BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF046B21

Length=558
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP30256.1|  hypothetical protein JCGZ_17038                         108   9e-24   Jatropha curcas
ref|XP_007013520.1|  RabGAP/TBC domain-containing protein isoform 1     106   7e-23   
gb|KJB27075.1|  hypothetical protein B456_004G276400                    101   2e-21   Gossypium raimondii
gb|KJB27076.1|  hypothetical protein B456_004G276400                    101   3e-21   Gossypium raimondii
emb|CDP10442.1|  unnamed protein product                                101   3e-21   Coffea canephora [robusta coffee]
gb|KJB27077.1|  hypothetical protein B456_004G276400                    100   4e-21   Gossypium raimondii
gb|KJB27079.1|  hypothetical protein B456_004G276400                    100   4e-21   Gossypium raimondii
ref|XP_010241555.1|  PREDICTED: TBC1 domain family member 17 isof...    100   5e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010241554.1|  PREDICTED: TBC1 domain family member 17 isof...    100   6e-21   Nelumbo nucifera [Indian lotus]
gb|KHG01737.1|  TBC1 domain family member 15                            100   8e-21   Gossypium arboreum [tree cotton]
ref|XP_010656459.1|  PREDICTED: TBC1 domain family member 17 isof...  99.8    1e-20   Vitis vinifera
ref|XP_010112474.1|  TBC1 domain family member 15                     98.2    2e-20   
gb|KDO80156.1|  hypothetical protein CISIN_1g005652mg                 99.0    2e-20   Citrus sinensis [apfelsine]
ref|XP_010656458.1|  PREDICTED: GTPase-activating protein GYP7 is...  98.2    3e-20   Vitis vinifera
ref|XP_009593350.1|  PREDICTED: TBC1 domain family member 17 isof...  93.6    1e-18   Nicotiana tomentosiformis
ref|XP_009593351.1|  PREDICTED: TBC1 domain family member 15 isof...  93.2    1e-18   
ref|XP_009789609.1|  PREDICTED: TBC1 domain family member 17-like...  93.2    1e-18   Nicotiana sylvestris
ref|XP_009789610.1|  PREDICTED: TBC1 domain family member 15-like...  93.2    1e-18   Nicotiana sylvestris
ref|XP_009593349.1|  PREDICTED: TBC1 domain family member 17 isof...  93.2    2e-18   Nicotiana tomentosiformis
ref|XP_009789608.1|  PREDICTED: TBC1 domain family member 17-like...  93.2    2e-18   Nicotiana sylvestris
ref|XP_010323291.1|  PREDICTED: GTPase-activating protein gyp7        90.5    1e-17   Solanum lycopersicum
ref|XP_007155039.1|  hypothetical protein PHAVU_003G167800g           89.7    3e-17   Phaseolus vulgaris [French bean]
gb|AIU48651.1|  RabGAP/TBC domain-containing protein                  88.6    6e-17   Gossypium raimondii
gb|AIU48673.1|  RabGAP/TBC domain-containing protein                  88.6    6e-17   Phaseolus vulgaris [French bean]
ref|XP_006358298.1|  PREDICTED: GTPase-activating protein gyp7-like   88.6    8e-17   Solanum tuberosum [potatoes]
gb|KJB64720.1|  hypothetical protein B456_010G061900                  87.4    1e-16   Gossypium raimondii
gb|AIU48656.1|  RabGAP/TBC domain-containing protein                  87.8    1e-16   Glycine max [soybeans]
gb|AIU48652.1|  RabGAP/TBC domain-containing protein                  87.4    2e-16   Carica papaya [mamon]
ref|XP_011084120.1|  PREDICTED: TBC1 domain family member 15          87.4    2e-16   Sesamum indicum [beniseed]
gb|KJB64721.1|  hypothetical protein B456_010G061900                  87.0    2e-16   Gossypium raimondii
gb|KJB64719.1|  hypothetical protein B456_010G061900                  87.0    2e-16   Gossypium raimondii
gb|AIU48685.1|  RabGAP/TBC domain-containing protein                  85.1    3e-16   Platanus x hispanica [London plane tree]
ref|XP_004508469.1|  PREDICTED: TBC1 domain family member 17-like...  85.9    4e-16   
gb|ACU19099.1|  unknown                                               83.6    4e-16   Glycine max [soybeans]
ref|XP_010241556.1|  PREDICTED: TBC1 domain family member 15 isof...  86.3    5e-16   Nelumbo nucifera [Indian lotus]
ref|XP_007013521.1|  RabGAP/TBC domain-containing protein isoform 2   85.9    5e-16   
ref|XP_003542634.1|  PREDICTED: TBC1 domain family member 15-like     85.9    6e-16   Glycine max [soybeans]
gb|KHN22122.1|  TBC1 domain family member 15                          85.9    6e-16   Glycine soja [wild soybean]
gb|AIU48660.1|  RabGAP/TBC domain-containing protein                  85.5    7e-16   Chloranthus japonicus
ref|XP_004508468.1|  PREDICTED: TBC1 domain family member 17-like...  85.5    8e-16   Cicer arietinum [garbanzo]
gb|AIU48649.1|  RabGAP/TBC domain-containing protein                  83.2    8e-16   Sarcandra glabra
ref|XP_002285365.1|  PREDICTED: TBC1 domain family member 17 isof...  85.1    1e-15   Vitis vinifera
gb|AIU48681.1|  RabGAP/TBC domain-containing protein                  85.1    1e-15   Vitis vinifera
gb|AIU48647.1|  RabGAP/TBC domain-containing protein                  84.3    2e-15   Theobroma cacao [chocolate]
gb|AIU48643.1|  RabGAP/TBC domain-containing protein                  84.3    2e-15   Magnolia denudata [haku-mokuren]
gb|KDO80165.1|  hypothetical protein CISIN_1g005652mg                 82.4    2e-15   Citrus sinensis [apfelsine]
ref|XP_011020167.1|  PREDICTED: TBC1 domain family member 15          84.3    2e-15   Populus euphratica
gb|AIU48684.1|  RabGAP/TBC domain-containing protein                  84.0    2e-15   Cinnamomum camphora
ref|XP_003549744.1|  PREDICTED: TBC1 domain family member 15-like     84.0    3e-15   
gb|KDO80163.1|  hypothetical protein CISIN_1g005652mg                 82.4    4e-15   Citrus sinensis [apfelsine]
gb|KJB27078.1|  hypothetical protein B456_004G276400                  83.2    5e-15   Gossypium raimondii
gb|AIU48668.1|  RabGAP/TBC domain-containing protein                  83.2    5e-15   Manihot esculenta [manioc]
gb|EYU18249.1|  hypothetical protein MIMGU_mgv1a002604mg              82.8    6e-15   Erythranthe guttata [common monkey flower]
gb|AIU48669.1|  RabGAP/TBC domain-containing protein                  82.8    6e-15   Erythranthe guttata [common monkey flower]
gb|KDO80162.1|  hypothetical protein CISIN_1g005652mg                 82.4    6e-15   Citrus sinensis [apfelsine]
gb|AIU48675.1|  RabGAP/TBC domain-containing protein                  82.4    7e-15   Ricinus communis
gb|KDO80164.1|  hypothetical protein CISIN_1g005652mg                 82.0    8e-15   Citrus sinensis [apfelsine]
ref|XP_003609386.1|  TBC1 domain family member                        82.4    8e-15   Medicago truncatula
gb|KDO80161.1|  hypothetical protein CISIN_1g005652mg                 82.0    8e-15   Citrus sinensis [apfelsine]
ref|XP_004159423.1|  PREDICTED: TBC1 domain family member 15-like     81.6    9e-15   
ref|XP_002527173.1|  conserved hypothetical protein                   82.4    9e-15   
gb|AIU48666.1|  RabGAP/TBC domain-containing protein                  82.4    9e-15   Medicago truncatula
gb|KDO80160.1|  hypothetical protein CISIN_1g005652mg                 82.0    9e-15   Citrus sinensis [apfelsine]
gb|AIU48658.1|  RabGAP/TBC domain-containing protein                  82.0    1e-14   Buxus sinica
ref|XP_006475896.1|  PREDICTED: TBC1 domain family member 17-like     82.0    1e-14   Citrus sinensis [apfelsine]
gb|KDO80159.1|  hypothetical protein CISIN_1g005652mg                 82.0    1e-14   Citrus sinensis [apfelsine]
gb|AIU48650.1|  RabGAP/TBC domain-containing protein                  82.0    1e-14   Citrus clementina [clementine]
ref|XP_006450870.1|  hypothetical protein CICLE_v10007683mg           82.0    1e-14   Citrus clementina [clementine]
gb|AIU48654.1|  RabGAP/TBC domain-containing protein                  82.0    1e-14   Citrus sinensis [apfelsine]
gb|AIU48639.1|  RabGAP/TBC domain-containing protein                  81.6    1e-14   Aquilegia coerulea [Rocky Mountain columbine]
ref|XP_008456989.1|  PREDICTED: TBC1 domain family member 15          81.6    2e-14   Cucumis melo [Oriental melon]
ref|XP_004139297.1|  PREDICTED: TBC1 domain family member 15-like     81.3    2e-14   Cucumis sativus [cucumbers]
ref|XP_006345222.1|  PREDICTED: TBC1 domain family member 15-like     81.3    2e-14   Solanum tuberosum [potatoes]
gb|AIU48687.1|  RabGAP/TBC domain-containing protein                  80.9    3e-14   Houttuynia cordata [chameleon-plant]
gb|AIU48659.1|  RabGAP/TBC domain-containing protein                  80.1    4e-14   Iris japonica
ref|XP_009758337.1|  PREDICTED: TBC1 domain family member 15-like     80.1    5e-14   Nicotiana sylvestris
gb|AIU48671.1|  RabGAP/TBC domain-containing protein                  80.1    5e-14   Prunus persica
ref|XP_007204093.1|  hypothetical protein PRUPE_ppa002904mg           79.7    6e-14   
ref|XP_008242808.1|  PREDICTED: TBC1 domain family member 17          79.7    6e-14   Prunus mume [ume]
gb|KJB54007.1|  hypothetical protein B456_009G016100                  79.3    8e-14   Gossypium raimondii
gb|AIU48662.1|  RabGAP/TBC domain-containing protein                  79.3    9e-14   Chimonanthus praecox [wintersweet]
ref|XP_009127224.1|  PREDICTED: TBC1 domain family member 15          79.3    1e-13   Brassica rapa
ref|XP_004251725.1|  PREDICTED: TBC1 domain family member 17-like     79.0    1e-13   Solanum lycopersicum
ref|XP_011017820.1|  PREDICTED: TBC1 domain family member 17-like...  79.0    1e-13   Populus euphratica
ref|XP_011017816.1|  PREDICTED: TBC1 domain family member 15-like...  79.0    1e-13   Populus euphratica
ref|XP_011017818.1|  PREDICTED: TBC1 domain family member 15-like...  79.0    1e-13   Populus euphratica
emb|CDY27056.1|  BnaA02g10760D                                        78.6    2e-13   Brassica napus [oilseed rape]
ref|XP_010687932.1|  PREDICTED: TBC1 domain family member 15 isof...  78.6    2e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687933.1|  PREDICTED: TBC1 domain family member 15 isof...  78.6    2e-13   Beta vulgaris subsp. vulgaris [field beet]
gb|AIU48655.1|  RabGAP/TBC domain-containing protein                  78.2    2e-13   Eucalyptus grandis [rose gum]
ref|XP_010047970.1|  PREDICTED: TBC1 domain family member 15          78.6    2e-13   Eucalyptus grandis [rose gum]
gb|AIU48689.1|  RabGAP/TBC domain-containing protein                  78.2    2e-13   Alisma plantago-aquatica
gb|KCW80045.1|  hypothetical protein EUGRSUZ_C01375                   78.2    2e-13   Eucalyptus grandis [rose gum]
ref|XP_006372159.1|  hypothetical protein POPTR_0018s12770g           78.2    2e-13   
ref|XP_009624893.1|  PREDICTED: TBC1 domain family member 15-like     78.2    2e-13   Nicotiana tomentosiformis
ref|XP_002324638.2|  hypothetical protein POPTR_0018s12770g           78.2    2e-13   
gb|AIU48670.1|  RabGAP/TBC domain-containing protein                  78.2    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006401806.1|  hypothetical protein EUTSA_v10012867mg           77.8    3e-13   
gb|AIU48674.1|  RabGAP/TBC domain-containing protein                  75.1    3e-13   Artemisia annua [sweet Annie]
gb|AIU48680.1|  RabGAP/TBC domain-containing protein                  77.8    3e-13   Schrenkiella parvula
ref|XP_006401805.1|  hypothetical protein EUTSA_v10012867mg           77.8    3e-13   Eutrema salsugineum [saltwater cress]
ref|XP_006855176.1|  hypothetical protein AMTR_s00051p00106780        77.0    5e-13   Amborella trichopoda
ref|XP_008354495.1|  PREDICTED: GTPase-activating protein gyp7-like   75.9    5e-13   
ref|XP_008377303.1|  PREDICTED: TBC1 domain family member 17          77.0    6e-13   
ref|XP_011469988.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...  76.6    7e-13   Fragaria vesca subsp. vesca
ref|XP_010557604.1|  PREDICTED: TBC1 domain family member 15          76.6    7e-13   Tarenaya hassleriana [spider flower]
gb|AIU48682.1|  RabGAP/TBC domain-containing protein                  75.1    8e-13   Lactuca sativa [cultivated lettuce]
emb|CDY65323.1|  BnaC02g44880D                                        75.9    1e-12   Brassica napus [oilseed rape]
gb|AIU48640.1|  RabGAP/TBC domain-containing protein                  75.1    2e-12   Arabidopsis lyrata [lyrate rockcress]
ref|XP_009363991.1|  PREDICTED: TBC1 domain family member 15          75.1    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_004287286.1|  PREDICTED: TBC1 domain family member 15          74.7    3e-12   Fragaria vesca subsp. vesca
gb|AIU48690.1|  RabGAP/TBC domain-containing protein                  74.3    4e-12   Trachycarpus fortunei
gb|AIU48665.1|  RabGAP/TBC domain-containing protein                  74.3    4e-12   Aristolochia tagala
gb|AIU48661.1|  RabGAP/TBC domain-containing protein                  73.9    5e-12   Ceratophyllum demersum [hornwort]
gb|AIU48676.1|  RabGAP/TBC domain-containing protein                  73.9    6e-12   Dioscorea oppositifolia
gb|AIU48686.1|  RabGAP/TBC domain-containing protein                  73.9    6e-12   Ginkgo biloba [ginkgo]
gb|AIU48663.1|  RabGAP/TBC domain-containing protein                  71.2    6e-12   Pandanus utilis
gb|AIU48653.1|  RabGAP/TBC domain-containing protein                  73.6    7e-12   Capsella rubella
gb|AIU48648.1|  RabGAP/TBC domain-containing protein                  73.6    7e-12   Acorus calamus [flagroot]
gb|AIU48645.1|  RabGAP/TBC domain-containing protein                  73.6    7e-12   Pinellia ternata
ref|XP_006280129.1|  hypothetical protein CARUB_v10026023mg           73.6    7e-12   Capsella rubella
gb|AIU48641.1|  RabGAP/TBC domain-containing protein                  73.2    9e-12   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26862.1|  hypothetical protein AALP_AA8G303600                  73.6    9e-12   Arabis alpina [alpine rockcress]
ref|XP_002864184.1|  hypothetical protein ARALYDRAFT_495330           73.6    9e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_008785780.1|  PREDICTED: TBC1 domain family member 15          73.2    9e-12   Phoenix dactylifera
gb|AIU48683.1|  RabGAP/TBC domain-containing protein                  73.2    1e-11   Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU48664.1|  RabGAP/TBC domain-containing protein                  72.8    1e-11   Asparagus officinalis
ref|NP_200071.2|  RabGAP/TBC domain-containing protein                72.8    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482627.1|  PREDICTED: TBC1 domain family member 15-like...  72.4    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010442797.1|  PREDICTED: TBC1 domain family member 15-like     72.4    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010445069.1|  PREDICTED: TBC1 domain family member 15-like...  72.4    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010445073.1|  PREDICTED: TBC1 domain family member 15-like...  72.4    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010482626.1|  PREDICTED: TBC1 domain family member 15-like...  72.4    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010482625.1|  PREDICTED: TBC1 domain family member 15-like...  72.4    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_008362894.1|  PREDICTED: TBC1 domain family member 17-like     72.0    2e-11   
gb|AIU48657.1|  RabGAP/TBC domain-containing protein                  72.0    3e-11   Illicium henryi
ref|XP_001783529.1|  predicted protein                                71.2    3e-11   
gb|AIU48677.1|  RabGAP/TBC domain-containing protein                  70.9    6e-11   Yucca filamentosa [Adam's-needle]
ref|XP_010911930.1|  PREDICTED: TBC1 domain family member 17 isof...  70.1    1e-10   Elaeis guineensis
gb|AIU48691.1|  RabGAP/TBC domain-containing protein                  68.2    3e-10   Cabomba caroliniana
ref|XP_010911929.1|  PREDICTED: TBC1 domain family member 15 isof...  68.2    4e-10   Elaeis guineensis
ref|XP_009420718.1|  PREDICTED: TBC1 domain family member 15          65.5    3e-09   
gb|AIU48667.1|  RabGAP/TBC domain-containing protein                  63.9    1e-08   Canna indica [canna]
dbj|BAA98077.1|  unnamed protein product                              63.2    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190524.1|  RabGAP/TBC domain-containing protein             62.8    3e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AIU48678.1|  RabGAP/TBC domain-containing protein                  62.4    3e-08   Setaria italica
ref|XP_004953647.1|  PREDICTED: TBC1 domain family member 15-like     62.4    3e-08   Setaria italica
gb|EEC73873.1|  hypothetical protein OsI_08649                        62.0    4e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_001047892.1|  Os02g0709800                                     62.0    4e-08   
gb|AIU48688.1|  RabGAP/TBC domain-containing protein                  61.6    5e-08   Zea mays [maize]
gb|AIU48642.1|  RabGAP/TBC domain-containing protein                  61.2    7e-08   Lilium brownii [Hong Kong lily]
ref|NP_001168835.1|  uncharacterized protein LOC100382640             61.2    7e-08   Zea mays [maize]
dbj|BAA98076.1|  unnamed protein product                              60.1    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|EMT03185.1|  TBC1 domain family member 15                          60.8    1e-07   
gb|AIU48679.1|  RabGAP/TBC domain-containing protein                  60.8    1e-07   Sorghum bicolor [broomcorn]
ref|XP_002452666.1|  hypothetical protein SORBIDRAFT_04g030250        60.5    1e-07   
gb|EPS58476.1|  hypothetical protein M569_16338                       59.3    2e-07   Genlisea aurea
gb|AIU48646.1|  RabGAP/TBC domain-containing protein                  59.7    2e-07   Brachypodium distachyon [annual false brome]
ref|XP_003570212.1|  PREDICTED: TBC1 domain family member 15          59.3    3e-07   Brachypodium distachyon [annual false brome]
gb|AIU48672.1|  RabGAP/TBC domain-containing protein                  59.3    4e-07   Panicum virgatum
gb|KHG10934.1|  TBC1 domain family member 17                          55.8    5e-07   Gossypium arboreum [tree cotton]
ref|XP_006381118.1|  hypothetical protein POPTR_0006s06510g           57.8    6e-07   
dbj|BAK05291.1|  predicted protein                                    58.2    8e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006647781.1|  PREDICTED: TBC1 domain family member 15-like     57.4    1e-06   Oryza brachyantha
gb|KDO80158.1|  hypothetical protein CISIN_1g005652mg                 54.7    9e-06   Citrus sinensis [apfelsine]
ref|XP_010112473.1|  hypothetical protein L484_008961                 53.1    3e-05   
ref|XP_004338737.1|  TBC domain containing protein                    48.5    0.001   Acanthamoeba castellanii str. Neff



