_002531690.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF30681.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   308 bits (789),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RKVGS G  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKPSNELVRKVGSVGGGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILAK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|XP_008462084.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Cucumis melo]
Length=265

 Score =   308 bits (788),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RKVG+ G +RFTMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQAALKQSNELVRKVGAVGGSRFTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+L+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|XP_009630805.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   308 bits (788),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALKSQ +L+RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNELVRKIGSFNGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>ref|XP_008379987.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Malus domestica]
Length=265

 Score =   307 bits (787),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RK+G  G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSXELVRKIGGLGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILS+
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSR  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>dbj|BAE46383.1| chlorophyll a/b binding protein [Panax ginseng]
Length=265

 Score =   307 bits (787),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQ+SAFAGQ+ALK Q +L+RK+GS G  R TMRRTV+SAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQRSAFAGQTALKPQNELVRKIGSLGGGRITMRRTVRSAPESIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEIL++
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAR  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWAS
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAS  163



>gb|AEY78525.1| chlorophyll a/b-binding protein [Tagetes erecta]
Length=265

 Score =   307 bits (786),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAG +ALK Q +L++K GS    RFTMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGSAALKPQNELVKKTGSFTGGRFTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+LSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEVLSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>gb|EYU42755.1| hypothetical protein MIMGU_mgv1a011961mg [Erythranthe guttata]
Length=265

 Score =   307 bits (786),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF+G++ALK Q +L+RK+G+ G  RFTMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFSGKTALKPQNELIRKIGNVGGGRFTMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+LSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEVLSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA+
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAT  163



>sp|P12062.1|CB26_PETSP RecName: Full=Chlorophyll a-b binding protein 37, chloroplastic; 
AltName: Full=LHCII type I CAB-37; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA28639.1| chlorophyll a/b binding protein [Petunia x hybrida]
Length=265

 Score =   306 bits (785),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALKSQ +L+RK+GS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA+
Sbjct  121  NGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAA  163



>ref|XP_007215825.1| hypothetical protein PRUPE_ppa010078mg [Prunus persica]
 gb|EMJ17024.1| hypothetical protein PRUPE_ppa010078mg [Prunus persica]
Length=265

 Score =   306 bits (784),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RK+G  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELIRKIGGLGGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWA  162



>ref|XP_010270182.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Nelumbo nucifera]
Length=264

 Score =   306 bits (783),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 154/162 (95%), Gaps = 1/162 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK Q +L+RKVG SG  R +MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQQNELVRKVGVSG-GRISMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH+RWAMLGALGCVFPEIL+K
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGCVFPEILAK  119

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  161



>ref|XP_009802594.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Nicotiana sylvestris]
Length=265

 Score =   306 bits (783),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF+GQ+ALKSQ +L+RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFSGQTALKSQNELVRKIGSFNGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>ref|XP_009343482.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Pyrus x bretschneideri]
Length=265

 Score =   306 bits (783),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ LK   +L++K+G  G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTVLKQSNELVQKIGGLGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|XP_010252708.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Nelumbo nucifera]
Length=264

 Score =   306 bits (783),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 153/162 (94%), Gaps = 1/162 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK Q +L+RKVG SG  R +MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQQNELVRKVGVSG-GRVSMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIH+RWAMLGALGCVFPEIL K
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHARWAMLGALGCVFPEILEK  119

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  161



>ref|XP_010112785.1| Chlorophyll a-b binding protein 151 [Morus notabilis]
 gb|EXC34900.1| Chlorophyll a-b binding protein 151 [Morus notabilis]
Length=265

 Score =   306 bits (783),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RK G+ G  R TMRRTV+SAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKAGAVGGGRATMRRTVRSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>ref|XP_009626274.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Nicotiana tomentosiformis]
Length=265

 Score =   305 bits (782),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALKSQ +L+RK+G     R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNELVRKIGCFNGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>sp|P27494.1|CB23_TOBAC RecName: Full=Chlorophyll a-b binding protein 36, chloroplastic; 
AltName: Full=LHCII type I CAB-36; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA41188.1| chlorophyll a/b binding protein [Nicotiana tabacum]
Length=265

 Score =   305 bits (782),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  I+QSAFAGQ+ALKSQ +L+RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIEQSAFAGQTALKSQNELVRKIGSFNGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILA+WAS
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAVWAS  163



>ref|XP_008342193.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Malus domestica]
Length=265

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQ+SAFAGQ+ LK   +L+RK+G  G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQRSAFAGQTVLKQSNELVRKIGGLGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|XP_009136161.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Brassica rapa]
 emb|CDX93077.1| BnaA03g37990D [Brassica napus]
Length=265

 Score =   305 bits (781),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQS+FAGQ+ALK   DLLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|NP_001234739.1| chlorophyll a-b binding protein 4, chloroplastic [Solanum lycopersicum]
 sp|P14278.1|CB24_SOLLC RecName: Full=Chlorophyll a-b binding protein 4, chloroplastic; 
AltName: Full=LHCII type I CAB-4; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34141.1| chlorophyll a/b-binding protein precursor [Solanum lycopersicum]
Length=265

 Score =   305 bits (781),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+C IQQSAF GQ+  KSQ + +RKVG+ G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATCAIQQSAFVGQAVGKSQNEFIRKVGNFGEGRITMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWA  162



>ref|XP_010467054.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Camelina sativa]
 ref|XP_010488741.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Camelina sativa]
Length=265

 Score =   305 bits (780),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQS+FAGQ+ALK   DLLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>emb|CDY15050.1| BnaC03g44110D [Brassica napus]
Length=265

 Score =   305 bits (780),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQS+FAGQ+ALK   DLLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|WP_039311140.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91138.1| hypothetical protein QW71_36380, partial [Paenibacillus sp. IHB 
B 3415]
Length=191

 Score =   302 bits (773),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 157/177 (89%), Gaps = 3/177 (2%)
 Frame = +1

Query  19   TINSNRKLRRAEESSS---MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV  189
            T N   +  + ++ SS   MA+  IQQSAFAGQ+ALK Q +L+RK+GS G  R TMRRTV
Sbjct  9    TTNKPTEKHQHQQRSSHAVMATSAIQQSAFAGQTALKPQNELVRKIGSFGGGRITMRRTV  68

Query  190  KSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIH  369
            +SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH
Sbjct  69   RSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH  128

Query  370  SRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSIL  540
             RWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSIL
Sbjct  129  CRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSIL  185



>ref|XP_011100602.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Sesamum 
indicum]
Length=266

 Score =   305 bits (780),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 152/163 (93%), Gaps = 1/163 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGS-SGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+   QQSAF GQ+ALK Q +L+RKVG+ S   RFTMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MATSAFQQSAFGGQTALKPQNELIRKVGNVSAGGRFTMRRTVKSAPQSIWYGPDRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEILS
Sbjct  61   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  163



>ref|XP_006296728.1| hypothetical protein CARUB_v10014404mg [Capsella rubella]
 gb|EOA29626.1| hypothetical protein CARUB_v10014404mg [Capsella rubella]
Length=265

 Score =   305 bits (780),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQS+FAGQ+ALK   DLLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQAALKPSNDLLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>gb|KDO58421.1| hypothetical protein CISIN_1g024579mg [Citrus sinensis]
Length=265

 Score =   305 bits (780),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+AL+   + +RKVG +   R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>gb|AHC95482.1| chlorophyll A/B binding protein [Ziziphus jujuba]
Length=264

 Score =   304 bits (779),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 152/162 (94%), Gaps = 1/162 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RKVGS G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGSGG-GRITMRRTVKSVPQSIWYGPDRPKYLGP  59

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  119

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  120  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  161



>ref|XP_008229895.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Prunus mume]
Length=265

 Score =   304 bits (779),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  I QSAFAGQ+ALK   +L+RK+G  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIHQSAFAGQTALKQSNELIRKIGGLGGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWA  162



>gb|AAO62942.1| chlorophyll a/b binding protein [Nicotiana tabacum]
Length=265

 Score =   303 bits (777),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF GQ+  KSQ +L+RK+GS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGQTVAKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  162



>ref|XP_004293460.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=265

 Score =   303 bits (777),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RK+GS G  R +MRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKPSNELVRKIGSLGGGRISMRRTVKSAPESIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+LSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEVLSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWA  162



>emb|CAA52750.1| chlorophyll a/b binding protein [Amaranthus hypochondriacus]
Length=264

 Score =   303 bits (777),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 152/162 (94%), Gaps = 1/162 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF GQ+ LK Q +L+RKVG +G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSTIQQSAFVGQTLLKQQNELVRKVGGNG-GRFSMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEILSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  119

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIF EGGLDYLGNPNLIHAQSILAIWA
Sbjct  120  NGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLIHAQSILAIWA  161



>gb|AAD28771.1|AF134124_1 Lhcb2 protein [Arabidopsis thaliana]
Length=265

 Score =   303 bits (777),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQS+FAGQ+ALK   +LLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNELLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|NP_178585.1| photosystem II light harvesting complex protein 2.1 [Arabidopsis 
thaliana]
 gb|AAD31358.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AAK96468.1| At2g05100/F15L11.2 [Arabidopsis thaliana]
 gb|AAK96540.1| At2g05100/F15L11.2 [Arabidopsis thaliana]
 gb|AAN71932.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AEC05894.1| photosystem II light harvesting complex protein 2.1 [Arabidopsis 
thaliana]
Length=265

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQS+FAGQ+ALK   +LLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNELLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|XP_009618965.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   303 bits (777),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF GQ+  KSQ +L+RK+GS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGQTVAKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  162



>ref|XP_002885789.1| Lhcb2 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62048.1| Lhcb2 protein [Arabidopsis lyrata subsp. lyrata]
Length=265

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQS+FAGQ+ALK   DLLRK G SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKAGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>gb|AAC34983.1| light harvesting chlorophyll A/B binding protein [Prunus persica]
Length=265

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RK+G  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELIRKIGGLGGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+N +LEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNGELEVIHSRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWA  162



>ref|XP_002271687.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Vitis vinifera]
 emb|CAN71610.1| hypothetical protein VITISV_000630 [Vitis vinifera]
Length=265

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQ+SAFAGQ+ALK   +L+RKVG  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQRSAFAGQTALKQPNELVRKVGGLGGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  162



>ref|XP_006447758.1| hypothetical protein CICLE_v10016280mg [Citrus clementina]
 ref|XP_006469510.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Citrus sinensis]
 gb|ESR60998.1| hypothetical protein CICLE_v10016280mg [Citrus clementina]
Length=265

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+AL+   + +RKVG +   R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>gb|AFK45982.1| unknown [Lotus japonicus]
Length=265

 Score =   303 bits (776),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF GQ+ALK   +LLRK G  G  RFTMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGQTALKQGNELLRKAGGFGKGRFTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEIL +
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILER  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAT  163



>ref|XP_010412501.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Camelina sativa]
Length=265

 Score =   302 bits (774),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQS+FAGQ+ALK   DLLRKVG S   R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKVGVSSGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|XP_004251540.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Solanum 
lycopersicum]
Length=265

 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQ SAFAGQ+ALKSQ + +RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQHSAFAGQTALKSQNEFIRKIGSFEGGRVTMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>gb|AAL29886.1|M97171_1 chlorophyll a/b binding protein type II [Glycine max]
Length=265

 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RK G +G  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQLNELVRKTGGAGKGRTTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|XP_006352013.1| PREDICTED: chlorophyll a-b binding protein 37, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALKSQ + +R +GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNEFIRTIGSFEGGRVTMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>gb|AEK26372.1| chloroplast photosystem II chlorophyll a/b binding protein [Sedum 
alfredii]
 gb|AHB24930.1| chloroplast photosystem II light harvesting complex protein 2.1 
[Sedum alfredii]
Length=265

 Score =   302 bits (773),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQ SAFAGQ++LK Q +L+RKVG+    R TMRRTVKS PQSIWYG DRPKYLGP
Sbjct  1    MATSAIQSSAFAGQTSLKQQNELVRKVGNFSGGRATMRRTVKSTPQSIWYGADRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWAS
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAS  163



>gb|AAD28769.1|AF134122_1 Lhcb2 protein [Arabidopsis thaliana]
Length=265

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            M +  IQQS+FAGQ+ALK   +LLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MGTSAIQQSSFAGQTALKPSNELLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|XP_009111582.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Brassica rapa]
 emb|CDY20039.1| BnaA09g02120D [Brassica napus]
Length=265

 Score =   301 bits (772),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S   R  MRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGRVVMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>ref|XP_009792415.1| PREDICTED: chlorophyll a-b binding protein 37, chloroplastic-like 
[Nicotiana sylvestris]
Length=265

 Score =   301 bits (772),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF G++  KSQ +L+RK+GS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGRTVAKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  162



>ref|XP_006363015.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   301 bits (772),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF GQ+  KSQ + +RKVGS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGQAVGKSQNEFVRKVGSFGEGRITMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWA  162



>emb|CAA84525.1| chlorophyll a,b binding protein type I [Solanum tuberosum]
Length=265

 Score =   301 bits (772),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALKSQ + +RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNEFIRKIGSFEGGRVTMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARN +LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNLELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  NGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  163



>gb|AII25433.1| light-harvesting chlorophyll a/b binding protein [Sedum alfredii]
Length=265

 Score =   301 bits (772),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQ SAFAGQ++LK Q +L+RKVG+    R TMRRTVKS PQSIWYG DRPKYLGP
Sbjct  1    MATSAIQSSAFAGQTSLKQQNELVRKVGNFSGGRATMRRTVKSTPQSIWYGADRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWAS
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAS  163



>ref|XP_010412415.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Camelina sativa]
Length=172

 Score =   298 bits (763),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S F+GQ+ALK   DLLRKVGSS G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSTFSGQTALKPSNDLLRKVGSSNGGGRIVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  163



>gb|ACJ84374.1| unknown [Medicago truncatula]
Length=265

 Score =   301 bits (770),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF G++ LK   + +RK GS G +RFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLKQGNEFIRKAGSFGQSRFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAT  163



>gb|AFK45300.1| unknown [Medicago truncatula]
Length=265

 Score =   301 bits (770),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF G++ LK   + +RK GS G +RFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLKQGNEFIRKAGSFGQSRFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAT  163



>ref|XP_003617948.1| Chlorophyll a/b binding protein [Medicago truncatula]
 gb|AET00907.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=265

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF G++ LK   + +RK GS G +RFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLKQGNEFIRKAGSFGQSRFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAT  163