>gb|KDP30256.1| hypothetical protein JCGZ_17038 [Jatropha curcas]
Length=687

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 58/69 (84%), Gaps = 2/69 (3%)
 Frame = +3

Query  354  RKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQAL  527
            RKH+H EE AT V P  LIN+ +FD ++LVWGKPRQP +G +EWATFLDSEGRVM+ +AL
Sbjct  319  RKHEHGEEAATNVGPFQLINFKEFDKLTLVWGKPRQPPLGSEEWATFLDSEGRVMDSKAL  378

Query  528  RKRIFYGGL  554
            RKRIFYGG+
Sbjct  379  RKRIFYGGV  387



>ref|XP_007013520.1| RabGAP/TBC domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY31139.1| RabGAP/TBC domain-containing protein isoform 1 [Theobroma cacao]
Length=743

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 2/73 (3%)
 Frame = +3

Query  342  KSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            K+ +RKH+HD+E AT V    LI++ +FD +SLVWGKPRQP +G +EWATFLDSEGRV++
Sbjct  334  KAPYRKHNHDDEAATNVGTFELIDFKEFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVD  393

Query  516  PQALRKRIFYGGL  554
             +ALRKRIFYGG+
Sbjct  394  SKALRKRIFYGGI  406


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS QQGSASM R +  K S+S++ +   I  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASQQQGSASMMRCDRGKRSSSSEPEGAEIVYLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGSSLF  78



>gb|KJB27075.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=544

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +G +EW TFLDSEGRV
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPLGLEEWVTFLDSEGRV  370

Query  510  MNPQALRKRIFYGGL  554
            ++ +ALRKRIFYGG+
Sbjct  371  VDSKALRKRIFYGGI  385


 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>gb|KJB27076.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=626

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +G +EW TFLDSEGRV
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPLGLEEWVTFLDSEGRV  370

Query  510  MNPQALRKRIFYGGL  554
            ++ +ALRKRIFYGG+
Sbjct  371  VDSKALRKRIFYGGI  385


 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>emb|CDP10442.1| unnamed protein product [Coffea canephora]
Length=692

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            L K+S R  + DEE AT V    L+N  + D +SLVWGKPRQP +GP+EWATFLDSEGRV
Sbjct  313  LEKTSHRNENRDEEAATNVGVFELVNCKELDKLSLVWGKPRQPPLGPEEWATFLDSEGRV  372

Query  510  MNPQALRKRIFYGGL  554
            M+ +AL+KRIFYGG+
Sbjct  373  MDEKALKKRIFYGGV  387


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS+QQGS+S  RS+  + S+S ++D   I  L D V ++P Q+A
Sbjct  1    MHETEVNDLSDDADYAASMQQGSSSFARSDSGRRSSSGETDGAEIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I  +L+ I QG  + 
Sbjct  61   SERIRGRLKLIKQGTALF  78



>gb|KJB27077.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=639

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +G +EW TFLDSEGRV
Sbjct  267  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPLGLEEWVTFLDSEGRV  326

Query  510  MNPQALRKRIFYGGL  554
            ++ +ALRKRIFYGG+
Sbjct  327  VDSKALRKRIFYGGI  341


 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>gb|KJB27079.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=683

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LINY +FD +SLVWGKPRQP +G +EW TFLDSEGRV
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELINYKEFDKLSLVWGKPRQPPLGLEEWVTFLDSEGRV  370

Query  510  MNPQALRKRIFYGGL  554
            ++ +ALRKRIFYGG+
Sbjct  371  VDSKALRKRIFYGGI  385


 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>ref|XP_010241555.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Nelumbo nucifera]
Length=700

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            L K   +K +H EE ATKV    L+N  +FD ++LVWGKPRQP +GP+EW TFLDSEGRV
Sbjct  328  LEKIPCKKQNHGEEAATKVGTFELVNCKEFDKLALVWGKPRQPPLGPEEWTTFLDSEGRV  387

Query  510  MNPQALRKRIFYGGL  554
            M+ +AL+KRIFYGG+
Sbjct  388  MDSKALKKRIFYGGI  402


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  90   ADPEAMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVN  269
            ++   M   E  D SD+  YAAS QQGS S++++     +  N++D   +    D V ++
Sbjct  2    SESSTMQEGESHDLSDDADYAASQQQGSTSISQNGSGGRTVMNEADRAQVVYQKDNVTIH  61

Query  270  PMQYASDWINNQLRQINQGKPIL  338
            P QYAS+ I+ +LR I QG  + 
Sbjct  62   PTQYASERISGRLRLIKQGSSLF  84



>ref|XP_010241554.1| PREDICTED: TBC1 domain family member 17 isoform X1 [Nelumbo nucifera]
Length=707

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 56/69 (81%), Gaps = 2/69 (3%)
 Frame = +3

Query  354  RKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQAL  527
            +K +H EE ATKV    L+N  +FD ++LVWGKPRQP +GP+EW TFLDSEGRVM+ +AL
Sbjct  341  KKQNHGEEAATKVGTFELVNCKEFDKLALVWGKPRQPPLGPEEWTTFLDSEGRVMDSKAL  400

Query  528  RKRIFYGGL  554
            +KRIFYGG+
Sbjct  401  KKRIFYGGI  409


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  90   ADPEAMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVN  269
            ++   M   E  D SD+  YAAS QQGS S++++     +  N++D   +    D V ++
Sbjct  2    SESSTMQEGESHDLSDDADYAASQQQGSTSISQNGSGGRTVMNEADRAQVVYQKDNVTIH  61

Query  270  PMQYASDWINNQLRQINQGKPIL  338
            P QYAS+ I+ +LR I QG  + 
Sbjct  62   PTQYASERISGRLRLIKQGSSLF  84



>gb|KHG01737.1| TBC1 domain family member 15 [Gossypium arboreum]
Length=683

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 59/75 (79%), Gaps = 2/75 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K  +R+H+ D E AT V    LI+Y +FD +SLVWGKPRQP +G +EWATFLDSEGRV
Sbjct  311  VEKVPYREHNRDGEAATNVGTFELISYKEFDKLSLVWGKPRQPPLGLEEWATFLDSEGRV  370

Query  510  MNPQALRKRIFYGGL  554
            ++ +ALRKRIFYGG+
Sbjct  371  VDSKALRKRIFYGGI  385


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS Q+GSASM R +  K STS++++   I  L D VA++P QYA
Sbjct  1    MQEAELHDLSDDADYAASQQEGSASMMRCDSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
             + I+ +L+ I QG  + 
Sbjct  61   FERISGRLKLIKQGSALF  78



>ref|XP_010656459.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Vitis vinifera]
 emb|CBI28236.3| unnamed protein product [Vitis vinifera]
Length=684

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 57/75 (76%), Gaps = 2/75 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            L K+  RK  HDEE  T V    LI+  +FD ++LVWGKPRQP +G +EWATFLDSEGR+
Sbjct  312  LEKTRCRKQYHDEEAVTNVGTFELIDCKEFDKLALVWGKPRQPPLGSEEWATFLDSEGRI  371

Query  510  MNPQALRKRIFYGGL  554
            M+ +ALRKRIFYGG+
Sbjct  372  MDSKALRKRIFYGGI  386



>ref|XP_010112474.1| TBC1 domain family member 15 [Morus notabilis]
 gb|EXC33718.1| TBC1 domain family member 15 [Morus notabilis]
Length=517

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 60/90 (67%), Gaps = 2/90 (2%)
 Frame = +3

Query  291  WINNQLRQINQGKPILTKSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSM  464
            +   +L+        L K S  KH+  EE AT V    LIN  +FD ++LVWGKPRQP +
Sbjct  55   YFRQELKHWELVSYTLPKFSCMKHNIGEEAATGVGNFELINLEEFDKLALVWGKPRQPPL  114

Query  465  GPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            GP+EW T LDSEGRV +P+ALRKRIFYGG+
Sbjct  115  GPEEWVTLLDSEGRVTDPEALRKRIFYGGV  144



>gb|KDO80156.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=685

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 2/75 (3%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQP--LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRV  509
            + K S RKH HDEE  T V    LI+  +FD ++LVWGKPRQP +G +EW TFLD+EGRV
Sbjct  312  VEKISSRKHIHDEEAVTNVGTFELIDCKEFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRV  371

Query  510  MNPQALRKRIFYGGL  554
            M+  ALRKRIFYGG+
Sbjct  372  MDSNALRKRIFYGGV  386



>ref|XP_010656458.1| PREDICTED: GTPase-activating protein GYP7 isoform X1 [Vitis vinifera]
Length=696

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +3

Query  342  KSSFRKHDHDEEPATKVQ--PLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            K+  RK  HDEE  T V    LI+  +FD ++LVWGKPRQP +G +EWATFLDSEGR+M+
Sbjct  326  KTRCRKQYHDEEAVTNVGTFELIDCKEFDKLALVWGKPRQPPLGSEEWATFLDSEGRIMD  385

Query  516  PQALRKRIFYGGL  554
             +ALRKRIFYGG+
Sbjct  386  SKALRKRIFYGGI  398



>ref|XP_009593350.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Nicotiana 
tomentosiformis]
Length=626

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 4/73 (5%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  308  LEKRSSEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  363

Query  516  PQALRKRIFYGGL  554
             QALRKRIFYGG+
Sbjct  364  SQALRKRIFYGGV  376



>ref|XP_009593351.1| PREDICTED: TBC1 domain family member 15 isoform X3 [Nicotiana 
tomentosiformis]
Length=563

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 4/73 (5%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  195  LEKRSSEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  250

Query  516  PQALRKRIFYGGL  554
             QALRKRIFYGG+
Sbjct  251  SQALRKRIFYGGV  263



>ref|XP_009789609.1| PREDICTED: TBC1 domain family member 17-like isoform X2 [Nicotiana 
sylvestris]
Length=626

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 4/73 (5%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  308  LEKRSNEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  363

Query  516  PQALRKRIFYGGL  554
             QALRKRIFYGG+
Sbjct  364  SQALRKRIFYGGV  376


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            ++ D SD+  YAAS+ QGS SMT S   K S+S++   V I  L D VA++P Q+A + I
Sbjct  5    DLHDLSDDADYAASMHQGSTSMTTSGGSKPSSSSEQVGVEIVYLKDNVAIHPTQHAWERI  64

Query  297  NNQLRQINQGKPIL  338
              +L+ I QG  +L
Sbjct  65   RGRLKLIKQGSSLL  78



>ref|XP_009789610.1| PREDICTED: TBC1 domain family member 15-like isoform X3 [Nicotiana 
sylvestris]
Length=563

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 4/73 (5%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  195  LEKRSNEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  250

Query  516  PQALRKRIFYGGL  554
             QALRKRIFYGG+
Sbjct  251  SQALRKRIFYGGV  263



>ref|XP_009593349.1| PREDICTED: TBC1 domain family member 17 isoform X1 [Nicotiana 
tomentosiformis]
Length=676

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 4/73 (5%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  308  LEKRSSEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  363

Query  516  PQALRKRIFYGGL  554
             QALRKRIFYGG+
Sbjct  364  SQALRKRIFYGGV  376



>ref|XP_009789608.1| PREDICTED: TBC1 domain family member 17-like isoform X1 [Nicotiana 
sylvestris]
Length=676

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 55/73 (75%), Gaps = 4/73 (5%)
 Frame = +3

Query  336  LTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMN  515
            L K S  KH H+EE A + +      ++D +SLVWGKPRQP +G +EW+TFLDSEGR+++
Sbjct  308  LEKRSNEKHSHNEEAALRDETF----EYDKLSLVWGKPRQPPLGSKEWSTFLDSEGRIID  363

Query  516  PQALRKRIFYGGL  554
             QALRKRIFYGG+
Sbjct  364  SQALRKRIFYGGV  376


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            ++ D SD+  YAAS+ QGS SMT S   K S+S++   V I  L D VA++P Q+A + I
Sbjct  5    DLHDLSDDADYAASMHQGSTSMTTSGGSKPSSSSEQVGVEIVYLKDNVAIHPTQHAWERI  64

Query  297  NNQLRQINQGKPIL  338
              +L+ I QG  +L
Sbjct  65   RGRLKLIKQGSSLL  78



>ref|XP_010323291.1| PREDICTED: GTPase-activating protein gyp7 [Solanum lycopersicum]
Length=678

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 57/71 (80%), Gaps = 2/71 (3%)
 Frame = +3

Query  342  KSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQ  521
            +SS  KH+ +EE A + + L  Y+ +D +SLVWGKPRQP +G +EW+TFLDSEGR+++ Q
Sbjct  310  ESSCEKHNKNEEAAMRDENL-EYD-YDKLSLVWGKPRQPPLGSEEWSTFLDSEGRIVDSQ  367

Query  522  ALRKRIFYGGL  554
            ALRKRIFYGG+
Sbjct  368  ALRKRIFYGGV  378



>ref|XP_007155039.1| hypothetical protein PHAVU_003G167800g [Phaseolus vulgaris]
 gb|ESW27033.1| hypothetical protein PHAVU_003G167800g [Phaseolus vulgaris]
Length=652