>ref|NP_178582.1| photosystem II light harvesting complex protein 2.2 [Arabidopsis 
thaliana]
 gb|AAD28770.1|AF134123_1 Lhcb2 protein [Arabidopsis thaliana]
 gb|AAD25595.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AAL06878.1| At2g05070/F1O13.20 [Arabidopsis thaliana]
 gb|AAL32641.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AAL47403.1| At2g05070/F1O13.20 [Arabidopsis thaliana]
 gb|AAM13371.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AEC05893.1| photosystem II light harvesting complex protein 2.2 [Arabidopsis 
thaliana]
Length=265

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQS+FAGQ+ALK  +DL++KVG  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSSDLIQKVGVLGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|XP_010045878.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Eucalyptus grandis]
 gb|KCW88692.1| hypothetical protein EUGRSUZ_A01047 [Eucalyptus grandis]
Length=265

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK  ++L+RKVG+    R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATTVIQQSAFAGQTALKQSSELVRKVGNFAGGRATMRRTVKSVPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEIL K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILQK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>gb|AAD48017.1|AF165529_1 chlorophyll a/b binding protein [Rumex palustris]
Length=264

 Score =   301 bits (770),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 153/162 (94%), Gaps = 1/162 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+ GIQ SA AGQ+ALK Q +L+RKVG +G  RF MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MAASGIQFSAIAGQTALKPQNELVRKVGGNG-GRFFMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPE+LSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLSK  119

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGV+FGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  120  NGVQFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWA  161



>ref|NP_001240183.1| uncharacterized protein LOC100793702 [Glycine max]
 gb|ACU18219.1| unknown [Glycine max]
 gb|KHN43946.1| Chlorophyll a-b binding protein 151, chloroplastic [Glycine soja]
Length=265

 Score =   300 bits (769),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RK G +G  R  MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQLNELVRKTGGAGKGRTNMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>gb|AFW90566.1| chlorophyll a/b-binding protein [Solanum tuberosum]
Length=271

 Score =   300 bits (769),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF GQ+  KSQ + +RKVGS G +R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGQAVGKSQNEFVRKVGSCGESRITMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSY TGEFPGDYGWDTAGLSADPETFARNR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYSTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWA  162



>ref|XP_010665939.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 emb|CAA74179.1| chlorophyll a/b-binding protein [Beta vulgaris subsp. vulgaris]
Length=264

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 152/163 (93%), Gaps = 1/163 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ LK Q +L+RK G +G  R +MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSTIQQSAFAGQTILKPQNELVRKFGGNG-GRASMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  119

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAG+QIF EGGLDYLGNPNLIHAQSILAIWAS
Sbjct  120  NGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLIHAQSILAIWAS  162



>gb|KFK23428.1| hypothetical protein AALP_AAs45999U001400 [Arabis alpina]
Length=265

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQS+FAGQ+ALK   ++LRKVG S   R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNEILRKVGVSSGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>emb|CDX83726.1| BnaC07g24660D [Brassica napus]
Length=266

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  164



>gb|AGZ15385.1| chlorophyll a/b-binding protein (LHCII type II) [Phaseolus vulgaris]
Length=239

 Score =   298 bits (764),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+   QQSAFAGQ+ALK   + +RK G SG  R  MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAFQQSAFAGQTALKQVNEFVRKTGGSGKGRTNMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  162



>emb|CDY13732.1| BnaA06g31910D [Brassica napus]
Length=266

 Score =   300 bits (767),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPANDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  164



>ref|XP_009151928.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic-like 
[Brassica rapa]
 emb|CDY49770.1| BnaA02g29010D [Brassica napus]
Length=266

 Score =   300 bits (767),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  164



>ref|XP_006395408.1| hypothetical protein EUTSA_v10004777mg [Eutrema salsugineum]
 dbj|BAJ33772.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ32694.1| hypothetical protein EUTSA_v10004777mg [Eutrema salsugineum]
Length=266

 Score =   299 bits (766),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  164



>ref|XP_007142492.1| hypothetical protein PHAVU_008G285100g [Phaseolus vulgaris]
 gb|AGV54257.1| LHCII type II chlorophyll a/b-binding protein [Phaseolus vulgaris]
 gb|ESW14486.1| hypothetical protein PHAVU_008G285100g [Phaseolus vulgaris]
Length=265

 Score =   299 bits (766),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+   QQSAFAGQ+ALK   + +RK G SG  R  MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAFQQSAFAGQTALKQVNEFVRKTGGSGKGRTNMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  162



>ref|NP_001241179.1| uncharacterized protein LOC100815789 [Glycine max]
 gb|ACU19775.1| unknown [Glycine max]
 gb|KHN46928.1| Chlorophyll a-b binding protein 215, chloroplastic [Glycine soja]
Length=265

 Score =   299 bits (765),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF GQ+ALK   + +RK G +G  R  MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGQTALKQLNEFVRKTGGAGKGRTNMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|XP_010502775.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic-like 
[Camelina sativa]
Length=266

 Score =   299 bits (765),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S+FAGQ+ALK   DLLRKVGSS G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGSSNGGGRIVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  163



>emb|CDY03989.1| BnaC02g37040D [Brassica napus]
Length=266

 Score =   298 bits (764),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSVIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  164



>ref|XP_007049308.1| Photosystem II light harvesting complex gene 2.1 [Theobroma cacao]
 gb|EOX93465.1| Photosystem II light harvesting complex gene 2.1 [Theobroma cacao]
Length=265

 Score =   298 bits (764),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+RKVG  G  R TMRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGVFGGGRVTMRRTVKSAPASIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEILS+
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSR  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>emb|CDY00149.1| BnaC09g01520D [Brassica napus]
Length=266

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S+F GQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFTGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  164



>gb|KJB06589.1| hypothetical protein B456_001G192000 [Gossypium raimondii]
 gb|KJB06590.1| hypothetical protein B456_001G192000 [Gossypium raimondii]
Length=265

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF GQ+ALK   +LLRKVG+    R TMRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFVGQTALKQSNELLRKVGAFDGGRVTMRRTVKSAPTSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|XP_004491575.1| PREDICTED: chlorophyll a-b binding protein 215, chloroplastic-like 
[Cicer arietinum]
Length=265

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF G++ L+   + +RK GS G  RFTMRRTVKS P+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLRQGNEFIRKAGSFGQGRFTMRRTVKSTPESIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAT  163



>gb|KJB06801.1| hypothetical protein B456_001G192300 [Gossypium raimondii]
Length=265

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF GQ+ALK   +LLRKVG+    R TMRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFVGQTALKQSNELLRKVGAFDGGRVTMRRTVKSAPTSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>gb|ABO20852.1| chlorophyll a/b binding protein of LHCII type I [Lilium longiflorum]
Length=264

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 152/162 (94%), Gaps = 1/162 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF GQ+ALK++ +L+RKVG  G  R +MRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFTGQTALKNRDELVRKVGVVG-GRVSMRRTVKSAPQSIWYGADRPKYLGP  59

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+LSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSK  119

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  161



>ref|XP_006291684.1| hypothetical protein CARUB_v10017845mg [Capsella rubella]
 gb|EOA24582.1| hypothetical protein CARUB_v10017845mg [Capsella rubella]
Length=266

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S+FAGQ+ LK   DLLRKVG+S G AR  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTTLKPSNDLLRKVGASNGGARIVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  163



>ref|XP_010514479.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Camelina 
sativa]
Length=266

 Score =   297 bits (761),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S F+GQ+ALK   DLLRKVGSS G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSTFSGQTALKPSNDLLRKVGSSNGGGRIVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  163



>gb|AAF89205.1|AF279248_1 LHCII type II chlorophyll a/b-binding protein [Vigna radiata]
Length=265

 Score =   297 bits (760),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 146/162 (90%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+   QQSAFAGQ+ALK   + +RK G SG  R  MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATTAFQQSAFAGQTALKQVNEFVRKTGGSGKGRTNMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALG VFPEIL K
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGIVFPEILEK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>gb|KFK33682.1| hypothetical protein AALP_AA5G045900 [Arabis alpina]
Length=266

 Score =   297 bits (760),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYG DRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGADRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  164



>gb|AEO51757.1| chloroplast chlorophyll A/B binding protein [Dimocarpus longan]
Length=265

 Score =   296 bits (759),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  +Q S+FAGQ++L    + +RKVGS G  R TMRRTVKS P SIWYGPDRPKYLGP
Sbjct  1    MATTALQHSSFAGQTSLNLSNEFIRKVGSFGEGRITMRRTVKSVPASIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAT  163



>ref|XP_006291597.1| hypothetical protein CARUB_v10017751mg [Capsella rubella]
 gb|EOA24495.1| hypothetical protein CARUB_v10017751mg [Capsella rubella]
Length=293

 Score =   298 bits (762),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = +1

Query  64   SMASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYL  240
            +MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYL
Sbjct  27   AMATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRIVMRRTVKSTPQSIWYGPDRPKYL  86

Query  241  GPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEIL  420
            GPFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEIL
Sbjct  87   GPFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEIL  146

Query  421  SKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            SKNGVKFGEAVWF+AG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  147  SKNGVKFGEAVWFRAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  190



>gb|KJB10748.1| hypothetical protein B456_001G220900 [Gossypium raimondii]
Length=265

 Score =   296 bits (759),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+ KVG+ G  R +MRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVCKVGAVGGGRVSMRRTVKSAPTSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>gb|AAW31512.1| light-harvesting chlorophyll-a/b binding protein Lhcb2 [Pisum 
sativum]
Length=265

 Score =   296 bits (759),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF G++ L+   + +RK G+ G ARFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLRQGNEFIRKAGNFGQARFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGC FPE+L K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPELLEK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAG+QIF+EGGLDYLGNPNLIHAQSILAIWA+
Sbjct  121  NGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWAT  163



>ref|XP_002875397.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51656.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
Length=266

 Score =   296 bits (759),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S+FAGQ+ALK   DL+RKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLIRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  163



>ref|XP_009397219.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Musa acuminata subsp. malaccensis]
 gb|ABF70157.1| chlorophyll A-B binding protein (CAB), putative [Musa acuminata]
Length=264

 Score =   296 bits (758),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 150/162 (93%), Gaps = 1/162 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  +QQSAFAGQ+ALK Q +L+R+VGSS   RF MRRT  S P+SIWYGPDRPKYLGP
Sbjct  1    MATSALQQSAFAGQTALKQQNELVRRVGSS-RGRFFMRRTTASTPKSIWYGPDRPKYLGP  59

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEIL+K
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLGALGCVFPEILAK  119

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  161



>gb|KFK33681.1| hypothetical protein AALP_AA5G045800 [Arabis alpina]
Length=266

 Score =   296 bits (758),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYG DRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGADRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  164



>sp|P12332.2|CB21_SILPR RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor, 
partial [Silene latifolia subsp. alba]
 gb|AAB42157.1| chlorophyl-a/b-binding protein precursor, partial [Silene latifolia 
subsp. alba]
Length=205

 Score =   294 bits (752),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 151/162 (93%), Gaps = 1/162 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ LK Q +L+RKVG +G  R +MRRT+KSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSTIQQSAFAGQTLLKPQNELVRKVGGNG-GRVSMRRTIKSAPESIWYGPDRPKYLGP  59

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L+K
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAK  119

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIF EGGLDYLGNPNL+HAQSILAIWA
Sbjct  120  NGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLVHAQSILAIWA  161



>ref|XP_010557706.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Tarenaya 
hassleriana]
Length=266

 Score =   296 bits (757),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  249
            A+  IQ++AFAGQ+AL    + LRKVG S   R TMRRTVKSAPQSIWYGPDRPKYLGPF
Sbjct  3    ATSAIQKTAFAGQTALNQSNEFLRKVGVSSGGRVTMRRTVKSAPQSIWYGPDRPKYLGPF  62

Query  250  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKN  429
            SE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEILSKN
Sbjct  63   SENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKN  122

Query  430  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            GVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  123  GVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  163



>sp|P27518.2|CB21_GOSHI RecName: Full=Chlorophyll a-b binding protein 151, chloroplastic; 
AltName: Full=LHCII type II CAB-151; Short=LHCP; Flags: 
Precursor [Gossypium hirsutum]
 emb|CAA38025.1| chlorophyll ab binding protein [Gossypium hirsutum]
 gb|KHG21776.1| Chlorophyll a-b binding protein, chloroplastic [Gossypium arboreum]
Length=265

 Score =   296 bits (757),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAFAGQ+ALK   +L+ K+G+ G  R +MRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVCKIGAVGGGRVSMRRTVKSAPTSIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>sp|P27520.1|CB215_PEA RecName: Full=Chlorophyll a-b binding protein 215, chloroplastic; 
AltName: Full=LHCII type II CAB-215; Short=LHCP; Flags: 
Precursor [Pisum sativum]
 emb|CAA40365.1| chlorophyll a/b-binding protein [Pisum sativum]
Length=265

 Score =   295 bits (756),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQQSAF G++ L+   + +RK G+ G ARFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLRQGNEFIRKRGNFGQARFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGC FPE+L K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPELLEK  120

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAG+QIF+EGGLDYLGNPNLIHAQSILAIWA+
Sbjct  121  NGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWAT  163



>ref|NP_189406.1| photosystem II light harvesting complex protein 2.3 [Arabidopsis 
thaliana]
 gb|AAD28772.1|AF134125_1 Lhcb2 protein [Arabidopsis thaliana]
 gb|AAK48984.1|AF370557_1 light harvesting chlorophyll a/b-binding protein [Arabidopsis 
thaliana]
 dbj|BAB02693.1| light harvesting chlorophyll a/b-binding protein [Arabidopsis 
thaliana]
 gb|AAP13406.1| At3g27700 [Arabidopsis thaliana]
 gb|AEE77352.1| photosystem II light harvesting complex protein 2.3 [Arabidopsis 
thaliana]
Length=266

 Score =   295 bits (756),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S+FAGQ+ LK   DLLRK+G+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTTLKPSNDLLRKIGASNGGGRIIMRRTVKSTPQSIWYGPDRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  163



>gb|KFK33683.1| hypothetical protein AALP_AA5G046000 [Arabis alpina]
Length=266

 Score =   294 bits (753),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSA-RFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S    R  MRRTVKS PQSIWYG DRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNDGGRVVMRRTVKSTPQSIWYGADRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAS  164



>sp|P12328.1|CB21_LEMGI RecName: Full=Chlorophyll a-b binding protein of LHCII type I, 
chloroplastic; Short=CAB; Short=LHCP; Flags: Precursor [Lemna 
gibba]
 gb|AAA33392.1| chlorophyll a/b apoprotein [Lemna gibba]
Length=264