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 79/140 (56%), Gaps = 10/140 (7%)
 Frame = +3

Query  159  IQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLR--QIN----  320
            +  GS+S+T  + R     + + D+ I  L     V   ++A +  +   R  QIN    
Sbjct  217  VNNGSSSVTHFHGRPRQKVDPARDISIQVLEKFSLVT--KFARETTSQLFRENQINGFSE  274

Query  321  QGKPILTKSSF-RKHDHDEEPATKVQPL-INYNKFDNVSLVWGKPRQPSMGPQEWATFLD  494
            +  PI T     R+  H EE  +    L ++  +FDN+SLVWGKPRQP +G +EW  FLD
Sbjct  275  RRTPIQTNIDHPRRSSHVEEKTSDESCLALDSQEFDNLSLVWGKPRQPPLGSEEWIIFLD  334

Query  495  SEGRVMNPQALRKRIFYGGL  554
            SEGRV + +ALRKR+FYGGL
Sbjct  335  SEGRVTDSEALRKRVFYGGL  354



>gb|AIU48651.1| RabGAP/TBC domain-containing protein, partial [Gossypium raimondii]
Length=624

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 56/82 (68%), Gaps = 4/82 (5%)
 Frame = +3

Query  309  RQINQGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATF  488
            R  NQ     +KSS  K D   +      PL    +FD +SLVWGKPRQP +G +EWATF
Sbjct  255  RNSNQSALDYSKSSEYKEDVPVQSPVDPDPL----EFDKLSLVWGKPRQPPLGLEEWATF  310

Query  489  LDSEGRVMNPQALRKRIFYGGL  554
            LDSEGRV++P+ALRKRIFYGG+
Sbjct  311  LDSEGRVVDPKALRKRIFYGGV  332



>gb|AIU48673.1| RabGAP/TBC domain-containing protein, partial [Phaseolus vulgaris]
Length=623

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 77/137 (56%), Gaps = 10/137 (7%)
 Frame = +3

Query  159  IQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQIN----QG  326
            +  GS+S+T  + R     + + D+ I  L     V   ++A +  +   R+ N    + 
Sbjct  200  VNNGSSSVTHFHGRPRQKVDPARDISIQVLEKFSLVT--KFARETTSQLFRENNGFSERR  257

Query  327  KPILTKSSFRKHDHDEEPATKVQPL-INYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEG  503
             PI T     +  H EE  +    L ++  +FDN+SLVWGKPRQP +G +EW  FLDSEG
Sbjct  258  TPIQTHP---RRSHVEEKTSDESCLALDSQEFDNLSLVWGKPRQPPLGSEEWIIFLDSEG  314

Query  504  RVMNPQALRKRIFYGGL  554
            RV + +ALRKR+FYGGL
Sbjct  315  RVTDSEALRKRVFYGGL  331



>ref|XP_006358298.1| PREDICTED: GTPase-activating protein gyp7-like [Solanum tuberosum]
Length=678

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = +3

Query  342  KSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQ  521
            +SS   H+ +EE A + + L  Y+ +D +SLVWGKPRQP +G +EW+TFLDSEGRV++ Q
Sbjct  310  ESSCEIHNKNEEAAMRDESL-EYD-YDKLSLVWGKPRQPPLGSKEWSTFLDSEGRVIDSQ  367

Query  522  ALRKRIFYGGL  554
            ALRKRIFYGG+
Sbjct  368  ALRKRIFYGGV  378



>gb|KJB64720.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=527

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQP +G +EWATFLDSEGRV++P+ALRKRIFYGG+
Sbjct  308  EFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDPKALRKRIFYGGV  354


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS QQGS S+ R +  K S+S++ +   I  L D V ++P Q+A
Sbjct  1    MQEAELHDLSDDADYAASQQQGSPSIMRCDSGKKSSSSEPEGAQIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSSLF  78



>gb|AIU48656.1| RabGAP/TBC domain-containing protein, partial [Glycine max]
Length=625

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 59/89 (66%), Gaps = 8/89 (9%)
 Frame = +3

Query  297  NNQLRQINQGKPILT---KSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMG  467
            NN    I++   I T   KS+  ++  DE P       ++  +FDN+SLVWGKPRQP +G
Sbjct  250  NNGFSPIDRRTHIQTHPKKSNVEENTSDESPVA-----LDSQEFDNLSLVWGKPRQPPLG  304

Query  468  PQEWATFLDSEGRVMNPQALRKRIFYGGL  554
             +EW TF+DSEGRV + +ALRKR+FYGGL
Sbjct  305  SEEWITFMDSEGRVTDSEALRKRVFYGGL  333



>gb|AIU48652.1| RabGAP/TBC domain-containing protein, partial [Carica papaya]
Length=628

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +GP+EW TFLDSEGRVM+ +ALRKRIFYGG+
Sbjct  290  EFDKLTLVWGKPRQPPLGPEEWVTFLDSEGRVMDSKALRKRIFYGGI  336



>ref|XP_011084120.1| PREDICTED: TBC1 domain family member 15 [Sesamum indicum]
Length=654

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQP +G +EWATF+D+EGRVM+P+ALRKRIFYGG+
Sbjct  309  EFDKLSLVWGKPRQPPLGKEEWATFMDAEGRVMDPKALRKRIFYGGV  355


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAASIQQGSASMTRS+ R+ S++++ +   +    + VA++P QYAS+ I
Sbjct  5    ELHDLSDDADYAASIQQGSASMTRSDSRRLSSTSEPEGAEVVYSKENVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGNSLF  78



>gb|KJB64721.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=550

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQP +G +EWATFLDSEGRV++P+ALRKRIFYGG+
Sbjct  308  EFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDPKALRKRIFYGGV  354


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS QQGS S+ R +  K S+S++ +   I  L D V ++P Q+A
Sbjct  1    MQEAELHDLSDDADYAASQQQGSPSIMRCDSGKKSSSSEPEGAQIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSSLF  78



>gb|KJB64719.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=653

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQP +G +EWATFLDSEGRV++P+ALRKRIFYGG+
Sbjct  308  EFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDPKALRKRIFYGGV  354


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS QQGS S+ R +  K S+S++ +   I  L D V ++P Q+A
Sbjct  1    MQEAELHDLSDDADYAASQQQGSPSIMRCDSGKKSSSSEPEGAQIVYLKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSSLF  78



>gb|AIU48685.1| RabGAP/TBC domain-containing protein, partial [Platanus x acerifolia]
Length=387

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 2/57 (4%)
 Frame = +3

Query  390  VQPLINYN--KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            V+PL+  +  +FD ++LVWGKPRQP +G +EWA FLDSEGR+M+ +ALRKRIFYGG+
Sbjct  147  VEPLVAADPPEFDKLTLVWGKPRQPPLGSEEWAAFLDSEGRIMDSKALRKRIFYGGV  203



>ref|XP_004508469.1| PREDICTED: TBC1 domain family member 17-like isoform X2 [Cicer 
arietinum]
Length=518

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQP +G +EW TFLDSEGRV N +ALRKRIFYGGL
Sbjct  360  EFDELSLVWGKPRQPPLGSEEWITFLDSEGRVTNSEALRKRIFYGGL  406



>gb|ACU19099.1| unknown [Glycine max]
Length=311

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query  300  NQLRQINQGKPILTKSSFRKHDHDEEPATKVQPLI-NYNKFDNVSLVWGKPRQPSMGPQE  476
            N    I++   I T     K  + EE  +   P++ +  +FDN+SLVWGKPRQP +G +E
Sbjct  85   NGFSPIDRRTHIQTNLDHPKSSNVEENTSVESPVVLDSQEFDNLSLVWGKPRQPPLGSEE  144

Query  477  WATFLDSEGRVMNPQALRKRIFYGGL  554
            W  FLDSEGRV + +ALRKR+FYGGL
Sbjct  145  WNAFLDSEGRVTDSEALRKRVFYGGL  170



>ref|XP_010241556.1| PREDICTED: TBC1 domain family member 15 isoform X3 [Nelumbo nucifera]
Length=673

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +GP+EW TFLDSEGRVM+ +AL+KRIFYGG+
Sbjct  329  EFDKLALVWGKPRQPPLGPEEWTTFLDSEGRVMDSKALKKRIFYGGI  375


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +3

Query  90   ADPEAMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVN  269
            ++   M   E  D SD+  YAAS QQGS S++++     +  N++D   +    D V ++
Sbjct  2    SESSTMQEGESHDLSDDADYAASQQQGSTSISQNGSGGRTVMNEADRAQVVYQKDNVTIH  61

Query  270  PMQYASDWINNQLRQINQGKPIL  338
            P QYAS+ I+ +LR I QG  + 
Sbjct  62   PTQYASERISGRLRLIKQGSSLF  84



>ref|XP_007013521.1| RabGAP/TBC domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY31140.1| RabGAP/TBC domain-containing protein isoform 2 [Theobroma cacao]
Length=656

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRK  533
             K D DEE   K     +  +FD +SLVWGKPRQP +G +EWATFLDSEGRV++ +ALRK
Sbjct  292  HKVDEDEELPVKSPVAPDPLEFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDSKALRK  351

Query  534  RIFYGGL  554
            RIFYGG+
Sbjct  352  RIFYGGI  358


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS QQGSASM R +  K S+S++ +   I  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASQQQGSASMMRCDRGKRSSSSEPEGAEIVYLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGSSLF  78



>ref|XP_003542634.1| PREDICTED: TBC1 domain family member 15-like [Glycine max]
Length=656

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPL-INYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            +K  + EE  +   P+ ++  +FDN+SLVWGKPRQP +G +EW TF+DSEGRV + +ALR
Sbjct  289  KKSSNVEENTSDESPVALDSQEFDNLSLVWGKPRQPPLGSEEWITFMDSEGRVTDSEALR  348

Query  531  KRIFYGGL  554
            KR+FYGGL
Sbjct  349  KRVFYGGL  356


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 3/78 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSAS-MTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            ML  E+ D SD+  YAAS QQGSAS M RS+  K S+  +  +  I  L D VA++P Q+
Sbjct  1    MLESELHDLSDDADYAASQQQGSASVMLRSDSAKQSSPREGAE--IVFLKDNVAIHPTQF  58

Query  282  ASDWINNQLRQINQGKPI  335
            AS+ I+ +L+ I Q   +
Sbjct  59   ASERISGRLKLIKQSSSL  76



>gb|KHN22122.1| TBC1 domain family member 15 [Glycine soja]
Length=656

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 1/68 (1%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPL-INYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            +K  + EE  +   P+ ++  +FDN+SLVWGKPRQP +G +EW TF+DSEGRV + +ALR
Sbjct  289  KKSSNVEENTSDESPVALDSQEFDNLSLVWGKPRQPPLGSEEWITFMDSEGRVTDSEALR  348

Query  531  KRIFYGGL  554
            KR+FYGGL
Sbjct  349  KRVFYGGL  356


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 3/78 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSAS-MTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            ML  E+ D SD+  YAAS QQGSAS M RS+  K S+  +  +  I  L D VA++P Q+
Sbjct  1    MLESELHDLSDDADYAASQQQGSASVMLRSDSAKQSSPREGAE--IVFLKDNVAIHPTQF  58

Query  282  ASDWINNQLRQINQGKPI  335
            AS+ I+ +L+ I Q   +
Sbjct  59   ASERISGRLKLIKQSSSL  76



>gb|AIU48660.1| RabGAP/TBC domain-containing protein, partial [Chloranthus japonicus]
Length=627

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 60/91 (66%), Gaps = 6/91 (7%)
 Frame = +3

Query  285  SDWINNQLRQINQGKPILTKSSFRKHD-HDEEPATKVQPLINYNKFDNVSLVWGKPRQPS  461
            SD+   Q +   Q  P+ T +S       DE PAT   P+    +FD ++LVWGKPRQP 
Sbjct  250  SDFSAYQGKHQIQSDPVCTGNSNDSQKVSDEIPATS-DPV----EFDKLTLVWGKPRQPP  304

Query  462  MGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            MG +EWATFLD+EGR+M+ + LRKRIFYGG+
Sbjct  305  MGFEEWATFLDAEGRIMDSKGLRKRIFYGGV  335



>ref|XP_004508468.1| PREDICTED: TBC1 domain family member 17-like isoform X1 [Cicer 
arietinum]
Length=705

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQP +G +EW TFLDSEGRV N +ALRKRIFYGGL
Sbjct  360  EFDELSLVWGKPRQPPLGSEEWITFLDSEGRVTNSEALRKRIFYGGL  406



>gb|AIU48649.1| RabGAP/TBC domain-containing protein, partial [Sarcandra glabra]
Length=355

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 5/62 (8%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DE PAT   P+    +FD ++LVWGKPRQP +G +EW+TFLD+EGR+M+ +ALRKRIFYG
Sbjct  7    DEIPATS-DPV----EFDKLTLVWGKPRQPPLGFEEWSTFLDAEGRIMDSKALRKRIFYG  61

Query  549  GL  554
            G+
Sbjct  62   GV  63



>ref|XP_002285365.1| PREDICTED: TBC1 domain family member 17 isoform X3 [Vitis vinifera]
Length=657

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EWATFLDSEGR+M+ +ALRKRIFYGG+
Sbjct  313  EFDKLALVWGKPRQPPLGSEEWATFLDSEGRIMDSKALRKRIFYGGI  359



>gb|AIU48681.1| RabGAP/TBC domain-containing protein, partial [Vitis vinifera]
Length=629

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EWATFLDSEGR+M+ +ALRKRIFYGG+
Sbjct  291  EFDKLALVWGKPRQPPLGSEEWATFLDSEGRIMDSKALRKRIFYGGI  337



>gb|AIU48647.1| RabGAP/TBC domain-containing protein, partial [Theobroma cacao]
Length=603

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQP +G +EWATFLDSEGRV++ +ALRKRIFYGG+
Sbjct  265  EFDKLSLVWGKPRQPPLGLEEWATFLDSEGRVVDSKALRKRIFYGGI  311



>gb|AIU48643.1| RabGAP/TBC domain-containing protein, partial [Magnolia denudata]
Length=622

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQP +G +EWATF DSEGR+M+ +ALRKRIFYGG+
Sbjct  290  EFDKLSLVWGKPRQPPLGLEEWATFFDSEGRIMDSKALRKRIFYGGV  336



>gb|KDO80165.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=356

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +3

Query  402  INYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +++ +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+
Sbjct  7    VSFWQFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGV  57



>ref|XP_011020167.1| PREDICTED: TBC1 domain family member 15 [Populus euphratica]
Length=660

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EWATFLDSEGRVM+ +AL+KRIFYGG+
Sbjct  314  EFDKMTLVWGKPRQPPLGSEEWATFLDSEGRVMDSKALKKRIFYGGV  360


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            E+ D SD+  YAAS+QQGSASM  TRS+  + ++S+  +   I  L D V ++P QYAS+
Sbjct  5    ELHDLSDDADYAASLQQGSASMMITRSDSGRSTSSSVPEGAEIVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSSLF  80



>gb|AIU48684.1| RabGAP/TBC domain-containing protein, partial [Cinnamomum camphora]
Length=561

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQP +G +EWATFLD+EGR+M+ +ALRKRIFYGG+
Sbjct  223  EFDKLSLVWGKPRQPPLGFEEWATFLDAEGRIMDSKALRKRIFYGGV  269



>ref|XP_003549744.1| PREDICTED: TBC1 domain family member 15-like [Glycine max]
 gb|KHN15067.1| TBC1 domain family member 15 [Glycine soja]
Length=655

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 1/87 (1%)
 Frame = +3

Query  297  NNQLRQINQGKPILTKSSFRKHDHDEEPATKVQPLI-NYNKFDNVSLVWGKPRQPSMGPQ  473
            +N    I++   I T     K  + EE  +   P++ +  +FDN+SLVWGKPRQP +G +
Sbjct  269  SNGFSPIDRRTHIQTNLDHPKSSNVEENTSVESPVVLDSQEFDNLSLVWGKPRQPPLGSE  328

Query  474  EWATFLDSEGRVMNPQALRKRIFYGGL  554
            EW  FLDSEGRV + +ALRKR+FYGGL
Sbjct  329  EWNAFLDSEGRVTDSEALRKRVFYGGL  355


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSAS-MTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            ML  E+ D SD+  YAAS QQGSAS M RS+  K S+     ++  +   D VA++P Q+
Sbjct  1    MLESELHDLSDDADYAASQQQGSASVMLRSDSAKQSSPRNGAEIVFS--KDNVAIHPTQF  58

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+ I Q   + 
Sbjct  59   ASERISGRLKLIKQSSSLF  77



>gb|KDO80163.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=473

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGV  359



>gb|KJB27078.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=656

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQP +G +EW TFLDSEGRV++ +ALRKRIFYGG+
Sbjct  312  EFDKLSLVWGKPRQPPLGLEEWVTFLDSEGRVVDSKALRKRIFYGGI  358


 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  E+ D SD+  YAAS Q+GSASM R    K STS++++   I  L D VA++P QYA
Sbjct  1    MLEAELHDLSDDADYAASQQEGSASMMRCYSSKLSTSSETEGAEIVYLKDNVAIHPTQYA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  + 
Sbjct  61   SERISGRLKLIKQGSTLF  78



>gb|AIU48668.1| RabGAP/TBC domain-containing protein, partial [Manihot esculenta]
Length=627

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EWATFLD EGRVM+ +ALRKRIFYGG+
Sbjct  289  EFDKLTLVWGKPRQPPLGSEEWATFLDPEGRVMDSKALRKRIFYGGV  335



>gb|EYU18249.1| hypothetical protein MIMGU_mgv1a002604mg [Erythranthe guttata]
Length=655

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQ  +G QEWATFLD+EGRVM+ +AL KRIFYGGL
Sbjct  310  EFDKISLVWGKPRQSPLGQQEWATFLDAEGRVMDSKALIKRIFYGGL  356


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAASIQQGSAS++++  R+ STSN+ D   I    D V ++P QYAS+ I
Sbjct  5    ELHDLSDDADYAASIQQGSASISQNESRRQSTSNEPDGAEIVYTKDNVTIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGNALF  78



>gb|AIU48669.1| RabGAP/TBC domain-containing protein, partial [Erythranthe guttata]
Length=624

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQ  +G QEWATFLD+EGRVM+ +AL KRIFYGGL
Sbjct  286  EFDKISLVWGKPRQSPLGQQEWATFLDAEGRVMDSKALIKRIFYGGL  332



>gb|KDO80162.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=522

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGV  359



>gb|AIU48675.1| RabGAP/TBC domain-containing protein, partial [Ricinus communis]
Length=610

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 81/143 (57%), Gaps = 12/143 (8%)
 Frame = +3

Query  153  ASIQQGSASMTRSNIRKWSTSNK-SDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGK  329
             +I +GS+S+ + + R+    N  + D+ I  L     V   ++A +   +QL   N G 
Sbjct  179  GNIHRGSSSIPQHDGRQRHKGNDPARDLSIQVLEKFSLVT--KFARE-TTSQLFWENNGF  235

Query  330  PILTKSSFRKHDHD------EEPATKVQPLINYN--KFDNVSLVWGKPRQPSMGPQEWAT  485
              + + S+ +   D      +     +Q  +  +  +FD ++LVWGKPRQP +G +EWAT
Sbjct  236  DAIERKSYNQSSLDCPKTPKDTEEVSIQSAVPSDPLEFDKLTLVWGKPRQPPLGFEEWAT  295

Query  486  FLDSEGRVMNPQALRKRIFYGGL  554
            FLDSEGRV + +ALRKRIFYGG+
Sbjct  296  FLDSEGRVTDSKALRKRIFYGGV  318



>gb|KDO80164.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=496

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+
Sbjct  151  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGV  197



>ref|XP_003609386.1| TBC1 domain family member [Medicago truncatula]
 gb|AES91583.1| RabGAP/TBC domain protein [Medicago truncatula]
Length=666

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FDN+SLVWGKPRQ  +G +EW TF+DSEGRV++ +ALRKRIFYGGL
Sbjct  321  EFDNLSLVWGKPRQSPLGSKEWITFVDSEGRVIDSEALRKRIFYGGL  367



>gb|KDO80161.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=553

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGV  359



>ref|XP_004159423.1| PREDICTED: TBC1 domain family member 15-like [Cucumis sativus]
Length=485

 Score = 81.6 bits (200),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EWATFLD+EGRV++  +LRKRIFYGG+
Sbjct  314  QFDKLTLVWGKPRQPPLGSEEWATFLDAEGRVLDSTSLRKRIFYGGV  360


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  ++ D SD+  YAAS QQGS +M R++  + S+S++ +   +    + V ++P Q+A
Sbjct  1    MLETDLHDLSDDADYAASQQQGSTTMMRTDSGRGSSSSEHEGAEVVYSKENVTIHPTQFA  60

Query  285  SDWINNQLRQINQG  326
            S+ I+ +LR I QG
Sbjct  61   SERISGRLRLIKQG  74



>ref|XP_002527173.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35186.1| conserved hypothetical protein [Ricinus communis]
Length=645

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EWATFLDSEGRV + +ALRKRIFYGG+
Sbjct  299  EFDKLTLVWGKPRQPPLGFEEWATFLDSEGRVTDSKALRKRIFYGGV  345



>gb|AIU48666.1| RabGAP/TBC domain-containing protein, partial [Medicago truncatula]
Length=626

 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FDN+SLVWGKPRQ  +G +EW TF+DSEGRV++ +ALRKRIFYGGL
Sbjct  288  EFDNLSLVWGKPRQSPLGSKEWITFVDSEGRVIDSEALRKRIFYGGL  334



>gb|KDO80160.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=553

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGV  359



>gb|AIU48658.1| RabGAP/TBC domain-containing protein, partial [Buxus sinica]
Length=629