 Score =   294 bits (752),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 1/163 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQ SAFAGQ+ALK + +L+RKVG S   RF+MRRTVK+ PQSIWYG DRPK+LGP
Sbjct  1    MAASAIQSSAFAGQTALKQRDELVRKVGVS-DGRFSMRRTVKAVPQSIWYGADRPKFLGP  59

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC+FPE+LSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSK  119

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGV+FGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA+
Sbjct  120  NGVQFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAT  162



>ref|XP_008810536.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Phoenix 
dactylifera]
Length=265

 Score =   294 bits (752),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 150/161 (93%), Gaps = 1/161 (1%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  249
            A+  +Q+SAFAGQ+ALK Q +L+RKVG     R +MRRTVKSAPQS+WYGPDRPKYLGPF
Sbjct  3    AASALQRSAFAGQTALKQQNELVRKVGVF-QGRISMRRTVKSAPQSMWYGPDRPKYLGPF  61

Query  250  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKN  429
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEILS+N
Sbjct  62   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSRN  121

Query  430  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  122  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>gb|ABD92879.1| chloroplast chlorophyll a/b binding protein [Pachysandra terminalis]
Length=264

 Score =   293 bits (751),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 149/162 (92%), Gaps = 1/162 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  +QQSA AG++ALK Q +L++KVG  G  R +M RTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSALQQSALAGRTALKQQNELVKKVGVFG-GRISMHRTVKSTPQSIWYGPDRPKYLGP  59

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEILSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  119

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  161



>ref|XP_002875398.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51657.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
Length=266

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 148/163 (91%), Gaps = 1/163 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  IQ S+F GQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQYSSFTGQTALKPSNDLLRKVGASNGGGRVIMRRTVKSTPQSIWYGPDRPKYLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAG+QIFSEGGLDYLG+PNLIHAQSILAIWA
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGSPNLIHAQSILAIWA  163



>gb|AEZ49172.1| chlorophyll a/b binding protein of LHCII type I [Wolffia australiana]
Length=264

 Score =   290 bits (743),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQ+SA AGQ  L+ + +L+RKVG S   R +MRRTVK+APQSIWYGPDRPK+LGP
Sbjct  1    MAASAIQKSALAGQRGLRQRDELVRKVGVS-DGRVSMRRTVKAAPQSIWYGPDRPKFLGP  59

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH+RWAMLGALGC+FPE+LSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGCIFPELLSK  119

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA+
Sbjct  120  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAT  162



>ref|XP_010908796.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Elaeis 
guineensis]
Length=265

 Score =   290 bits (742),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 150/163 (92%), Gaps = 2/163 (1%)
 Frame = +1

Query  67   MASC-GIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MAS    Q+SAFAGQ+ALK Q +L++KVG     R +MRRTVKSAPQS+WYGPDRPKYLG
Sbjct  1    MASASAFQRSAFAGQTALKRQNELVQKVGVF-EGRISMRRTVKSAPQSMWYGPDRPKYLG  59

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPEIL+
Sbjct  60   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILA  119

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  120  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  162



>ref|XP_006836754.1| hypothetical protein AMTR_s00088p00153020 [Amborella trichopoda]
 gb|ERM99607.1| hypothetical protein AMTR_s00088p00153020 [Amborella trichopoda]
Length=264

 Score =   289 bits (739),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 149/162 (92%), Gaps = 1/162 (1%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  246
            MA+  IQ S+FAGQ+ LK Q++L +KVG+ G  R  MRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MAASAIQSSSFAGQTVLKPQSELAKKVGAYG-GRIFMRRTVKSVPQSIWYGPDRPKYLGP  59

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L++
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR  119

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  120  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWA  161



>gb|ABK21429.1| unknown [Picea sitchensis]
 gb|ABK22448.1| unknown [Picea sitchensis]
 gb|ABK23914.1| unknown [Picea sitchensis]
 gb|ABK24064.1| unknown [Picea sitchensis]
 gb|ABK26103.1| unknown [Picea sitchensis]
 gb|ABK26818.1| unknown [Picea sitchensis]
 gb|ABR17641.1| unknown [Picea sitchensis]
 gb|ACN39896.1| unknown [Picea sitchensis]
 gb|ACN39974.1| unknown [Picea sitchensis]
 gb|ACN40033.1| unknown [Picea sitchensis]
 gb|ACN40585.1| unknown [Picea sitchensis]
 gb|ACN40649.1| unknown [Picea sitchensis]
Length=266

 Score =   286 bits (731),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 150/162 (93%), Gaps = 2/162 (1%)
 Frame = +1

Query  73   SCGIQQSAFAGQSALKS-QTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  249
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  250  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKN  429
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  430  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  164



>gb|ABR17665.1| unknown [Picea sitchensis]
Length=266

 Score =   286 bits (731),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 150/162 (93%), Gaps = 2/162 (1%)
 Frame = +1

Query  73   SCGIQQSAFAGQSALKS-QTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  249
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  250  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKN  429
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  430  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  164



>gb|ABK21859.1| unknown [Picea sitchensis]
 gb|ABK21874.1| unknown [Picea sitchensis]
 gb|ABK24058.1| unknown [Picea sitchensis]
 gb|ABK24837.1| unknown [Picea sitchensis]
 gb|ABK26095.1| unknown [Picea sitchensis]
 gb|ACN39796.1| unknown [Picea sitchensis]
 gb|ACN40179.1| unknown [Picea sitchensis]
Length=266

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 148/159 (93%), Gaps = 2/159 (1%)
 Frame = +1

Query  82   IQQSAFAGQSALKS-QTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQ  258
            IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPFSEQ
Sbjct  7    IQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPFSEQ  65

Query  259  TPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVK  438
            TPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L+K GVK
Sbjct  66   TPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKTGVK  125

Query  439  FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  126  FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  164



>gb|ABK21323.1| unknown [Picea sitchensis]
Length=266

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/162 (83%), Positives = 149/162 (92%), Gaps = 2/162 (1%)
 Frame = +1

Query  73   SCGIQQSAFAGQSALKS-QTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  249
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+ AP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRIAPESIWYGPDRPKYLGPF  62

Query  250  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKN  429
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  430  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  164



>gb|ABQ02464.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=263

 Score =   284 bits (726),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 149/164 (91%), Gaps = 4/164 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  +QQ+ +F G +  + +  L+R+VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALQQTTSFLGTAPRRDE--LVRRVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWAS
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAS  161



>gb|AAC15992.1| chlorophyll a/b binding protein [Oryza sativa Japonica Group]
Length=263

 Score =   283 bits (723),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 148/163 (91%), Gaps = 4/163 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F G +  + +  L+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  160



>ref|NP_001050586.1| Os03g0592500 [Oryza sativa Japonica Group]
 sp|Q10HD0.1|CB23_ORYSJ RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Oryza sativa Japonica Group]
 sp|A2XJ35.1|CB23_ORYSI RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Oryza sativa Indica Group]
 gb|AAT81763.1| chlorophyll a/b binding protein [Oryza sativa Japonica Group]
 gb|ABF97413.1| Chlorophyll a-b binding protein, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF12500.1| Os03g0592500 [Oryza sativa Japonica Group]
 gb|EAY90845.1| hypothetical protein OsI_12453 [Oryza sativa Indica Group]
 gb|EAZ27662.1| hypothetical protein OsJ_11611 [Oryza sativa Japonica Group]
 gb|AFI71846.1| chlorophyll a/b binbing protein [Oryza sativa]
Length=263

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 148/163 (91%), Gaps = 4/163 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F G +  + +  L+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  160



>gb|ABK22382.1| unknown [Picea sitchensis]
 gb|ABK23122.1| unknown [Picea sitchensis]
 gb|ABK26462.1| unknown [Picea sitchensis]
 gb|ABR16136.1| unknown [Picea sitchensis]
 gb|ACN40237.1| unknown [Picea sitchensis]
Length=266

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 148/161 (92%), Gaps = 2/161 (1%)
 Frame = +1

Query  73   SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  249
            +  IQ S+ AGQ+ L+  Q +L+ KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQISSLAGQTLLRPQQNELVSKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  250  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKN  429
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  430  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  163



>ref|XP_006664981.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Oryza brachyantha]
Length=263

 Score =   282 bits (722),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 147/163 (90%), Gaps = 4/163 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+  F G +  + +  L+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTGFLGTAPRRDE--LVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  160



>dbj|BAA00537.1| type II light-harvesting chlorophyll a/b-binding protein [Oryza 
sativa Japonica Group]
Length=263

 Score =   281 bits (720),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 148/163 (91%), Gaps = 4/163 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F G +  +   D++R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DVVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LE+IHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELELIHSRWAMLGALGCVFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  160



>prf||1707316B chlorophyll a/b binding protein 2
Length=263

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 148/163 (91%), Gaps = 4/163 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F G +  +   DL+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LE+IHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELELIHSRWAMLGALGCVFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  160



>gb|AFV34723.1| light harvesting chlorophyll a/b-binding protein 2-1 [Dendrocalamus 
latiflorus]
Length=263

 Score =   281 bits (720),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 148/164 (90%), Gaps = 4/164 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F G +  + +  L+R+VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRRVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWAS
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAS  161



>gb|ACO06085.1| chlorophyll a-b binding protein [Triticum aestivum]
Length=196

 Score =   278 bits (712),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 146/163 (90%), Gaps = 4/163 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F G +  +   DL+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRSVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNG+KFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  118  KNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  160



>emb|CAA43907.1| chlorophyll a/b-binding protein [Pinus thunbergii]
Length=266

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 147/158 (93%), Gaps = 2/158 (1%)
 Frame = +1

Query  82   IQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQ  258
            IQ S+ AGQ+ L+  Q +L++KVG++  AR TMRRTV+SAP+SIWYGPDRPKYLGPFSE 
Sbjct  7    IQSSSLAGQTLLRPQQNELVKKVGTA-QARITMRRTVRSAPESIWYGPDRPKYLGPFSEG  65

Query  259  TPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVK  438
            TPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGC+FPE+L+KNGVK
Sbjct  66   TPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCLFPELLAKNGVK  125

Query  439  FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  126  FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  163



>gb|ACE88963.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=181

 Score =   277 bits (708),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 143/157 (91%), Gaps = 3/157 (2%)
 Frame = +1

Query  85   QQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTP  264
            Q ++F G +  + +  L+R+VG  G  R TMRRTVKSAPQSIWYGPDRPKYLGPFSEQTP
Sbjct  1    QTTSFLGTAPRRDE--LVRRVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTP  57

Query  265  SYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFG  444
            SYLTGEF GDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEILSKNGVKFG
Sbjct  58   SYLTGEFAGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFG  117

Query  445  EAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            EAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWAS
Sbjct  118  EAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAS  154



>gb|EMS46868.1| Chlorophyll a-b binding protein, chloroplastic [Triticum urartu]
Length=263

 Score =   279 bits (714),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 146/163 (90%), Gaps = 4/163 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F G +  +   DL+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRSVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNG+KFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  118  KNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  160



>gb|ABK21446.1| unknown [Picea sitchensis]
Length=266

 Score =   279 bits (714),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 147/161 (91%), Gaps = 2/161 (1%)
 Frame = +1

Query  73   SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  249
            +  IQ S+ AGQ+ L+  Q +L+ KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQISSLAGQTLLRPQQNELVSKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  250  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKN  429
            SEQTPSYLTGEFPGDY WDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYRWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  430  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  163



>gb|ABQ02463.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=263

 Score =   279 bits (713),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 147/164 (90%), Gaps = 4/164 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F G  A   + +L+R+VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLG--AAPRRDELVRRVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEF GDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFAGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWAS
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAS  161



>gb|AEW70716.1| light harvesting chlorophyll a-b binding protein 2-1 [Phyllostachys 
edulis]
Length=263

 Score =   278 bits (712),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 147/164 (90%), Gaps = 4/164 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F G  A   + +L+R+VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLG--AAPRRDELVRRVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEF GDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFAGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWAS
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAS  161



>gb|ACO06088.1| chlorophyll a-b binding protein [Triticum aestivum]
Length=263

 Score =   278 bits (712),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 146/163 (90%), Gaps = 4/163 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F G +  +   DL+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRSVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNG+KFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  118  KNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  160



>ref|XP_003562323.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Brachypodium 
distachyon]
Length=263

 Score =   278 bits (711),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 146/163 (90%), Gaps = 4/163 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F G +  +   DL+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRSVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  118  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWA  160



>gb|ABO10493.1| light-harvesting chlorophyll a/b binding protein [Bambusa oldhamii]
Length=263

 Score =   277 bits (709),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 146/164 (89%), Gaps = 4/164 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F G +  + +  L+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRHVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+L VIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELGVIHSRWAMLGALGCVFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWAS
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAS  161



>gb|AAV74408.1| chloroplast chlorophyll A/B binding protein [Manihot esculenta]
Length=243

 Score =   276 bits (707),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  133  LLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTA  312
            L+RK GS G  RF+MRRTVKSAP SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTA
Sbjct  1    LVRKXGSFGGGRFSMRRTVKSAPPSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTA  60

Query  313  GLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGG  492
            GLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+LSKNGVKFGEAVWFKAGAQIFSEGG
Sbjct  61   GLSADPETFAKNRELEVIHCRWAMLGALGCVFPEVLSKNGVKFGEAVWFKAGAQIFSEGG  120

Query  493  LDYLGNPNLIHAQSILAIWA  552
            LDYLGNPNLIHAQSILAIWA
Sbjct  121  LDYLGNPNLIHAQSILAIWA  140



>gb|AAB19040.1| type 2 light-harvesting chlorophyll a/b-binding polypeptide, 
partial [Pinus palustris]
Length=246

 Score =   276 bits (707),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 139/143 (97%), Gaps = 1/143 (1%)
 Frame = +1

Query  124  QTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGW  303
            Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGW
Sbjct  2    QNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGW  60

Query  304  DTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFS  483
            DTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+L+KNGVKFGEAVWFKAGAQIFS
Sbjct  61   DTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGAQIFS  120

Query  484  EGGLDYLGNPNLIHAQSILAIWA  552
            EGGLDYLGNPNLIHAQSILAIWA
Sbjct  121  EGGLDYLGNPNLIHAQSILAIWA  143



>gb|ABR25974.1| chloroplast chlorophyll a-b binding protein precursor [Oryza 
sativa Indica Group]
Length=253

 Score =   276 bits (707),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 137/143 (96%), Gaps = 1/143 (1%)
 Frame = +1

Query  124  QTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGW  303
            + +L+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDY W
Sbjct  9    RDELVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYRW  67

Query  304  DTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFS  483
            DTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFS
Sbjct  68   DTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFS  127

Query  484  EGGLDYLGNPNLIHAQSILAIWA  552
            EGGLDYLGNPNL+HAQSILAIWA
Sbjct  128  EGGLDYLGNPNLVHAQSILAIWA  150



>gb|ABK22497.1| unknown [Picea sitchensis]
 gb|ABK24164.1| unknown [Picea sitchensis]
 gb|ABK26145.1| unknown [Picea sitchensis]
 gb|ABR17447.1| unknown [Picea sitchensis]
 gb|ABR17727.1| unknown [Picea sitchensis]
 gb|ACN39972.1| unknown [Picea sitchensis]
 gb|ACN40388.1| unknown [Picea sitchensis]
Length=266

 Score =   276 bits (706),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 142/152 (93%), Gaps = 2/152 (1%)
 Frame = +1

Query  103  GQSALKSQ-TDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTG  279
            GQ+ L+ Q  +L+RKVG S  AR TMRRTV+SAP+SIWYGPDRPKYLGPFSEQTPSYLTG
Sbjct  14   GQTLLRPQHNELVRKVGMS-QARITMRRTVRSAPESIWYGPDRPKYLGPFSEQTPSYLTG  72

Query  280  EFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWF  459
            EFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L+K GVKFGEAVWF
Sbjct  73   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKTGVKFGEAVWF  132

Query  460  KAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  133  KAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  164



>ref|NP_001148271.1| chlorophyll a-b binding protein [Zea mays]
 ref|XP_008665042.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Zea 
mays]
 gb|ACG30372.1| chlorophyll a-b binding protein [Zea mays]
 gb|ACR34075.1| unknown [Zea mays]
 tpg|DAA50197.1| TPA: type II light-harvesting chlorophyll a /b-binding protein 
isoform 1 [Zea mays]
 tpg|DAA50198.1| TPA: type II light-harvesting chlorophyll a /b-binding protein 
isoform 2 [Zea mays]
 tpg|DAA50201.1| TPA: light harvesting chlorophyll binding protein9 isoform 1 
[Zea mays]
 tpg|DAA50202.1| TPA: light harvesting chlorophyll binding protein9 isoform 2 
[Zea mays]
Length=260

 Score =   275 bits (704),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 141/163 (87%), Gaps = 7/163 (4%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F GQ+ +       R  G     R TMRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGQALVS------RAAGVDAGGRITMRRTVKSVPQSIWYGPDRPKYLG  54

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEIL+
Sbjct  55   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILA  114

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  115  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  157



>gb|ACG30954.1| chlorophyll a-b binding protein [Zea mays]
Length=260

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 141/163 (87%), Gaps = 7/163 (4%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F GQ+ +       R  G     R TMRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGQALVA------RAAGVDAGDRITMRRTVKSVPQSIWYGPDRPKYLG  54

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEIL+
Sbjct  55   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILA  114

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  115  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  157



>sp|P10049.1|CB21_PINTH RecName: Full=Chlorophyll a-b binding protein type I, chloroplastic; 
Short=CAB; Short=LHCP; Flags: Precursor [Pinus thunbergii]
 emb|CAA31773.1| chlorophylla/b-binding preprotein (AA -37 to 229) [Pinus thunbergii]
Length=266

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 145/158 (92%), Gaps = 2/158 (1%)
 Frame = +1

Query  82   IQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQ  258
            IQ S+ AGQ+ L+  Q +L++KVG++  AR TMRRTV+SAP+SIWYGPDRPKYLGPFSE 
Sbjct  7    IQSSSLAGQTLLRPQQNELVKKVGTA-QARITMRRTVRSAPESIWYGPDRPKYLGPFSEG  65

Query  259  TPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVK  438
            TPSYLTGEFPGDYGWDTA +SADPETFA+NR+LEVIH RWAMLGALGCVFPE+L+KNG+K
Sbjct  66   TPSYLTGEFPGDYGWDTAAVSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGLK  125

Query  439  FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            FGEAVWFKAGAQIFSEGGLDY GNPNLIHAQSILAIWA
Sbjct  126  FGEAVWFKAGAQIFSEGGLDYAGNPNLIHAQSILAIWA  163



>ref|XP_002986911.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ11993.1| light-harvesting complex [Selaginella moellendorffii]
Length=267

 Score =   274 bits (700),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +1

Query  103  GQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGE  282
            GQ+ALKS  +L RKVG+ G AR  MRRT  S P SIWYGPDRPK+LGPFSEQTPSYLTGE
Sbjct  15   GQTALKSPNELSRKVGNLGEARTVMRRTRASTPDSIWYGPDRPKFLGPFSEQTPSYLTGE  74

Query  283  FPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFK  462
            FPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCV PE+L+KNG+KFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVTPELLAKNGIKFGEAVWFK  134

Query  463  AGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            AG+QIF EGGLDYLGNPNL+HAQSILAIWAS
Sbjct  135  AGSQIFKEGGLDYLGNPNLVHAQSILAIWAS  165



>ref|XP_004982492.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Setaria italica]
Length=261

 Score =   273 bits (699),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 143/163 (88%), Gaps = 6/163 (4%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F GQ AL S+        +    R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGQ-ALVSRP----AAAADAGGRITMRRTVKSAPQSIWYGPDRPKYLG  55

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEIL+
Sbjct  56   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILA  115

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  116  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  158



>ref|XP_002466863.1| hypothetical protein SORBIDRAFT_01g015400 [Sorghum bicolor]
 gb|EER93861.1| hypothetical protein SORBIDRAFT_01g015400 [Sorghum bicolor]
Length=262

 Score =   273 bits (698),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 141/163 (87%), Gaps = 5/163 (3%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F GQ+ +          G     R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGQALVSRPAAAAADAG----GRITMRRTVKSAPQSIWYGPDRPKYLG  56

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFPEIL+
Sbjct  57   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILA  116

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  117  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  159



>gb|ABK23816.1| unknown [Picea sitchensis]
Length=166

 Score =   265 bits (677),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 138/149 (93%), Gaps = 2/149 (1%)
 Frame = +1

Query  82   IQQSAFAGQSALKS-QTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQ  258
            IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPFSEQ
Sbjct  7    IQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPFSEQ  65

Query  259  TPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVK  438
            TPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L+K GVK
Sbjct  66   TPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKTGVK  125

Query  439  FGEAVWFKAGAQIFSEGGLDYLGNPNLIH  525
            FGEAVWFKAGAQIFSEGGLDYLGNPNLIH
Sbjct  126  FGEAVWFKAGAQIFSEGGLDYLGNPNLIH  154



>emb|CAA89823.1| light-harvesting chlorophyll a/b binding protein of photosystem 
II [Pseudotsuga menziesii]
Length=234

 Score =   267 bits (682),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 123/130 (95%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  163  ARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA  342
            AR TMRRTV+SAP+SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA
Sbjct  2    ARITMRRTVRSAPESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA  61

Query  343  RNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLI  522
            +NR+LEVIHSRWAMLGALGCVFPE+L+KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLI
Sbjct  62   KNRELEVIHSRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLI  121

Query  523  HAQSILAIWA  552
            HAQSILAIWA
Sbjct  122  HAQSILAIWA  131



>gb|AAB82142.1| chlorophyll a-b binding protein [Oryza sativa Indica Group]
Length=263

 Score =   268 bits (685),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 144/163 (88%), Gaps = 4/163 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F G +  + +  L+R+VG+SG  R TMRRTVKSAPQ+IWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRRVGNSG-GRITMRRTVKSAPQNIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTG+FPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGC FPEILS
Sbjct  58   PFSEQTPSYLTGKFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCFFPEILS  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KNGV FGEAVWFKAGAQIFSEGGLDYLGNP L+  QSILAIWA
Sbjct  118  KNGVNFGEAVWFKAGAQIFSEGGLDYLGNPALVRPQSILAIWA  160



>gb|KDO58422.1| hypothetical protein CISIN_1g024579mg [Citrus sinensis]
Length=229

 Score =   265 bits (678),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/126 (98%), Positives = 126/126 (100%), Gaps = 0/126 (0%)
 Frame = +1

Query  175  MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQ  354
            MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+
Sbjct  1    MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRE  60

Query  355  LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS  534
            LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS
Sbjct  61   LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS  120

Query  535  ILAIWA  552
            ILAIWA
Sbjct  121  ILAIWA  126



>gb|EMT32028.1| Chlorophyll a-b binding protein, chloroplastic [Aegilops tauschii]
Length=229

 Score =   265 bits (678),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/126 (97%), Positives = 126/126 (100%), Gaps = 0/126 (0%)
 Frame = +1

Query  175  MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQ  354
            MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+
Sbjct  1    MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRE  60

Query  355  LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS  534
            LEVIHSRWAMLGALGCVFPEILSKNG+KFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQS
Sbjct  61   LEVIHSRWAMLGALGCVFPEILSKNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQS  120

Query  535  ILAIWA  552
            ILAIWA
Sbjct  121  ILAIWA  126



>sp|P14279.1|CB25_SOLLC RecName: Full=Chlorophyll a-b binding protein 5, chloroplastic; 
AltName: Full=LHCII type I CAB-5; Short=LHCP; Flags: Precursor, 
partial [Solanum lycopersicum]
 gb|AAA34142.1| chlorophyll a/b-binding protein precursor, partial [Solanum lycopersicum]
Length=237

 Score =   265 bits (676),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +1

Query  163  ARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA  342
             R TMRRTVKSAPQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA
Sbjct  5    GRVTMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA  64

Query  343  RNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLI  522
            RNR+LEVIH RWAMLGALGCVFPEILSKNGV FGEAVWFKAG+QIFSEGGLDYLGNPNLI
Sbjct  65   RNRELEVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLI  124

Query  523  HAQSILAIWAS  555
            HAQSILAIWAS
Sbjct  125  HAQSILAIWAS  135



>ref|XP_001757271.1| predicted protein [Physcomitrella patens]
 gb|EDQ77756.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   265 bits (678),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 141/162 (87%), Gaps = 1/162 (1%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  249
            A+  +  +  AGQS LK   +L RKVGSS  AR TMRRTVKS   SIWYG DRPKYLGPF
Sbjct  3    AATAMHSTTLAGQSLLKPVNELSRKVGSS-EARVTMRRTVKSTSDSIWYGADRPKYLGPF  61

Query  250  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKN  429
            S +TPSYLTGEF GDYGWDTAGLS+DPETFARNR+LEVIH+RWAMLGALGC+ PE+L+K+
Sbjct  62   SGETPSYLTGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAKS  121

Query  430  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWAS
Sbjct  122  GVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAS  163



>gb|ACO06086.1| chlorophyll a-b binding protein [Triticum aestivum]
Length=215

 Score =   262 bits (669),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 139/161 (86%), Gaps = 4/161 (2%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  + Q+ +F G +  +   DL+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRSVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPEIL 
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILC  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAI  546
            KNG+KFGEAVWFKAG QIF EGGLDYLG+PNL+HAQS L I
Sbjct  118  KNGLKFGEAVWFKAGPQIFFEGGLDYLGHPNLVHAQSFLPI  158



>emb|CAA48641.1| type II light-harvesting chlorophyll a /b-binding protein [Zea 
mays]
Length=229

 Score =   262 bits (670),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 125/126 (99%), Gaps = 0/126 (0%)
 Frame = +1

Query  175  MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQ  354
            MRRTVKS PQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGW+TAG+SADPETFARNR+
Sbjct  1    MRRTVKSVPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWETAGVSADPETFARNRE  60

Query  355  LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS  534
            LEVIHSRWAMLGALGCVFPEIL+KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQS
Sbjct  61   LEVIHSRWAMLGALGCVFPEILAKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQS  120

Query  535  ILAIWA  552
            ILAIWA
Sbjct  121  ILAIWA  126



>ref|XP_001755762.1| predicted protein [Physcomitrella patens]
 gb|EDQ79435.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   258 bits (659),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  249
            A+  +  +A AGQS LK   +L RKVG+   AR +MR+T   +  SIWYG DRPKYLGPF
Sbjct  3    AATAMHSTALAGQSLLKPVNELSRKVGNV-EARISMRKTASKSSDSIWYGADRPKYLGPF  61

Query  250  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKN  429
            S +TPSYL GEF GDYGWDTAGLS+DPETFARNR+LEVIH+RWAMLGALGCV PE+L+KN
Sbjct  62   SGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLAKN  121

Query  430  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWAS
Sbjct  122  GVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAS  163



>gb|AAA60965.1| light-harvesting chlorophyll a/b binding protein of photosystem 
II [Ginkgo biloba]
Length=270

 Score =   258 bits (659),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 141/168 (84%), Gaps = 6/168 (4%)
 Frame = +1

Query  61   SSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRT----VKSAPQSIWYGPDR  228
            ++MAS G+  SAFAGQ  LK Q + +   G  G  R TMR+T    V ++  S WYGPDR
Sbjct  2    ATMASAGVASSAFAGQIVLKPQNEFVG--GVHGEGRITMRKTASKKVVASSGSPWYGPDR  59

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
             KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVF
Sbjct  60   VKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVF  119

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            PE+LS+NGVKFGEAVWFKAG+QIFS+GGLDYLGNP+LIHAQSILAIWA
Sbjct  120  PELLSRNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLIHAQSILAIWA  167



>gb|ACI90635.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus yunnanensis]
Length=254

 Score =   256 bits (654),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 142/173 (82%), Gaps = 9/173 (5%)
 Frame = +1

Query  61   SSMASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIW  213
            ++MASCGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S W
Sbjct  1    ATMASCGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSASASTSPW  60

Query  214  YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGA  393
            YGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGA
Sbjct  61   YGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA  120

Query  394  LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            LGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  121  LGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  173



>ref|XP_001762089.1| predicted protein [Physcomitrella patens]
 gb|EDQ73193.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 141/164 (86%), Gaps = 4/164 (2%)
 Frame = +1

Query  67   MASC-GIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+C     +A AGQ+ALKS  +L RKVG+   AR TMR+   S+  SIWYG DRPKYLG
Sbjct  1    MAACTATHSTALAGQTALKSINELSRKVGNV-QARVTMRKA--SSSDSIWYGADRPKYLG  57

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            P S +TPSYLTGEF GDYGWDTAGLS+DPETFARNR+LEVIH+RWAMLGALGCV PE+L+
Sbjct  58   PLSGETPSYLTGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLA  117