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 47/61 (77%), Gaps = 4/61 (7%)
 Frame = +3

Query  372  EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            EE      PL    +FD ++LVWGKPRQP +G +EWATFLDSEGR+++ +AL+KR+FYGG
Sbjct  281  EEIQVAADPL----EFDKLALVWGKPRQPPLGSEEWATFLDSEGRIVDSKALKKRVFYGG  336

Query  552  L  554
            +
Sbjct  337  V  337



>ref|XP_006475896.1| PREDICTED: TBC1 domain family member 17-like [Citrus sinensis]
 gb|KDO80157.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=658

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGV  359



>gb|KDO80159.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=630

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+
Sbjct  285  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGV  331



>gb|AIU48650.1| RabGAP/TBC domain-containing protein, partial [Citrus clementina]
Length=629

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+
Sbjct  291  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGV  337



>ref|XP_006450870.1| hypothetical protein CICLE_v10007683mg [Citrus clementina]
 gb|ESR64110.1| hypothetical protein CICLE_v10007683mg [Citrus clementina]
Length=658

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+
Sbjct  313  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGV  359



>gb|AIU48654.1| RabGAP/TBC domain-containing protein, partial [Citrus sinensis]
Length=629

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW TFLD+EGRVM+  ALRKRIFYGG+
Sbjct  291  EFDKLTLVWGKPRQPPLGSEEWTTFLDNEGRVMDSNALRKRIFYGGV  337



>gb|AIU48639.1| RabGAP/TBC domain-containing protein, partial [Aquilegia coerulea]
Length=625

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWG+PRQP +G +EWATFLD+EGR+++ ++LRKRIFYGGL
Sbjct  287  EFDKLTLVWGQPRQPPLGSEEWATFLDAEGRILDSKSLRKRIFYGGL  333



>ref|XP_008456989.1| PREDICTED: TBC1 domain family member 15 [Cucumis melo]
Length=655

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EWATFLD+EGRV++  +LRKRIFYGG+
Sbjct  311  QFDKLTLVWGKPRQPPLGSEEWATFLDAEGRVLDSTSLRKRIFYGGV  357


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  ++ D SD+  YAAS QQGS +M R++  + STS++ +   +    + V ++P Q+A
Sbjct  1    MLETDLHDLSDDADYAASQQQGSTTMMRTDSGRGSTSSELEGAEVVYSKENVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +LR I QG  + 
Sbjct  61   SERISGRLRLIKQGSCLF  78



>ref|XP_004139297.1| PREDICTED: TBC1 domain family member 15-like [Cucumis sativus]
 gb|KGN60701.1| hypothetical protein Csa_2G007450 [Cucumis sativus]
Length=655

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EWATFLD+EGRV++  +LRKRIFYGG+
Sbjct  311  QFDKLTLVWGKPRQPPLGSEEWATFLDAEGRVLDSTSLRKRIFYGGV  357


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            ML  ++ D SD+  YAAS QQGS +M R++  + S+S++ +   +    + V ++P Q+A
Sbjct  1    MLETDLHDLSDDADYAASQQQGSTTMMRTDSGRGSSSSEHEGAEVVYSKENVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +LR I QG  + 
Sbjct  61   SERISGRLRLIKQGSCLF  78



>ref|XP_006345222.1| PREDICTED: TBC1 domain family member 15-like [Solanum tuberosum]
Length=656

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQP +G +EW+ FLDSEGRV + +ALRKRIFYGG+
Sbjct  310  EFDKLSLVWGKPRQPPLGTEEWSAFLDSEGRVTDSEALRKRIFYGGV  356


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            ++ D SD+  YAAS+Q GSASM RSN  K  +S + +   I  + D VA++P QYAS+ I
Sbjct  5    DVHDLSDDADYAASVQHGSASMNRSNSSKQGSSGEQEGAEIVYVKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>gb|AIU48687.1| RabGAP/TBC domain-containing protein, partial [Houttuynia cordata]
Length=622

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 5/72 (7%)
 Frame = +3

Query  339  TKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNP  518
             KS+  + +  E  ATKV       + D +SLVWGKPRQPS+  +EW TFLDSEGR+ +P
Sbjct  264  VKSNEVQKNSTEVSATKVNM-----EVDKLSLVWGKPRQPSLSLEEWETFLDSEGRITDP  318

Query  519  QALRKRIFYGGL  554
             ALRKR+FYGG+
Sbjct  319  SALRKRVFYGGV  330



>gb|AIU48659.1| RabGAP/TBC domain-containing protein, partial [Iris japonica]
Length=629

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  411  NKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
             +FD +SLVWGKPRQP +  +EW TFLDSEGR+M+ +AL KRIFYGGL
Sbjct  290  TEFDKLSLVWGKPRQPPLTHEEWVTFLDSEGRIMDSKALIKRIFYGGL  337



>ref|XP_009758337.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana sylvestris]
Length=649

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQP +G +EW+TFLD EGRV + +A+RKRIFYGG+
Sbjct  303  EFDKLSLVWGKPRQPPLGTEEWSTFLDCEGRVTDSEAVRKRIFYGGV  349


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            +I D SD+  YAASIQQGS+SM RS+  K S+S + +   I  L D VA++P QYAS+ I
Sbjct  5    DIHDLSDDADYAASIQQGSSSMNRSDSSKQSSSGEQEGAEIVYLKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>gb|AIU48671.1| RabGAP/TBC domain-containing protein, partial [Prunus persica]
Length=589

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD VSLVWGKPRQ  +G  EW TFLD EGR+M+ +ALRKRIFYGG+
Sbjct  290  EFDKVSLVWGKPRQAPLGSDEWKTFLDYEGRIMDSEALRKRIFYGGV  336



>ref|XP_007204093.1| hypothetical protein PRUPE_ppa002904mg [Prunus persica]
 gb|EMJ05292.1| hypothetical protein PRUPE_ppa002904mg [Prunus persica]
Length=622

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD VSLVWGKPRQ  +G  EW TFLD EGR+M+ +ALRKRIFYGG+
Sbjct  313  EFDKVSLVWGKPRQAPLGSDEWKTFLDYEGRIMDSEALRKRIFYGGV  359


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS Q GSASM RS+  K S+S++ D   +  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASQQHGSASMMRSDSGKHSSSSEHDGAEVVYLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>ref|XP_008242808.1| PREDICTED: TBC1 domain family member 17 [Prunus mume]
Length=661

 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD VSLVWGKPRQ  +G  EW TFLD EGR+M+ +ALRKRIFYGG+
Sbjct  313  EFDKVSLVWGKPRQAPLGSDEWKTFLDYEGRIMDSEALRKRIFYGGV  359


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS Q GSASM RS+  K S+S++ D   +  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASQQHGSASMMRSDSGKHSSSSEHDGAEVVYLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>gb|KJB54007.1| hypothetical protein B456_009G016100 [Gossypium raimondii]
Length=657

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +3

Query  417  FDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
             D +SL WGKPRQP +G +EWATFLDSEGRV++ +ALRKRIFYGG+
Sbjct  312  LDKLSLAWGKPRQPPLGLEEWATFLDSEGRVVDSKALRKRIFYGGV  357


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   EI D SD+  YAAS QQGSASM R    K S+SN+ +   +  + D V ++P Q+A
Sbjct  1    MQETEIHDLSDDADYAASQQQGSASMMRCESGKRSSSNEPEGAEVVYMKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I Q   + 
Sbjct  61   SERISGRLKLIKQSSSLF  78



>gb|AIU48662.1| RabGAP/TBC domain-containing protein, partial [Chimonanthus praecox]
Length=627

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  405  NYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            N ++FD +SLVWGKPRQP +G +EWATFLD EGR+ +  AL+KRIFYGG+
Sbjct  286  NPSEFDQLSLVWGKPRQPPLGLEEWATFLDVEGRITDSNALKKRIFYGGV  335



>ref|XP_009127224.1| PREDICTED: TBC1 domain family member 15 [Brassica rapa]
Length=672

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRK  533
            ++H +DEE    +    +  +F+ +SLVWGKPRQP MG QE+  FLDSEGRV+  +ALR+
Sbjct  308  KEHLNDEETYNDIDVPADPLEFNKLSLVWGKPRQPPMGSQEFTAFLDSEGRVVESKALRE  367

Query  534  RIFYGGL  554
            R+FYGG+
Sbjct  368  RVFYGGI  374


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M A E+ D SD+  YAAS  QGSASM R +  K S S+  D   +  L D VA++P Q+A
Sbjct  1    MEASELHDLSDDADYAASQLQGSASMMRCDSDKRSRSSDPDAAELIYLKDNVAIHPTQFA  60

Query  285  SDWINNQLRQINQ  323
            S+ I+ +L+   Q
Sbjct  61   SERISGRLKLTKQ  73



>ref|XP_004251725.1| PREDICTED: TBC1 domain family member 17-like [Solanum lycopersicum]
Length=656

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQP +G +EW+ FLD+EGRV + +A+RKRIFYGG+
Sbjct  309  EFDKLSLVWGKPRQPPLGTEEWSAFLDTEGRVTDSEAVRKRIFYGGV  355


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            ++ D SD+  YAAS+QQGSASM RSN  K  +S + +   I  + D VA++P QYAS+ I
Sbjct  5    DVHDLSDDADYAASVQQGSASMNRSNSSKQGSSGEQEGAEIVYVKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>ref|XP_011017820.1| PREDICTED: TBC1 domain family member 17-like isoform X3 [Populus 
euphratica]
Length=637

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW  FLDSEGRV++ +AL+KRIFYGG+
Sbjct  329  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRVIDSKALKKRIFYGGV  375


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQG ASM  TRS++ K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDGDYAASLQQGPASMMMTRSDVGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSYLF  80



>ref|XP_011017816.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Populus 
euphratica]
 ref|XP_011017817.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Populus 
euphratica]
Length=676

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW  FLDSEGRV++ +AL+KRIFYGG+
Sbjct  329  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRVIDSKALKKRIFYGGV  375


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQG ASM  TRS++ K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDGDYAASLQQGPASMMMTRSDVGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSYLF  80



>ref|XP_011017818.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Populus 
euphratica]
Length=661

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW  FLDSEGRV++ +AL+KRIFYGG+
Sbjct  314  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRVIDSKALKKRIFYGGV  360


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQG ASM  TRS++ K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDGDYAASLQQGPASMMMTRSDVGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSYLF  80



>emb|CDY27056.1| BnaA02g10760D [Brassica napus]
Length=672

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRK  533
            ++H +DEE    +    +  +F+ +SLVWGKPRQP MG QE+  FLDSEGRV+  +ALR+
Sbjct  308  KEHLNDEEIYNDIDVPADPLEFNKLSLVWGKPRQPPMGSQEFTAFLDSEGRVVESKALRE  367

Query  534  RIFYGGL  554
            R+FYGG+
Sbjct  368  RVFYGGI  374


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M A E+ D SD+  YAAS  QGSASM R    K S S+  D   +  L D VA++P Q+A
Sbjct  1    MEASELHDLSDDADYAASQLQGSASMMRCESDKRSRSSDPDAAELIYLKDNVAIHPTQFA  60