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWAS
Sbjct  118  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWAS  161



>gb|ACI90632.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus tabuliformis var. henryi]
 gb|ACI90633.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus hwangshanensis]
 gb|ACI90634.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus tabuliformis]
Length=254

 Score =   254 bits (650),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 141/173 (82%), Gaps = 9/173 (5%)
 Frame = +1

Query  61   SSMASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIW  213
            ++MASCGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S W
Sbjct  1    ATMASCGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSASASTSPW  60

Query  214  YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGA  393
            YGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGA
Sbjct  61   YGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGA  120

Query  394  LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            LGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  121  LGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  173



>emb|CAC38830.1| chlorophyll a/b binding protein [Pinus contorta]
Length=274

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 140/171 (82%), Gaps = 9/171 (5%)
 Frame = +1

Query  67   MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  219
            MASCGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKAATKKVSVSASTSPWYG  60

Query  220  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALG  399
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  400  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  171



>gb|ACI90631.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus bungeana]
Length=254

 Score =   253 bits (645),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 142/173 (82%), Gaps = 9/173 (5%)
 Frame = +1

Query  61   SSMASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIW  213
            ++MA+CGI   AFAG   S+LK  T+ L  VG+   G +R TMR++       SA  S W
Sbjct  1    ATMATCGIGSCAFAGGQLSSLKPHTNQLLGVGAGVHGESRVTMRKSATKKSFASASPSPW  60

Query  214  YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGA  393
            YGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGA
Sbjct  61   YGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGA  120

Query  394  LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            LGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA
Sbjct  121  LGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA  173



>emb|CAA47950.1| chlorophyll a/b binding protein [Pinus contorta]
Length=274

 Score =   253 bits (646),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 139/171 (81%), Gaps = 9/171 (5%)
 Frame = +1

Query  67   MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  219
            MASCGI    FAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGIGSCGFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSVSASTSPWYG  60

Query  220  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALG  399
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  400  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  171



>gb|ACY66805.1| chlorophyll a/b-binding protein [Pinus massoniana]
Length=274

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 139/171 (81%), Gaps = 9/171 (5%)
 Frame = +1

Query  67   MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  219
            MASCGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSASASTSPWYG  60

Query  220  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALG  399
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALG  120

Query  400  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  171



>emb|CAA57408.1| light harvesting chlorophyll a /b-binding protein Lhcb1*2-1 [Picea 
abies]
Length=274

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 140/171 (82%), Gaps = 9/171 (5%)
 Frame = +1

Query  67   MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  219
            MASCGI   AFAG   S+LK   + L  VG+   G AR TMR++       SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHNNQLLGVGAGVHGEARVTMRKSSTKKVSASASPSPWYG  60

Query  220  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALG  399
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  400  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA  171



>gb|ABK20976.1| unknown [Picea sitchensis]
 gb|ABK21395.1| unknown [Picea sitchensis]
 gb|ABK25775.1| unknown [Picea sitchensis]
 gb|ABR17147.1| unknown [Picea sitchensis]
 gb|ABR17370.1| unknown [Picea sitchensis]
 gb|ACN39891.1| unknown [Picea sitchensis]
 gb|ACN40202.1| unknown [Picea sitchensis]
 gb|ACN40506.1| unknown [Picea sitchensis]
 gb|ACN40508.1| unknown [Picea sitchensis]
Length=274

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 140/171 (82%), Gaps = 9/171 (5%)
 Frame = +1

Query  67   MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  219
            MASCGI   AFAG   S+LK   + L  VG+   G AR TMR++       SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHNNQLVGVGAGVHGEARVTMRKSSTKKVSASASTSPWYG  60

Query  220  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALG  399
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  400  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  171



>emb|CAA57409.1| light harvesting chlorophyll a /b-binding protein Lhcb1*2-2 [Picea 
abies]
Length=275

 Score =   252 bits (644),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 141/172 (82%), Gaps = 10/172 (6%)
 Frame = +1

Query  67   MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRR--TVK----SAPQSIWY  216
            MASCGI   AFAG   S+LK   + L  VG+   G AR TMR+  T K    SA  S WY
Sbjct  1    MASCGIGSCAFAGGQISSLKPHNNQLLGVGAGVHGEARVTMRKSSTTKKVSASASPSPWY  60

Query  217  GPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGAL  396
            GPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGAL
Sbjct  61   GPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGAL  120

Query  397  GCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            GCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA
Sbjct  121  GCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA  172



>ref|XP_001774812.1| predicted protein [Physcomitrella patens]
 dbj|BAD08519.1| light-harvesting chlorophyll a/b-binding protein 2 [Physcomitrella 
patens]
 gb|EDQ60353.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   251 bits (641),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 136/154 (88%), Gaps = 3/154 (2%)
 Frame = +1

Query  97   FAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLGPFSEQTPSY  270
             AGQS LK   +L RKVGSS  AR TMRRTV KSA   SIWYG DRPKYLGPFS +TPSY
Sbjct  12   LAGQSLLKPVNELSRKVGSS-QARVTMRRTVNKSAGSDSIWYGADRPKYLGPFSGETPSY  70

Query  271  LTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEA  450
            L GEF GDYGWDTAGLS+DPETFARNR+LEVIH+RWAMLGALGCV PE+L+K+GVKFGEA
Sbjct  71   LNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLAKSGVKFGEA  130

Query  451  VWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            VWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  131  VWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  164



>sp|P15194.1|CB2B_PINSY RecName: Full=Chlorophyll a-b binding protein type 2 member 1B, 
chloroplastic; AltName: Full=Chlorophyll a-b binding protein 
type II 1B; Short=CAB; AltName: Full=LHCP; Flags: Precursor 
[Pinus sylvestris]
 emb|CAA32658.1| unnamed protein product [Pinus sylvestris]
Length=274

 Score =   251 bits (641),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 138/171 (81%), Gaps = 9/171 (5%)
 Frame = +1

Query  67   MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  219
            MASCGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKLTASASTSPWYG  60

Query  220  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALG  399
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPE FA+NR+LEVIH RWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALG  120

Query  400  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  171



>gb|ABK22798.1| unknown [Picea sitchensis]
Length=253

 Score =   250 bits (639),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 137/162 (85%), Gaps = 15/162 (9%)
 Frame = +1

Query  73   SCGIQQSAFAGQSALKS-QTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  249
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  250  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKN  429
            SEQTPSYLTGEFPGDYGWDTAGLSADPETF             AMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETF-------------AMLGALGCVFPELLAKT  109

Query  430  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS
Sbjct  110  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  151



>ref|XP_001751426.1| predicted protein [Physcomitrella patens]
 ref|XP_001785364.1| predicted protein [Physcomitrella patens]
 ref|XP_001785367.1| predicted protein [Physcomitrella patens]
 gb|EDQ49825.1| predicted protein [Physcomitrella patens]
 gb|EDQ49828.1| predicted protein [Physcomitrella patens]
 gb|EDQ83743.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   250 bits (639),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 139/162 (86%), Gaps = 3/162 (2%)
 Frame = +1

Query  73   SCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLGP  246
            +  +  +A AGQ  LK   +L RKVG+   AR TMRRTV KSA   SIWYG DRPK+LGP
Sbjct  4    ATAMHSTALAGQGVLKPVNELSRKVGNV-EARVTMRRTVSKSAGSDSIWYGADRPKFLGP  62

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FS +TPSYLTGEF GDYGWDTAGLS+DPETFARNR+LEVIH+RWAMLGALGC+ PE+L+K
Sbjct  63   FSGETPSYLTGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAK  122

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            +GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  123  SGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  164



>gb|AAC78690.1| chlorophyll a/b-binding protein [Pinus thunbergii]
Length=274

 Score =   251 bits (640),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 139/171 (81%), Gaps = 9/171 (5%)
 Frame = +1

Query  67   MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  219
            MASCG  + AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGSGRCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSASASTSPWYG  60

Query  220  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALG  399
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALG  120

Query  400  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  171



>gb|ACN40194.1| unknown [Picea sitchensis]
Length=274

 Score =   251 bits (640),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 140/171 (82%), Gaps = 9/171 (5%)
 Frame = +1

Query  67   MASCGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYG  219
            MASCGI   AFAG   S+LK   + L  VG+   G AR TMR++       SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHNNQLVGVGAGVHGEARVTMRKSSTKKVSASASTSPWYG  60

Query  220  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALG  399
            PDR  YLGPFS + PS+LTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSHLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  400  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  171



>sp|P24006.1|CB2A_PYRPY RecName: Full=Chlorophyll a-b binding protein 1A, chloroplastic; 
AltName: Full=LHCII type II CAB-1A; Short=LHCP; Flags: Precursor 
[Pyrus pyrifolia]
 dbj|BAA00449.1| light harvesting a/b binding protein [Pyrus pyrifolia var. culta]
Length=278

 Score =   251 bits (640),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 145/174 (83%), Gaps = 9/174 (5%)
 Frame = +1

Query  58   SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  210
            +++MASCGI  + AFAG   S++K Q + L  VG + G AR TMR+     +V ++  S 
Sbjct  2    ATTMASCGIGSRCAFAGAQLSSVKPQNNQLLGVGGAHGEARLTMRKATGRKSVAASIDSP  61

Query  211  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLG  390
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLG
Sbjct  62   WYGPDRVMYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  121

Query  391  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+P LIHAQSILAIWA
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWA  175



>ref|XP_001761868.1| predicted protein [Physcomitrella patens]
 ref|XP_001761952.1| predicted protein [Physcomitrella patens]
 sp|P20866.2|CB2_PHYPA RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ73309.1| predicted protein [Physcomitrella patens]
 gb|EDQ73393.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   250 bits (638),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 140/163 (86%), Gaps = 3/163 (2%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLG  243
            A+  +  +A AGQS +K   +L RKVG+   AR TMRRTV KSA   SIWYG DRPK+LG
Sbjct  3    AATAMHSTALAGQSLVKPVNELSRKVGNV-EARVTMRRTVSKSAGSDSIWYGADRPKFLG  61

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFS +TPSYL GEF GDYGWDTAGLS+DPETFARNR+LEVIH+RWAMLGALGC+ PE+L+
Sbjct  62   PFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLA  121

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  122  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  164



>ref|XP_001779318.1| predicted protein [Physcomitrella patens]
 gb|EDQ55825.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   250 bits (638),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 3/161 (2%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  249
            A+  +  +  AGQS LK   +L RKVG+S  AR +MR++  S   SIWYG DRPK+LGPF
Sbjct  3    AATAMHSTTLAGQSLLKPVNELSRKVGTS-EARVSMRKS--SGSDSIWYGADRPKFLGPF  59

Query  250  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKN  429
            S +TPSYL GEF GDYGWDTAGLS+DPETFARNR+LEVIH+RWAMLGALGCV PE+L+KN
Sbjct  60   SGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLAKN  119

Query  430  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  120  GVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  160



>sp|P15193.1|CB2A_PINSY RecName: Full=Chlorophyll a-b binding protein type 2 member 1A, 
chloroplastic; AltName: Full=Chlorophyll a-b binding protein 
type II 1A; Short=CAB; AltName: Full=LHCP; Flags: Precursor 
[Pinus sylvestris]
 emb|CAA32657.1| unnamed protein product [Pinus sylvestris]
Length=278

 Score =   250 bits (638),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 145/174 (83%), Gaps = 9/174 (5%)
 Frame = +1

Query  58   SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  210
            +++MASCGI  + AFAG   S++K Q + L  VG + G AR TMR+     +V ++  S 
Sbjct  2    ATTMASCGIGSRCAFAGAQLSSVKPQNNQLLGVGGAHGEARLTMRKATGKKSVAASIDSP  61

Query  211  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLG  390
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  121

Query  391  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+P LIHAQSILAIWA
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWA  175



>gb|AAU89261.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus monophylla]
Length=256

 Score =   249 bits (636),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 138/168 (82%), Gaps = 9/168 (5%)
 Frame = +1

Query  76   CGIQQSAFAG--QSALKSQTDLLRKVGSS--GSARFTMRRT-----VKSAPQSIWYGPDR  228
            CGI   AFAG   S+LK  T+ L  VG+   G +R TMR++     V SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQXSSLKPHTNQLLGVGAGVHGESRVTMRKSATKKSVASASPSPWYGPDR  60

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA  168



>gb|ABK22510.1| unknown [Picea sitchensis]
 gb|ABK22691.1| unknown [Picea sitchensis]
 gb|ABK26115.1| unknown [Picea sitchensis]
 gb|ABR17282.1| unknown [Picea sitchensis]
Length=278

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 144/174 (83%), Gaps = 9/174 (5%)
 Frame = +1

Query  58   SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  210
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  211  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLG  390
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  121

Query  391  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAIWA
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAIWA  175



>ref|XP_001774452.1| predicted protein [Physcomitrella patens]
 dbj|BAA77273.1| chlorophyll a/b-binding protein precursor [Physcomitrella patens]
 gb|EDQ60676.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = +1

Query  64   SMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVK--SAPQSIWYGPDRPKY  237
            + A+  +  +  AGQ+ LK  ++L RKV ++G AR TMR+TV   S   SIWYG DRPK+
Sbjct  2    ATAATAMNSTVLAGQALLKPVSELSRKV-NAGEARVTMRKTVSKSSGSDSIWYGADRPKF  60

Query  238  LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEI  417
            LGPFS +TPSYL GEF GDYGWDTAGLS+DPETFARNR+LEVIH+RWAMLGALGC+ PE+
Sbjct  61   LGPFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPEL  120

Query  418  LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            L+K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  121  LAKSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  165



>gb|AAU89262.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus remota]
Length=256

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 138/168 (82%), Gaps = 9/168 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRT-----VKSAPQSIWYGPDR  228
            CGI   AFAG   S+LK  T+ L  VG+   G +R TMR++     V SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQLSSLKPHTNQLLGVGAGVHGESRVTMRKSATKKSVASASPSPWYGPDR  60

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA  168



>gb|AAU89257.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus flexilis]
 gb|AAU89258.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus lambertiana]
 gb|AAU89259.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus monticola]
 gb|AAU89260.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus strobus]
Length=256

 Score =   249 bits (635),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 137/168 (82%), Gaps = 9/168 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYGPDR  228
            CGI   AFAG   S LK  T+ L  VG+   G +R TMR++       SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGKISLLKPHTNQLLGVGAGVHGESRVTMRKSAAKKSFASASPSPWYGPDR  60

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVF  120

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            PE+L+KNGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA
Sbjct  121  PELLAKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA  168