Query  285  SDWINNQLRQINQ  323
            S+ I+ +L+   Q
Sbjct  61   SERISGRLKLTKQ  73



>ref|XP_010687932.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=656

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +  +EW TFLDSEGRV++ +ALRKRIFYGG+
Sbjct  311  EFDKLALVWGKPRQPPLTKEEWITFLDSEGRVVDSKALRKRIFYGGV  357


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M+  E+ D SD+  YAAS QQGS S+ RS+  + S    ++   +  + D V+++P QY 
Sbjct  1    MIETELHDLSDDADYAASQQQGSQSIMRSDSGRRSEPEGAE---VVYVKDNVSIHPTQYM  57

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  ++
Sbjct  58   SERISGRLKLIKQGDSLI  75



>ref|XP_010687933.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=622

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +  +EW TFLDSEGRV++ +ALRKRIFYGG+
Sbjct  277  EFDKLALVWGKPRQPPLTKEEWITFLDSEGRVVDSKALRKRIFYGGV  323


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M+  E+ D SD+  YAAS QQGS S+ RS+  + S    ++   +  + D V+++P QY 
Sbjct  1    MIETELHDLSDDADYAASQQQGSQSIMRSDSGRRSEPEGAE---VVYVKDNVSIHPTQYM  57

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I QG  ++
Sbjct  58   SERISGRLKLIKQGDSLI  75



>gb|AIU48655.1| RabGAP/TBC domain-containing protein, partial [Eucalyptus grandis]
Length=624

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +S+VWGKPRQ  +G  EWATFLDSEGRV++ +AL+KRIFYGG+
Sbjct  287  EFDKLSMVWGKPRQSPLGSGEWATFLDSEGRVIDSKALKKRIFYGGV  333



>ref|XP_010047970.1| PREDICTED: TBC1 domain family member 15 [Eucalyptus grandis]
 gb|KCW80044.1| hypothetical protein EUGRSUZ_C01375 [Eucalyptus grandis]
Length=654

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +S+VWGKPRQ  +G  EWATFLDSEGRV++ +AL+KRIFYGG+
Sbjct  310  EFDKLSMVWGKPRQSPLGSGEWATFLDSEGRVIDSKALKKRIFYGGV  356


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD+  YAAS +QGS SM RS+  K S+S + +   +  + D V ++P Q+A
Sbjct  1    MHETELHDLSDDADYAASQRQGSVSMQRSDSAKTSSSAEPEGAELVYVKDNVTIHPSQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            ++ I  +L  I QG  +L
Sbjct  61   AERIGGRLMLIKQGACLL  78



>gb|AIU48689.1| RabGAP/TBC domain-containing protein, partial [Alisma plantago-aquatica]
Length=628

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +F+ +SLVWGKPRQ  MG  EWA FLDSEGR+M+P+AL+++IFYGGL
Sbjct  290  EFEKMSLVWGKPRQQPMGFDEWANFLDSEGRIMDPEALKRQIFYGGL  336



>gb|KCW80045.1| hypothetical protein EUGRSUZ_C01375 [Eucalyptus grandis]
Length=527

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +S+VWGKPRQ  +G  EWATFLDSEGRV++ +AL+KRIFYGG+
Sbjct  183  EFDKLSMVWGKPRQSPLGSGEWATFLDSEGRVIDSKALKKRIFYGGV  229



>ref|XP_006372159.1| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
 gb|ERP49956.1| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
Length=630

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW  FLDSEGR+++ +AL+KRIFYGG+
Sbjct  283  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRIIDSKALKKRIFYGGV  329



>ref|XP_009624893.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana tomentosiformis]
Length=649

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQP +G +EW+ FLD EGRV + +A+RKRIFYGG+
Sbjct  303  EFDKLSLVWGKPRQPPLGTEEWSAFLDCEGRVTDSEAVRKRIFYGGV  349


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            +I D SD+  YAASIQQGSASM RS+  K S+S + +   I  L D VA++P QYAS+ I
Sbjct  5    DIHDLSDDADYAASIQQGSASMNRSDSSKQSSSGEQEGAEIVYLKDNVAIHPTQYASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +L+ I QG  + 
Sbjct  65   SGRLKLIKQGGSLF  78



>ref|XP_002324638.2| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
 gb|EEF03203.2| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
Length=661

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW  FLDSEGR+++ +AL+KRIFYGG+
Sbjct  314  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRIIDSKALKKRIFYGGV  360


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            ++ D SD+  YAAS+QQGSASM  TRS+  K ++S+  +   +  L D V ++P QYAS+
Sbjct  5    DLHDLSDDADYAASLQQGSASMMMTRSDSGKSTSSSVPEGAEVVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSSLF  80



>gb|AIU48670.1| RabGAP/TBC domain-containing protein, partial [Populus trichocarpa]
Length=627

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD ++LVWGKPRQP +G +EW  FLDSEGR+++ +AL+KRIFYGG+
Sbjct  289  EFDKMTLVWGKPRQPPLGSEEWEIFLDSEGRIIDSKALKKRIFYGGV  335



>ref|XP_006401806.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
 gb|ESQ43259.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
Length=681

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 72/128 (56%), Gaps = 6/128 (5%)
 Frame = +3

Query  177  SMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGKPILTKSSFR  356
            S+     R+ +T   S++ G   ++ +    P+    + ++N   + +   P     S+ 
Sbjct  260  SLVTKFARETTTQLFSENNGFGSVDKRWNNQPVHNYDEKLSNIAEEKDHEGP----HSYP  315

Query  357  KHDH--DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            + DH  DEE    V    +  +F+ +SLVWGKPRQP MG +E+  FLDSEGRV+  +ALR
Sbjct  316  EKDHLNDEEIPITVDVPADPLEFNKLSLVWGKPRQPPMGSKEFTAFLDSEGRVVESKALR  375

Query  531  KRIFYGGL  554
            +R+FYGG+
Sbjct  376  ERVFYGGI  383


 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS  QGSASM R +  K S S++ +   +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQLQGSASMMRCDSEKRSLSSEHEGAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>gb|AIU48674.1| RabGAP/TBC domain-containing protein, partial [Artemisia annua]
Length=233

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            + D ++LVWGKPRQP +GP+EW TF DSEGRV +  AL++RIFYGG+
Sbjct  16   ELDKLALVWGKPRQPPLGPEEWGTFYDSEGRVEDLNALKERIFYGGV  62



>gb|AIU48680.1| RabGAP/TBC domain-containing protein, partial [Schrenkiella parvula]
Length=628

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  357  KHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKR  536
            KH +DEE    V    +  +F+ +SLVWGKPRQP MG +E+  FLDSEGRV+  +ALR+R
Sbjct  271  KHLNDEEIPITVDVPADPLEFNKLSLVWGKPRQPPMGSKEFTAFLDSEGRVVESKALRER  330

Query  537  IFYGGL  554
            +FYGG+
Sbjct  331  VFYGGI  336



>ref|XP_006401805.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
 gb|ESQ43258.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
Length=675

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 72/128 (56%), Gaps = 6/128 (5%)
 Frame = +3

Query  177  SMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGKPILTKSSFR  356
            S+     R+ +T   S++ G   ++ +    P+    + ++N   + +   P     S+ 
Sbjct  254  SLVTKFARETTTQLFSENNGFGSVDKRWNNQPVHNYDEKLSNIAEEKDHEGP----HSYP  309

Query  357  KHDH--DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            + DH  DEE    V    +  +F+ +SLVWGKPRQP MG +E+  FLDSEGRV+  +ALR
Sbjct  310  EKDHLNDEEIPITVDVPADPLEFNKLSLVWGKPRQPPMGSKEFTAFLDSEGRVVESKALR  369

Query  531  KRIFYGGL  554
            +R+FYGG+
Sbjct  370  ERVFYGGI  377


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS  QGSASM R +  K S S++ +   +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQLQGSASMMRCDSEKRSLSSEHEGAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>ref|XP_006855176.1| hypothetical protein AMTR_s00051p00106780 [Amborella trichopoda]
 gb|ERN16643.1| hypothetical protein AMTR_s00051p00106780 [Amborella trichopoda]
Length=688

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 7/116 (6%)
 Frame = +3

Query  225  DDVGIACLNDKVAVNPM--QYASDWINNQLRQINQ--GKPILTKSSFRKHDHDEEPATKV  392
            D++G      +V  +P+  Q   D ++ +L+  NQ    P L K + R     E  AT V
Sbjct  283  DNIGGYEKQQQVHSSPVKNQVGGDPVSQELQDKNQIISDP-LEKIACRNGKLCEAAATLV  341

Query  393  Q--PLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
                LI+  + +  SLVWGKPR P +G +EWATFLD EGR+++ +ALRKRIFYGG+
Sbjct  342  GTFELIDSKEAEQQSLVWGKPRLPPLGHEEWATFLDEEGRIVDSKALRKRIFYGGV  397



>ref|XP_008354495.1| PREDICTED: GTPase-activating protein gyp7-like [Malus domestica]
Length=398

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 1/68 (1%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLI-NYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            +K  HD   A +  P+  +  +FD  S+VWGKPRQP +G  EW  F DSEGR+++ +A+R
Sbjct  292  QKXSHDSNRAPEKSPVPPDSLEFDKESMVWGKPRQPPLGSDEWEAFFDSEGRIIDSEAIR  351

Query  531  KRIFYGGL  554
            KRIFYGG+
Sbjct  352  KRIFYGGV  359


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS+Q GSASM RS+  K S+S++ D   +  L D VA++P Q+ S+ I
Sbjct  5    ELHDLSDDADYAASLQXGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVAIHPTQFVSERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>ref|XP_008377303.1| PREDICTED: TBC1 domain family member 17 [Malus domestica]
Length=660

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD VS+ WG PRQP +G  EW TF+DSEGR++N +A RKRIFYGG+
Sbjct  314  EFDKVSMEWGNPRQPPLGSDEWETFMDSEGRIVNSEAFRKRIFYGGV  360


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS+Q GSASM RS+  K S+S++ D   +  L D V ++P Q+AS+ I
Sbjct  5    ELHDLSDDADYAASLQHGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVTIHPTQFASERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I  G  + 
Sbjct  65   SGRLRLIKHGSSLF  78



>ref|XP_011469988.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 15-like 
[Fragaria vesca subsp. vesca]
Length=634

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD  SLVWGKPR P +   EW TFLDSEGR+M+ +ALRKRIFYGG+
Sbjct  288  EFDKNSLVWGKPRHPPLETDEWHTFLDSEGRIMDSEALRKRIFYGGV  334



>ref|XP_010557604.1| PREDICTED: TBC1 domain family member 15 [Tarenaya hassleriana]
Length=669

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +3

Query  372  EEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            EE  T V+   +  +F+ +SLVWGKPRQ  +G +EWA FLDSEGRVM+ +ALR R+FYGG
Sbjct  311  EEIPTDVEVPADPLEFNKMSLVWGKPRQSPLGRREWAAFLDSEGRVMDSKALRDRVFYGG  370