>ref|XP_002960494.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ38033.1| light-harvesting complex [Selaginella moellendorffii]
Length=272

 Score =   249 bits (636),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 137/158 (87%), Gaps = 4/158 (3%)
 Frame = +1

Query  91   SAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAP---QSIWYGPDRPKYLGPFSEQT  261
            S FAGQ+ LK Q + + +  S+GS R  MR+T K++     S WYGPDR KYLGPFS ++
Sbjct  14   STFAGQTGLKPQNEFVARNASNGS-RIAMRKTGKASSVGGGSPWYGPDRVKYLGPFSGES  72

Query  262  PSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKF  441
            PSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+LSKNG+KF
Sbjct  73   PSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSKNGIKF  132

Query  442  GEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            GEAVWFKAG+QIF EGGLDYLGNP+L+HAQSILAIWAS
Sbjct  133  GEAVWFKAGSQIFKEGGLDYLGNPSLVHAQSILAIWAS  170



>gb|AAY81730.1| chloroplast putative light harvesting chlorophyll a/b binding 
protein, partial [Pinus krempfii]
Length=250

 Score =   248 bits (633),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 138/168 (82%), Gaps = 8/168 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK----SAPQSIWYGPDRP  231
            CGI   AFAG   S+LK  ++ L  VG+   G +R TMR++      S   S WYGPDR 
Sbjct  1    CGIGSCAFAGGKISSLKPHSNQLLGVGAGVHGESRVTMRKSATKKFASESPSPWYGPDRV  60

Query  232  KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFP  411
             YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFP
Sbjct  61   LYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  120

Query  412  EILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            E+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWAS
Sbjct  121  ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWAS  168



>gb|AAA33636.1| major chlorophyll binding protein [Physcomitrella patens]
Length=269

 Score =   249 bits (635),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 139/163 (85%), Gaps = 2/163 (1%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLG  243
            A+  +  +A AGQS +K   +L RKV  +  AR TMRRTV KSA   +IWYG DRPK+LG
Sbjct  3    AATAMHSTALAGQSLVKPVNELSRKVLGNVEARVTMRRTVSKSAGSDTIWYGADRPKFLG  62

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFS +TPSYL GEF GDYGWDTAGLS+DPETFARNR+LEVIH+RWAMLGALGC+ PE+L+
Sbjct  63   PFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLA  122

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  123  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  165



>gb|AAU89264.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus nelsonii]
Length=256

 Score =   248 bits (633),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 138/168 (82%), Gaps = 9/168 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRT-----VKSAPQSIWYGPDR  228
            CGI   AFAG   S+LK  T+ L  VG+   G +R TMR++     V SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHTNQLVGVGAGVHGESRVTMRKSATKKSVVSASPSPWYGPDR  60

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA  168



>gb|AAU89250.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus echinata]
Length=253

 Score =   248 bits (633),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 136/169 (80%), Gaps = 9/169 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYGPDR  228
            CGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSVSASTSPWYGPDR  60

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA 
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAC  169



>gb|AIW07979.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07980.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07981.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07982.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07983.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07984.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07985.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07986.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07987.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07988.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07989.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07990.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07991.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07992.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07993.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07994.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07995.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07996.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07997.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07998.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07999.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08000.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08001.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08002.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08003.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08004.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08005.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08006.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08007.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08008.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08009.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08010.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08011.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08012.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08013.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08014.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08015.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08016.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08017.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08018.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08019.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08020.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08021.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08022.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08023.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08024.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08025.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08026.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08027.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08028.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08029.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08030.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08031.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08032.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08033.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08034.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08035.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08036.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08037.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08038.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08039.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08040.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08041.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08042.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08043.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08044.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08045.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08046.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08047.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08048.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08049.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08050.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08051.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08052.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08053.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08055.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08056.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08057.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08058.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08059.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08060.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08061.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08062.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08063.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08064.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08065.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08066.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08068.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08069.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08070.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08071.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08072.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08073.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08074.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08075.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08076.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08077.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08078.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08079.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08080.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08081.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08082.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08083.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08084.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08085.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08086.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08087.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08088.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08089.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08090.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08091.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08092.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
Length=255

 Score =   248 bits (633),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 138/168 (82%), Gaps = 8/168 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK----SAPQSIWYGPDRP  231
            CGI   AFAG   S+LK  ++ L  VG+   G +R TMR++      S   S WYGPDR 
Sbjct  1    CGIGSCAFAGGKISSLKPHSNQLLGVGAGVHGESRVTMRKSATKKFASESPSPWYGPDRV  60

Query  232  KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFP  411
             YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFP
Sbjct  61   LYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  120

Query  412  EILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            E+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWAS
Sbjct  121  ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWAS  168



>gb|AHB24928.1| chloroplast chlorophyll a-b binding protein 2/3 [Sedum alfredii]
Length=267

 Score =   248 bits (634),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 123/137 (90%), Gaps = 4/137 (3%)
 Frame = +1

Query  157  GSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSA  324
            GS R TMR+T      SA  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GSGRVTMRKTAAKPKPSASSSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  325  DPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  504
            DPETFA+NR+LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  505  GNPNLIHAQSILAIWAS  555
            GNPNL+HAQSILAIWAS
Sbjct  149  GNPNLVHAQSILAIWAS  165



>gb|AAU89251.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus ponderosa]
Length=256

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 136/169 (80%), Gaps = 9/169 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYGPDR  228
            CGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSVSASTSPWYGPDR  60

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA 
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAC  169



>gb|AAU89253.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus contorta]
Length=256

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 137/168 (82%), Gaps = 9/168 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK---SAPQSI--WYGPDR  228
            CGI   AFAG   S+LK  T+ L  VG+   G AR TMR+      S P S   WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSVPASTSPWYGPDR  60

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVF  120

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  168



>gb|AAU89254.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus merkusii]
Length=256

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 136/169 (80%), Gaps = 9/169 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYGPDR  228
            CGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSASASTSPWYGPDR  60

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA 
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAC  169



>gb|AIW08054.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08067.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
Length=255

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 138/168 (82%), Gaps = 8/168 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK----SAPQSIWYGPDRP  231
            CGI   AFAG   S+LK  ++ L  VG+   G +R TMR++      S   S WYGPDR 
Sbjct  1    CGIGSCAFAGGKISSLKPHSNQLLGVGAGVHGESRVTMRKSATKKFASESPSPWYGPDRV  60

Query  232  KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFP  411
             YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVFP
Sbjct  61   LYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  120

Query  412  EILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            E+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWAS
Sbjct  121  ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAS  168



>gb|AAU89255.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus roxburghii]
Length=256

 Score =   248 bits (632),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 136/169 (80%), Gaps = 9/169 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYGPDR  228
            CGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKAATKKVSVSASTSPWYGPDR  60

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA 
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAC  169



>ref|XP_002967230.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ31829.1| light-harvesting complex [Selaginella moellendorffii]
Length=263

 Score =   248 bits (633),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 137/158 (87%), Gaps = 4/158 (3%)
 Frame = +1

Query  91   SAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAP---QSIWYGPDRPKYLGPFSEQT  261
            S FAGQ+ LK Q + + +  S+GS R  MR+T +++     S WYGPDR KYLGPFS ++
Sbjct  5    STFAGQTGLKPQNEFVARNASNGS-RVAMRKTGRASSVGGGSPWYGPDRVKYLGPFSGES  63

Query  262  PSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKF  441
            PSYLTGE+PGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+LSKNG+KF
Sbjct  64   PSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSKNGIKF  123

Query  442  GEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            GEAVWFKAG+QIF EGGLDYLGNP+L+HAQSILAIWAS
Sbjct  124  GEAVWFKAGSQIFKEGGLDYLGNPSLVHAQSILAIWAS  161



>gb|AAU89265.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Picea sitchensis]
Length=253

 Score =   247 bits (631),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 137/168 (82%), Gaps = 9/168 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYGPDR  228
            CGI   AFAG   S+LK   + L  VG+   G AR TMR++       SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHNNQLVGVGAGVHGEARVTMRKSSTKKVSASASTSPWYGPDR  60

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVF  120

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  168



>gb|AAY81729.1| chloroplast putative light harvesting chlorophyll a/b binding 
protein, partial [Pinus gerardiana]
Length=253

 Score =   247 bits (630),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 137/168 (82%), Gaps = 9/168 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYGPDR  228
            CGI   AFAG   S+LK  T+ L  VG+   G +R TMR++       SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQLSSLKPHTNQLLGVGAGIHGESRVTMRKSATKKSFASASPSPWYGPDR  60

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA  168



>ref|XP_001751359.1| predicted protein [Physcomitrella patens]
 gb|EDQ83676.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   247 bits (631),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 139/163 (85%), Gaps = 3/163 (2%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLG  243
            A+  +  +A AGQS  +   +L RKVG+  S R TMRRTV KSA   SIWYG DRPK+LG
Sbjct  3    AATAMHSTALAGQSLFQPVNELSRKVGNVDS-RVTMRRTVNKSAGSDSIWYGADRPKFLG  61

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFS +TPSYL GEF GDYGWDTAGLS+DPETFARNR+LEVIH+RWAMLGALGC+ PE+L+
Sbjct  62   PFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLA  121

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  122  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  164



>gb|AAU89256.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus chiapensis]
Length=256

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 137/168 (82%), Gaps = 9/168 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYGPDR  228
            CGI   AFAG   S LK  T+ L  VG+   G +R TMR++       SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGKISLLKPHTNQLLGVGAGVHGESRVTMRKSAAKKSFASASPSPWYGPDR  60

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVF  120

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            PE+L+KNGVKFGEAVWFKAGAQIFSEGGLD+LGNP+LIHAQSILAIWA
Sbjct  121  PELLAKNGVKFGEAVWFKAGAQIFSEGGLDHLGNPSLIHAQSILAIWA  168



>prf||1615137A chlorophyll a/b binding protein P25
Length=226

 Score =   246 bits (627),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/124 (91%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  184  TVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEV  363
            TV+SAP+SIWYGPDRPKYLGPFSE TPSYLTGEFPGDYGWDTA +SADPETFA+NR+LEV
Sbjct  1    TVRSAPESIWYGPDRPKYLGPFSEGTPSYLTGEFPGDYGWDTAAVSADPETFAKNRELEV  60

Query  364  IHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILA  543
            IH RWAMLGALGCVFPE+L KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILA
Sbjct  61   IHCRWAMLGALGCVFPELLVKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILA  120

Query  544  IWAS  555
            IWA 
Sbjct  121  IWAC  124



>gb|AAU89252.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus radiata]
Length=256

 Score =   246 bits (627),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 135/169 (80%), Gaps = 9/169 (5%)
 Frame = +1

Query  76   CGIQQSAFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRTVK-----SAPQSIWYGPDR  228
            CGI   AFAG   S+LK  T+ L  VG+   G AR  MR+        SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVMMRKATTKKVSVSASTSPWYGPDR  60

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA 
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAC  169



>gb|ACN40044.1| unknown [Picea sitchensis]
Length=278

 Score =   246 bits (628),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 143/174 (82%), Gaps = 9/174 (5%)
 Frame = +1

Query  58   SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  210
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  211  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLG  390
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  121

Query  391  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEG LDYLG+PNL+HAQSILAIWA
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGWLDYLGSPNLVHAQSILAIWA  175



>sp|P12329.1|CB21_MAIZE RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; 
AltName: Full=LHCII type I CAB-1; Short=LHCP; Flags: Precursor 
[Zea mays]
 emb|CAA32900.1| unnamed protein product [Zea mays]
 gb|ACF83754.1| unknown [Zea mays]
 gb|ACG25538.1| chlorophyll a-b binding protein 2 [Zea mays]
 gb|ACG28560.1| chlorophyll a-b binding protein 2 [Zea mays]
 tpg|DAA62636.1| TPA: light harvesting chlorophyll a/b binding protein2 [Zea mays]
Length=262

 Score =   245 bits (625),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 126/141 (89%), Gaps = 4/141 (3%)
 Frame = +1

Query  142  KVGSSGSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDT  309
            KVGS G  R TMR+TV     +A  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDT
Sbjct  19   KVGSFGEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDT  78

Query  310  AGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEG  489
            AGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEG
Sbjct  79   AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEG  138

Query  490  GLDYLGNPNLIHAQSILAIWA  552
            GLDYLGNP+LIHAQSILAIWA
Sbjct  139  GLDYLGNPSLIHAQSILAIWA  159



>ref|XP_001754234.1| predicted protein [Physcomitrella patens]
 dbj|BAD08518.1| light-harvesting chlorophyll a/b-binding protein 1 [Physcomitrella 
patens]
 gb|EDQ81135.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 134/152 (88%), Gaps = 3/152 (2%)
 Frame = +1

Query  103  GQSALKSQTDLLRKVGSSGSARFTMRRTVK--SAPQSIWYGPDRPKYLGPFSEQTPSYLT  276
            GQ+ L+   +L+RKVG+S  AR TMR+TV   S   SIWYG DRPK+LGPFS +TPSYL 
Sbjct  14   GQALLQPANELVRKVGTS-QARVTMRKTVSKSSGSDSIWYGADRPKFLGPFSGETPSYLN  72

Query  277  GEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVW  456
            GEF GDYGWDTAGLS+DPETFARNR+LEVIH+RWAMLGALGC+ PE+L+K+GVKFGEAVW
Sbjct  73   GEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAKSGVKFGEAVW  132

Query  457  FKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            FKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  164



>ref|XP_001751602.1| predicted protein [Physcomitrella patens]
 gb|EDQ83919.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   244 bits (624),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 138/163 (85%), Gaps = 3/163 (2%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLG  243
            A+  +  +  AGQS LK   +L R+VG+   AR TMRRTV KSA   SIWYG DRPK+LG
Sbjct  3    AAIAMHSTGLAGQSLLKPVNELSRRVGNV-DARVTMRRTVSKSARSDSIWYGADRPKFLG  61

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFS +TPSYL GEF GDYGWDTAGLS+D ETFARNR+LEVIH+RWAMLGALGC+ PE+L+
Sbjct  62   PFSGETPSYLNGEFAGDYGWDTAGLSSDLETFARNRELEVIHARWAMLGALGCLTPELLA  121

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  122  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWA  164



>ref|NP_565786.1| photosystem II light harvesting complex protein B1B2 [Arabidopsis 
thaliana]
 gb|AAK49602.1|AF372886_1 At2g34420/T31E10.24 [Arabidopsis thaliana]
 gb|AAL16165.1|AF428397_1 At2g34420/T31E10.24 [Arabidopsis thaliana]
 gb|AAL31882.1|AF419548_1 At2g34420/T31E10.24 [Arabidopsis thaliana]
 gb|AAL31919.1|AF419587_1 At2g34420/T31E10.24 [Arabidopsis thaliana]
 emb|CAA45790.1| photosystem II type I chlorophyll a /b binding protein [Arabidopsis 
thaliana]
 gb|AAC26710.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis 
thaliana]
 gb|AAK62616.1| At2g34420/T31E10.24 [Arabidopsis thaliana]
 gb|AAK76480.1| putative photosystem II type I chlorophyll a/b binding protein 
[Arabidopsis thaliana]
 gb|AAL38301.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis 
thaliana]
 gb|AAL84985.1| At2g34420/T31E10.24 [Arabidopsis thaliana]
 gb|AAL84994.1| At2g34420/T31E10.24 [Arabidopsis thaliana]
 gb|AAM10149.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis 
thaliana]
 gb|AAM14954.1| photosystem II type I chlorophyll a b binding protein [Arabidopsis 
thaliana]
 gb|AAN13114.1| putative photosystem II type I chlorophyll a/b binding protein 
[Arabidopsis thaliana]
 dbj|BAF01472.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis 
thaliana]
 gb|AEC08972.1| photosystem II light harvesting complex protein B1B2 [Arabidopsis 
thaliana]
Length=265

 Score =   244 bits (623),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 139/169 (82%), Gaps = 12/169 (7%)
 Frame = +1

Query  58   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV---KSAPQSIWYGPDR  228
            SS+MA   +   AFAG++   + +D+L      GS R TMR+TV   K    S WYG DR
Sbjct  3    SSTMA---LSSPAFAGKAVKPAASDVL------GSGRVTMRKTVAKPKGPSGSPWYGSDR  53

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
             KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVF
Sbjct  54   VKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  113

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            PE+L++NGVKFGEAVWFKAG+QIFS+GGLDYLGNP+L+HAQSILAIWA+
Sbjct  114  PELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWAT  162



>emb|CAA57407.1| light harvesting chlorophyll a /b-binding protein Lhcb1*1 [Picea 
abies]
Length=278

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 142/174 (82%), Gaps = 9/174 (5%)
 Frame = +1

Query  58   SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  210
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  211  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLG  390
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  391  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNLIHAQSILAI A
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLIHAQSILAILA  175



>ref|XP_002306927.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK95787.1| unknown [Populus trichocarpa]
 gb|ABK96559.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96723.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96730.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE93923.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   244 bits (622),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 123/134 (92%), Gaps = 1/134 (1%)
 Frame = +1

Query  157  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  333
            G+ R +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  29   GNGRVSMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  88

Query  334  TFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  513
            TFA+NR+LEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  148

Query  514  NLIHAQSILAIWAS  555
            +LIHAQSILAIWA+
Sbjct  149  SLIHAQSILAIWAT  162



>ref|XP_001754307.1| predicted protein [Physcomitrella patens]
 gb|EDQ80757.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   244 bits (622),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 138/164 (84%), Gaps = 3/164 (2%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQS--IWYGPDRPKYLG  243
            A+  +  +A AGQS LK   +L RKVG+   AR +MR++   +  S  IWYG DRPKYLG
Sbjct  3    AATAMHSTALAGQSLLKPVNELSRKVGNV-EARVSMRKSASKSAASDSIWYGADRPKYLG  61

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFS +TPSYL GEF GDYGWDTAGLS+DPETFARNR+LEVIH+RWAMLGALGCV PE+L+
Sbjct  62   PFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLA  121

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWAS
Sbjct  122  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAS  165



>gb|ACN40027.1| unknown [Picea sitchensis]
Length=278

 Score =   244 bits (623),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 142/174 (82%), Gaps = 9/174 (5%)
 Frame = +1

Query  58   SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  210
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  211  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLG  390
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEQPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  391  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAI A
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAILA  175



>ref|XP_011045092.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Populus 
euphratica]
Length=263

 Score =   243 bits (621),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 123/134 (92%), Gaps = 1/134 (1%)
 Frame = +1

Query  157  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  333
            G+ R +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  28   GNGRISMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  87

Query  334  TFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  513
            TFA+NR+LEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  88   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  147

Query  514  NLIHAQSILAIWAS  555
            +LIHAQSILAIWA+
Sbjct  148  SLIHAQSILAIWAT  161



>ref|XP_002307725.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK94788.1| unknown [Populus trichocarpa]
 gb|EEE94721.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   243 bits (621),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 123/134 (92%), Gaps = 1/134 (1%)
 Frame = +1

Query  157  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  333
            G+ R +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  29   GNGRVSMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  88

Query  334  TFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  513
            TFA+NR+LEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  148

Query  514  NLIHAQSILAIWAS  555
            +LIHAQSILAIWA+
Sbjct  149  SLIHAQSILAIWAT  162



>ref|NP_001147639.1| chlorophyll a-b binding protein 1, chloroplastic precursor [Zea 
mays]
 gb|ACG28217.1| chlorophyll a-b binding protein 2 [Zea mays]
Length=262

 Score =   243 bits (621),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 126/141 (89%), Gaps = 4/141 (3%)
 Frame = +1

Query  142  KVGSSGSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDT  309
            KVGS G  R TMR+TV     +A  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDT
Sbjct  19   KVGSFGEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDT  78

Query  310  AGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEG  489
            AGLSADP+TFA+NR+LEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEG
Sbjct  79   AGLSADPKTFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEG  138

Query  490  GLDYLGNPNLIHAQSILAIWA  552
            GLDYLGNP+LIHAQSILAIWA
Sbjct  139  GLDYLGNPSLIHAQSILAIWA  159



>gb|ABK22330.1| unknown [Picea sitchensis]
Length=278

 Score =   244 bits (622),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 142/174 (82%), Gaps = 9/174 (5%)
 Frame = +1

Query  58   SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMR-----RTVKSAPQSI  210
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR     ++V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMREATGKKSVAASSDSP  61

Query  211  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLG  390
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  391  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAI A
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAILA  175



>gb|ABK26071.1| unknown [Picea sitchensis]
 gb|ABR17429.1| unknown [Picea sitchensis]
Length=278

 Score =   244 bits (622),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 142/174 (82%), Gaps = 9/174 (5%)
 Frame = +1

Query  58   SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  210
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  211  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLG  390
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  391  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAI A
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAILA  175



>ref|XP_006295385.1| hypothetical protein CARUB_v10024479mg [Capsella rubella]
 ref|XP_010516588.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Camelina sativa]
 gb|EOA28283.1| hypothetical protein CARUB_v10024479mg [Capsella rubella]
Length=265

 Score =   243 bits (621),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 139/169 (82%), Gaps = 12/169 (7%)
 Frame = +1

Query  58   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV---KSAPQSIWYGPDR  228
            SS+MA   +   AFAG++   + +D+L      G+ R TMR+TV   K    S WYG DR
Sbjct  3    SSTMA---LSSPAFAGKAVKPAASDVL------GTGRVTMRKTVAKPKGPSGSPWYGSDR  53

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
             KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVF
Sbjct  54   VKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  113

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            PE+L++NGVKFGEAVWFKAG+QIFS+GGLDYLGNP+L+HAQSILAIWA+
Sbjct  114  PELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWAT  162



>ref|XP_011045093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=263

 Score =   243 bits (621),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 123/134 (92%), Gaps = 1/134 (1%)
 Frame = +1

Query  157  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  333
            G+ R +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  28   GNGRISMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  87

Query  334  TFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  513
            TFA+NR+LEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  88   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  147

Query  514  NLIHAQSILAIWAS  555
            +LIHAQSILAIWA+
Sbjct  148  SLIHAQSILAIWAT  161



>gb|EPS64140.1| chlorophyll a-b binding protein 21, chloroplastic [Genlisea aurea]
Length=265

 Score =   243 bits (621),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 133/164 (81%), Gaps = 8/164 (5%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTVKSAP--QSIWYGPDRPKYL  240
            A+  +   +FAGQ+  L   T  L     SG  R +MRRTV   P   S WYGPDR KYL
Sbjct  4    ATMALSSPSFAGQAVKLSPSTPEL-----SGKGRISMRRTVTKTPASSSPWYGPDRVKYL  58

Query  241  GPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEIL  420
            GPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH+RWAMLGALG +FPE+L
Sbjct  59   GPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGIIFPELL  118

Query  421  SKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            +KNGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA
Sbjct  119  AKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA  162



>gb|ABK23849.1| unknown [Picea sitchensis]
Length=278

 Score =   244 bits (622),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 142/174 (82%), Gaps = 9/174 (5%)
 Frame = +1

Query  58   SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVGSS-GSARFTMRR-----TVKSAPQSI  210
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AAAMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  211  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLG  390
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  391  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAI A
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAILA  175



>ref|XP_006844081.1| hypothetical protein AMTR_s00006p00251360 [Amborella trichopoda]
 gb|ERN05756.1| hypothetical protein AMTR_s00006p00251360 [Amborella trichopoda]
Length=266

 Score =   243 bits (621),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 137/166 (83%), Gaps = 5/166 (3%)
 Frame = +1

Query  67   MASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTVKSAPQS--IWYGPDRPKY  237
            MA+  +   +FAG++  + ++++    V   G  R +MR++   AP S   WYGPDR KY
Sbjct  1    MATMSLSSPSFAGKAVPVATRSEFGSTV--RGDGRVSMRKSASRAPVSGSPWYGPDRVKY  58

Query  238  LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEI  417
            LGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+
Sbjct  59   LGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL  118

Query  418  LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA+
Sbjct  119  LSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAT  164



>ref|XP_010509756.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Camelina sativa]
Length=265

 Score =   243 bits (620),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 139/169 (82%), Gaps = 12/169 (7%)
 Frame = +1

Query  58   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV---KSAPQSIWYGPDR  228
            SS+MA   +   AFAG++   + +D+L      G+ R TMR+TV   K    S WYG DR
Sbjct  3    SSTMA---LSSPAFAGKAVKPAVSDVL------GTGRVTMRKTVAKPKGPSGSPWYGSDR  53

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
             KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGALGCVF
Sbjct  54   VKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  113

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            PE+L++NGVKFGEAVWFKAG+QIFS+GGLDYLGNP+L+HAQSILAIWA+
Sbjct  114  PELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWAT  162



>gb|AAA80591.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   243 bits (620),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 136/163 (83%), Gaps = 6/163 (4%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLG  243
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+LS
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLS  119

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWA  162



>ref|XP_002460622.1| hypothetical protein SORBIDRAFT_02g032040 [Sorghum bicolor]
 gb|EER97143.1| hypothetical protein SORBIDRAFT_02g032040 [Sorghum bicolor]
Length=262

 Score =   243 bits (619),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 125/141 (89%), Gaps = 4/141 (3%)
 Frame = +1

Query  142  KVGSSGSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDT  309
            KVGS G  R TMR+T      +A  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDT
Sbjct  19   KVGSFGEGRITMRKTAAKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDT  78

Query  310  AGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEG  489
            AGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEG
Sbjct  79   AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEG  138

Query  490  GLDYLGNPNLIHAQSILAIWA  552
            GLDYLGNP+LIHAQSILAIWA
Sbjct  139  GLDYLGNPSLIHAQSILAIWA  159



>ref|XP_004957570.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Setaria italica]
Length=261

 Score =   242 bits (618),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 125/141 (89%), Gaps = 4/141 (3%)
 Frame = +1

Query  142  KVGSSGSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDT  309
            KVGS G  R TMR+T      +A  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDT
Sbjct  18   KVGSFGEGRITMRKTAAKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDT  77

Query  310  AGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEG  489
            AGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEG
Sbjct  78   AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEG  137

Query  490  GLDYLGNPNLIHAQSILAIWA  552
            GLDYLGNP+LIHAQSILAIWA
Sbjct  138  GLDYLGNPSLIHAQSILAIWA  158



>ref|XP_008644669.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Zea mays]
Length=259

 Score =   242 bits (618),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 131/161 (81%), Gaps = 7/161 (4%)
 Frame = +1

Query  67   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  243
            MA+  +QQ+ +F GQ+ +       R  G    +R TMRRTVKSAPQSIWY PDRPKYL 
Sbjct  1    MATSALQQTTSFLGQALVS------RPAGVDAGSRITMRRTVKSAPQSIWYDPDRPKYLA  54

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFSEQT SYLTGEFPGDYGWDTAGLSAD ETFARNR+LEVIHS WAMLGALGCVFPE+L+
Sbjct  55   PFSEQTSSYLTGEFPGDYGWDTAGLSADHETFARNRELEVIHSWWAMLGALGCVFPEVLA  114

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAI  546
            KN VKFGE VWFKAGAQIFSEGGLDYL N  L+HA+S LA+
Sbjct  115  KNDVKFGEVVWFKAGAQIFSEGGLDYLTNACLLHAKSFLAL  155



>ref|XP_008229463.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Prunus mume]
Length=215

 Score =   241 bits (614),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 137/175 (78%), Gaps = 21/175 (12%)
 Frame = +1

Query  58   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSS-----GSARFTMRRTVKSAPQ----SI  210
            SS+MA   +   + AGQ+          K+GSS     G  R TMR+T   +      S 
Sbjct  3    SSTMA---LSSPSLAGQAV---------KLGSSVSNIVGEGRVTMRKTASKSKNVSSGSP  50

Query  211  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLG  390
            WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  391  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            ALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAT  165



>ref|XP_010504897.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Camelina sativa]
Length=277

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 141/174 (81%), Gaps = 11/174 (6%)
 Frame = +1

Query  49   AEESSSMASCGIQQS--AFAGQSALKSQTDLLRKVGSSGSARFTMRRTV---KSAPQSIW  213
            A  S ++A   ++ S  AFAG++   + +D+L      G+ R TMR+TV   K    S W
Sbjct  7    ALSSPALAGKAVKLSSPAFAGKAVKPAASDVL------GTGRVTMRKTVAKPKGPSGSPW  60

Query  214  YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGA  393
            YG DR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGA
Sbjct  61   YGSDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA  120

Query  394  LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            LGCVFPE+L++NGVKFGEAVWFKAG+QIFS+GGLDYLGNP+L+HAQSILAIWA+
Sbjct  121  LGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWAT  174



>gb|AAU89263.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus longaeva]
Length=253

 Score =   241 bits (616),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 135/162 (83%), Gaps = 9/162 (6%)
 Frame = +1

Query  94   AFAGQ--SALKSQTDLLRKVGSS--GSARFTMRRT-----VKSAPQSIWYGPDRPKYLGP  246
            AFAG   S+LK  T+ L  VG+   G +R TMR++     V SA  S WYGPDR  YLGP
Sbjct  4    AFAGGQISSLKPHTNQLLGVGAGVHGESRVTMRKSATKKSVVSASPSPWYGPDRVLYLGP  63

Query  247  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSK  426
            FS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L++
Sbjct  64   FSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR  123

Query  427  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA
Sbjct  124  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA  165



>ref|XP_006368026.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   242 bits (617),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 136/163 (83%), Gaps = 6/163 (4%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLG  243
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVSKSAPSSSPWYGPDRVKYLG  59

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWA  162



>ref|XP_006365572.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
 gb|AAA80589.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   242 bits (617),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 136/163 (83%), Gaps = 6/163 (4%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLG  243
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWA  162



>ref|XP_004233096.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233099.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233100.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316910.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316913.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 sp|P07370.1|CB2B_SOLLC RecName: Full=Chlorophyll a-b binding protein 1B, chloroplastic; 
AltName: Full=LHCII type I CAB-1B; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34147.1| chlorophyll a/b-binding protein Cab-1B [Solanum lycopersicum]
Length=265

 Score =   242 bits (617),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 136/163 (83%), Gaps = 6/163 (4%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLG  243
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWA  162



>ref|XP_004293579.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Fragaria 
vesca subsp. vesca]
Length=263

 Score =   242 bits (617),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 138/168 (82%), Gaps = 11/168 (7%)
 Frame = +1

Query  58   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQS--IWYGPDRP  231
            +S+MA   +    FAG++   + T++       G+ R +MR+TV  A  S   WYGPDR 
Sbjct  3    ASTMA---LSSPTFAGKAVQLAPTEVF------GTGRISMRKTVGKAVSSGSPWYGPDRV  53

Query  232  KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFP  411
            KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFP
Sbjct  54   KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFP  113

Query  412  EILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            E+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+
Sbjct  114  ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAT  161



>ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|EEE97349.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 135/165 (82%), Gaps = 9/165 (5%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSAL--KSQTDLLRKVGSSGSARFTMRRTVKSAPQ-SIWYGPDRPKYL  240
            A+  +   AFAG++     S  +L+      G+ R +MR+T K     S WYGPDR KYL
Sbjct  4    ATMALSSPAFAGKAVKLSPSSPELM------GNGRVSMRKTTKPVSSGSPWYGPDRVKYL  57

Query  241  GPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEIL  420
            GPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE+L
Sbjct  58   GPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL  117

Query  421  SKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            S+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA+
Sbjct  118  SRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWAT  162



>ref|XP_001765456.1| predicted protein [Physcomitrella patens]
 gb|EDQ69717.1| predicted protein [Physcomitrella patens]
Length=266

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 137/164 (84%), Gaps = 4/164 (2%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVK--SAPQSIWYGPDRPKYLG  243
            A+  +  +  AGQS  +   +L  KVGSS  AR +MR+TV   S   SIWYG DRPK+LG
Sbjct  3    AATAMHSTTLAGQSLFRFN-ELSSKVGSS-QARVSMRKTVSKSSGSDSIWYGADRPKWLG  60

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFS +TPSYL GEF GDYGWDTAGLS+DPETFARNR+LEVIH+RWAMLGALGC+ PE+L+
Sbjct  61   PFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLA  120

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWAS
Sbjct  121  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAS  164



>ref|XP_004145734.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004169747.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 gb|KGN46826.1| hypothetical protein Csa_6G139750 [Cucumis sativus]
Length=267

 Score =   241 bits (616),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 138/171 (81%), Gaps = 15/171 (9%)
 Frame = +1

Query  58   SSSMASCGIQQSAFAGQSALKSQT--DLLRKVGSSGSARFTMRRTV-KSAPQS---IWYG  219
            +SSMA   +   +FAGQ+   S T  DLL      G  R TMR+T  K  P S    WYG
Sbjct  3    ASSMA---LSSPSFAGQAVKLSPTASDLL------GEGRITMRKTAGKPKPVSSGSPWYG  53

Query  220  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALG  399
            PDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALG
Sbjct  54   PDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  113

Query  400  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            CVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  114  CVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWA  164



>ref|XP_008229430.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   241 bits (616),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 140/176 (80%), Gaps = 23/176 (13%)
 Frame = +1

Query  58   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSS-----GSARFTMRRTVKSAPQSI----  210
            SS+MA   +   + AGQ+          K+GSS     G  R TMR+T  S P+++    
Sbjct  3    SSTMA---LSSPSLAGQAV---------KLGSSVSNIVGEGRVTMRKTA-SKPKNVSSGS  49

Query  211  -WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAML  387
             WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAML
Sbjct  50   PWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAML  109

Query  388  GALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            GALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+
Sbjct  110  GALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAT  165



>gb|AAT08668.1| chloroplast chlorophyll A-B binding protein 40 [Hyacinthus orientalis]
Length=237

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 127/141 (90%), Gaps = 6/141 (4%)
 Frame = +1

Query  148  GSSGSARFTMRRTVKSAPQSI-----WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTA  312
            G SG  RFTMR+TV + P+++     WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTA
Sbjct  11   GVSGDGRFTMRKTV-AKPKTVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTA  69

Query  313  GLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGG  492
            GLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGG
Sbjct  70   GLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGG  129

Query  493  LDYLGNPNLIHAQSILAIWAS  555
            LDYLGNP+L+HAQSILAIWA+
Sbjct  130  LDYLGNPSLVHAQSILAIWAT  150



>ref|XP_010316911.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 138/165 (84%), Gaps = 10/165 (6%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSA--LKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKY  237
            A+  +   +FAGQ+   L S +++      +G+ R TMR+ V KSAP S  WYGPDR KY
Sbjct  4    ATMALSSPSFAGQAVKLLPSASEI------TGNGRITMRKAVAKSAPSSSPWYGPDRVKY  57

Query  238  LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEI  417
            LGPFS ++PSYL GEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+
Sbjct  58   LGPFSGESPSYLNGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL  117

Query  418  LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  118  LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWA  162



>ref|XP_010052095.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Eucalyptus 
grandis]
Length=264

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 137/168 (82%), Gaps = 12/168 (7%)
 Frame = +1

Query  58   SSSMASCGIQQSAFAGQSALKSQT--DLLRKVGSSGSARFTMRRTVKSAPQ-SIWYGPDR  228
            +S+MA   +   +FAG++   S    DLL      G+ R TMR+ VK A   S WYGPDR
Sbjct  3    ASTMA---LSSPSFAGKAVKLSPATPDLL------GNGRVTMRKAVKPASSGSPWYGPDR  53

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
             KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVF
Sbjct  54   AKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  113

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA
Sbjct  114  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA  161



>gb|ABF97414.1| Chlorophyll a-b binding protein, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
Length=219

 Score =   239 bits (611),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = +1

Query  214  YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGA  393
            YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNR+LEVIHSRWAMLGA
Sbjct  4    YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA  63

Query  394  LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA
Sbjct  64   LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWA  116



>ref|XP_002515206.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF47190.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=267

 Score =   241 bits (615),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 135/159 (85%), Gaps = 5/159 (3%)
 Frame = +1

Query  91   SAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTV---KSAPQSIWYGPDRPKYLGPFSEQ  258
            S F G++  L +QT+L   V SS + R TMR+T     ++  S WYGPDR KYLGPFS +
Sbjct  8    STFTGKAVPLSAQTELPATVRSS-NGRVTMRKTAGKPAASSGSPWYGPDRVKYLGPFSGE  66

Query  259  TPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVK  438
             PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L++NGVK
Sbjct  67   PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVK  126

Query  439  FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            FGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA+
Sbjct  127  FGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWAT  165



>ref|XP_010316912.1| PREDICTED: chlorophyll a-b binding protein 1A, chloroplastic 
[Solanum lycopersicum]
Length=265

 Score =   241 bits (615),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 135/159 (85%), Gaps = 6/159 (4%)
 Frame = +1

Query  82   IQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLGPFSE  255
            +   +FAGQ+   S +       +SG+ R TMR+ V KSAP S  WYGPDR KYLGPFS 
Sbjct  8    LSSPSFAGQAVKLSPS----ASENSGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSG  63

Query  256  QTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGV  435
            ++PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L++NGV
Sbjct  64   ESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGV  123

Query  436  KFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            KFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  124  KFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWA  162



>ref|XP_006365573.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006365574.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=265

 Score =   241 bits (614),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 136/163 (83%), Gaps = 6/163 (4%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLG  243
            A+  +   +FAGQ+   S +        +G+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEITGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWA  162



>ref|XP_006365560.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   241 bits (614),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 136/163 (83%), Gaps = 6/163 (4%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLG  243
            A+  +   +FAGQ+   S +        +G+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEITGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWA  162



>ref|XP_004233101.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score =   241 bits (614),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 2/135 (1%)
 Frame = +1

Query  154  SGSARFTMRRTV-KSAPQS-IWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSAD  327
            SG+ R TMR+ V KSAP S  WYGPDR KYLGPFS ++PSYLTGEFPGDYGWDTAGLSAD
Sbjct  28   SGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSAD  87

Query  328  PETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLG  507
            PETFA+NR+LEVIH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLG
Sbjct  88   PETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLG  147

Query  508  NPNLIHAQSILAIWA  552
            NP+L+HAQSILAIWA
Sbjct  148  NPSLVHAQSILAIWA  162



>gb|AAA80593.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   241 bits (614),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 140/168 (83%), Gaps = 11/168 (7%)
 Frame = +1

Query  58   SSSMASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDR  228
            +S+MA   +   +FAGQ+  L   T  +     +G+ R TMR+ V KSAP S  WYGPDR
Sbjct  3    ASTMA---LSSPSFAGQAVKLSPSTSEI-----TGNGRITMRKAVAKSAPSSSPWYGPDR  54

Query  229  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVF  408
             KYLGPFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVF
Sbjct  55   VKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  114

Query  409  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            PE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA
Sbjct  115  PELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWA  162



>ref|XP_007217260.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
 gb|AAA50310.1| light-harvesting chlorophyll a/b-binding protein [Prunus persica]
 gb|EMJ18459.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
Length=267

 Score =   241 bits (614),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 137/175 (78%), Gaps = 21/175 (12%)
 Frame = +1

Query  58   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSS-----GSARFTMRRTVKSAPQ----SI  210
            SS+MA   +   + AGQ+          K+GSS     G  R TMR+T   +      S 
Sbjct  3    SSTMA---LSSPSLAGQAV---------KLGSSVSNIVGEGRITMRKTASKSKNVSSGSP  50

Query  211  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLG  390
            WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  391  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            ALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAT  165



>ref|XP_008229429.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   240 bits (613),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 137/175 (78%), Gaps = 21/175 (12%)
 Frame = +1

Query  58   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSS-----GSARFTMRRTVKSAPQ----SI  210
            SS+MA   +   + AGQ+          K+GSS     G  R TMR+T   +      S 
Sbjct  3    SSTMA---LSSPSLAGQAV---------KLGSSVSNIVGEGRVTMRKTASKSKNVSSGSP  50

Query  211  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLG  390
            WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  391  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            ALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAT  165



>prf||1204205B protein 1B,chlorophyll binding
Length=265

 Score =   240 bits (613),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 136/163 (83%), Gaps = 6/163 (4%)
 Frame = +1

Query  70   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLG  243
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  244  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPEILS  423
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  424  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA  552
            +NGVKFGEAVWFKAG+QIFS+GGLDYLGNP+L+HAQSILAIWA
Sbjct  120  RNGVKFGEAVWFKAGSQIFSQGGLDYLGNPSLVHAQSILAIWA  162



>gb|AHB24929.1| chloroplast light-harvesting complex II chlorophyll a/b binding 
protein 1 [Sedum alfredii]
Length=267

 Score =   240 bits (613),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 125/137 (91%), Gaps = 4/137 (3%)
 Frame = +1

Query  157  GSARFTMRRTV-KSAP---QSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSA  324
            G+++ TMR+T  KS P    S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNSKVTMRKTAAKSKPTVSSSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  325  DPETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  504
            DPETFA+NR+LEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  505  GNPNLIHAQSILAIWAS  555
            GNP+L+HAQSILAIWA+
Sbjct  149  GNPSLVHAQSILAIWAT  165



>gb|ABW70800.1| chloroplast light harvesting chlorophyll a/b binding protein 
[Populus euphratica]
Length=263

 Score =   240 bits (612),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 122/134 (91%), Gaps = 1/134 (1%)
 Frame = +1

Query  157  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  333
            G+   +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  28   GNGCISMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  87

Query  334  TFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  513
            TFA+NR+LEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  88   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  147

Query  514  NLIHAQSILAIWAS  555
            +LIHAQSILAIWA+
Sbjct  148  SLIHAQSILAIWAT  161



>ref|XP_008358195.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   240 bits (613),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 137/167 (82%), Gaps = 8/167 (5%)
 Frame = +1

Query  67   MASCGIQQSAFAGQS-ALKSQTDLLRKVGSSGSARFTMRRTVKS---APQSIWYGPDRPK  234
            MA+  +  S F G++  L +QT+        G+ R +MR+T K    +  S WYGPDR K
Sbjct  1    MATMALS-SPFTGKAIPLNTQTEF---SAVQGNGRVSMRKTAKKPAVSSGSPWYGPDRVK  56

Query  235  YLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRQLEVIHSRWAMLGALGCVFPE  414
            YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NR+LEVIHSRWAMLGALGCVFPE
Sbjct  57   YLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE  116

Query  415  ILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAS  555
            +LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+
Sbjct  117  LLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAT  163



>gb|ACL50948.1| putative chloroplast chlorophyll a/b binding protein [Solanum 
nigrum]
Length=249

 Score =   239 bits (611),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 2/135 (1%)
 Frame = +1

Query  154  SGSARFTMRRTV-KSAPQS-IWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSAD  327
            SG+ R TMR+ V KSAP S  WYGPDR KYLGPFS ++PSYLTGEFPGDYGWDTAGLSAD
Sbjct  12   SGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSAD  71

Query  328  PETFARNRQLEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLG  507
            PETFA+NR+LEVIH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLG
Sbjct  72   PETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLG  131

Query  508  NPNLIHAQSILAIWA  552
            NP+L+HAQSILAIWA
Sbjct  132  NPSLVHAQSILAIWA  146



Lambda      K        H        a         alpha
   0.317    0.132    0.403    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800