Query  552  L  554
            +
Sbjct  371  I  371


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E  D SD+  YAAS QQGSASM R +  K S+ ++ +   I  L D VA++P Q+A
Sbjct  1    MEESEFQDLSDDADYAASQQQGSASMMRCDSGKRSSPSEQEGGEIVYLKDNVAIHPTQFA  60

Query  285  SDWINNQLR  311
            S+ I+ +L+
Sbjct  61   SERISGRLK  69



>gb|AIU48682.1| RabGAP/TBC domain-containing protein, partial [Lactuca sativa]
Length=351

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SLVWGKPRQ  +  +EW++FLD EGR+M+P AL+KRIFYGG+
Sbjct  13   EFDKLSLVWGKPRQHPLEVEEWSSFLDYEGRIMDPDALKKRIFYGGV  59



>emb|CDY65323.1| BnaC02g44880D [Brassica napus]
Length=672

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +3

Query  354  RKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRK  533
            ++H +DEE    +    +  +F+ +SLVWGKPRQ  MG QE+  FLDSEGRV+  +ALR+
Sbjct  308  KEHLNDEEIYNDIDVPADPLEFNKLSLVWGKPRQSPMGSQEFTAFLDSEGRVVESKALRE  367

Query  534  RIFYGGL  554
            R+FYGG+
Sbjct  368  RVFYGGI  374


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M A E+ D SD+  YAAS  QGSASM R +  K S S+  D   +  L D VA++P Q+A
Sbjct  1    MEASELHDLSDDADYAASQLQGSASMMRCDSDKRSRSSDPDAAELIYLKDNVAIHPTQFA  60

Query  285  SDWINNQLRQINQ  323
            S+ I+ +L+   Q
Sbjct  61   SERISGRLKLTKQ  73



>gb|AIU48640.1| RabGAP/TBC domain-containing protein, partial [Arabidopsis lyrata]
Length=627

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 76/143 (53%), Gaps = 11/143 (8%)
 Frame = +3

Query  150  AASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGK  329
            +A I    +S+ +S +RK  + + + D+ I  L     V   ++A D    QL   N G 
Sbjct  196  SADIGNRVSSVIQSGLRKHKSHDPTRDLSIHLLEKFSLVT--KFARD-TTTQLFSENNGF  252

Query  330  PILTKS----SFRKHDH----DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWAT  485
              + K       R +      DEE +  +    +  +F+ +SLVWGKPRQP MG +E+  
Sbjct  253  GSVDKRWNNLPIRHYSENLLKDEEISNDIDVPADPLEFNKLSLVWGKPRQPPMGHKEFTA  312

Query  486  FLDSEGRVMNPQALRKRIFYGGL  554
             LDSEGRV+  +ALR+R+FYGG+
Sbjct  313  LLDSEGRVVESKALRERVFYGGI  335



>ref|XP_009363991.1| PREDICTED: TBC1 domain family member 15 [Pyrus x bretschneideri]
Length=658

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD  S+VWGKPRQP +G  EW  F DSEGR+++ +A RKRIFYGG+
Sbjct  312  EFDKESMVWGKPRQPPLGSDEWEAFFDSEGRIIDSEAFRKRIFYGGV  358


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS++ GSASM RS+  K S+S++ D   +  L D V ++P Q+ S+ I
Sbjct  5    ELHDLSDDADYAASLRHGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVTIHPTQFTSERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I  G  + 
Sbjct  65   SGRLRLIKHGSSLF  78



>ref|XP_004287286.1| PREDICTED: TBC1 domain family member 15 [Fragaria vesca subsp. 
vesca]
Length=659

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD  SLVWGKPRQP +   EW TFLDSEGR+ + +ALRKRIFYGG+
Sbjct  313  EFDKNSLVWGKPRQPPLEFDEWRTFLDSEGRITDSEALRKRIFYGGV  359



>gb|AIU48690.1| RabGAP/TBC domain-containing protein, partial [Trachycarpus fortunei]
Length=627

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD + LVWGK R+P +  +EWA FLDSEGRVM+ +ALRKRIFYGG+
Sbjct  289  EFDKLPLVWGKQREPPLCLEEWAAFLDSEGRVMDSKALRKRIFYGGV  335



>gb|AIU48665.1| RabGAP/TBC domain-containing protein, partial [Aristolochia tagala]
Length=616

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D +SLVWGKPRQP +G  EW  FLDSEGR+ +  +LRKRIFYGG+
Sbjct  280  DKISLVWGKPRQPPLGFDEWTIFLDSEGRITDSDSLRKRIFYGGV  324



>gb|AIU48661.1| RabGAP/TBC domain-containing protein, partial [Ceratophyllum 
demersum]
Length=615

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +3

Query  321  QGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSE  500
            Q  P++T +        ++ A +V  ++++ +FD + LVWGKPRQPS+  QEW  F+DSE
Sbjct  253  QENPLVTSAPEYGQLDTKKVADEVPVVLDHLEFDKLPLVWGKPRQPSLSLQEWEKFMDSE  312

Query  501  GRVMNPQALRKRIFYGGL  554
            GR+ + ++LR+ +FYGG+
Sbjct  313  GRINDSKSLRRHVFYGGV  330



>gb|AIU48676.1| RabGAP/TBC domain-containing protein, partial [Dioscorea oppositifolia]
Length=625

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D+++LVWGKPRQP +  +EWA FLDSEGRV + +ALRKRIFYGG+
Sbjct  289  DSLNLVWGKPRQPPLKIEEWAAFLDSEGRVNDSKALRKRIFYGGV  333



>gb|AIU48686.1| RabGAP/TBC domain-containing protein, partial [Ginkgo biloba]
Length=617

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +3

Query  429  SLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +LVWGKPR P +G +EWATF+DSEGRV++ +ALRKRIFYGG+
Sbjct  291  TLVWGKPRLPPLGIEEWATFVDSEGRVVDSKALRKRIFYGGI  332



>gb|AIU48663.1| RabGAP/TBC domain-containing protein, partial [Pandanus utilis]
Length=264

 Score = 71.2 bits (173),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            + ++LVWGK RQP +  +EW+ FLDSEGR+M+ +ALRKRIFYGG+
Sbjct  90   NKLNLVWGKSRQPPLCLEEWSAFLDSEGRIMDSKALRKRIFYGGV  134



>gb|AIU48653.1| RabGAP/TBC domain-containing protein, partial [Capsella rubella]
Length=626

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 76/146 (52%), Gaps = 17/146 (12%)
 Frame = +3

Query  150  AASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI------NNQLR  311
            +A +    +S+ +  +RK  + + + D+ I  L     V   ++A D        NN   
Sbjct  195  SADVGNRVSSVNQYGLRKQKSHDPTRDLSIHLLEKFSLVT--KFARDTTTQLFSENNGFG  252

Query  312  QI-----NQGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQE  476
             I     NQ  P    + F+    DEE A  V    +  + + +SLVWGKPRQP MG +E
Sbjct  253  SIDKRWNNQPSPHYLDNPFK----DEEIANNVDVPDDPLEVNKLSLVWGKPRQPPMGRKE  308

Query  477  WATFLDSEGRVMNPQALRKRIFYGGL  554
            +  FLDSEGRV+  +ALR+R+FYGG+
Sbjct  309  FTAFLDSEGRVVESKALRERVFYGGI  334



>gb|AIU48648.1| RabGAP/TBC domain-containing protein, partial [Acorus calamus]
Length=550

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D +SLVWGKPRQ  +   EWATFLDSEGRV + +ALRKRIFYGG+
Sbjct  214  DKLSLVWGKPRQSPLNYVEWATFLDSEGRVKDSEALRKRIFYGGV  258



>gb|AIU48645.1| RabGAP/TBC domain-containing protein, partial [Pinellia ternata]
Length=624

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +F+ + L+WGKPRQ  +  +EW+ FLDSEGR+M+P ALRKRIFYGG+
Sbjct  286  EFERLPLIWGKPRQGPLDFKEWSAFLDSEGRIMDPDALRKRIFYGGV  332



>ref|XP_006280129.1| hypothetical protein CARUB_v10026023mg [Capsella rubella]
 gb|EOA13027.1| hypothetical protein CARUB_v10026023mg [Capsella rubella]
Length=672

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 70/128 (55%), Gaps = 6/128 (5%)
 Frame = +3

Query  177  SMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQGKP--ILTKSS  350
            S+     R  +T   S++ G   ++ +    P+    + ++N   + +Q  P   L    
Sbjct  251  SLVTKFARDTTTQLFSENNGFGSIDKRWNNQPVHSYPEKLSNIAEEKHQESPHSYLDNDP  310

Query  351  FRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALR  530
            F+    DEE A  V    +  + + +SLVWGKPRQP MG +E+  FLDSEGRV+  +ALR
Sbjct  311  FK----DEEIANNVDVPDDPLEVNKLSLVWGKPRQPPMGRKEFTAFLDSEGRVVESKALR  366

Query  531  KRIFYGGL  554
            +R+FYGG+
Sbjct  367  ERVFYGGI  374


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM R +  K S+ ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRCDSGKRSSPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>gb|AIU48641.1| RabGAP/TBC domain-containing protein, partial [Arabidopsis thaliana]
Length=626

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 72/138 (52%), Gaps = 18/138 (13%)
 Frame = +3

Query  174  ASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWINNQLRQINQG---------  326
            +S+++S  RK  + + + D+ I  L     V   ++A D    QL   N G         
Sbjct  204  SSVSQSGFRKQKSHDPTRDLSIHLLEKFSLVT--KFARD-TTTQLFSENNGFGSIDKRWN  260

Query  327  -KPILTKS-SFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSE  500
             +PI   S +  K D          PL    +FD +SL+WGKPRQP MG +E+   LDSE
Sbjct  261  NQPIRHYSENLLKDDEISYIDVPADPL----EFDKLSLMWGKPRQPPMGHKEFTALLDSE  316

Query  501  GRVMNPQALRKRIFYGGL  554
            GRV+  +ALR+R+FYGG+
Sbjct  317  GRVVESKALRERVFYGGI  334



>gb|KFK26862.1| hypothetical protein AALP_AA8G303600 [Arabis alpina]
Length=675

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  +    +  +F  +SLVWGKPRQ  MG +E+  FLDSEGRV++P+ LR+R+FYG
Sbjct  316  DEEISNDIDVPADPLEFTKLSLVWGKPRQSPMGREEFTAFLDSEGRVVDPKGLRERVFYG  375

Query  549  GL  554
            G+
Sbjct  376  GI  377


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +3

Query  102  AMLAREIIDPSDNI-YYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQ  278
            +M A E+ D SD+  Y AAS QQGSASM R +  K S+S++ +   +    D VA++P Q
Sbjct  2    SMEASELQDLSDDADYAAASQQQGSASMMRCDSEKRSSSSEHEGAELIYTKDNVAIHPTQ  61

Query  279  YASDWINNQLRQINQ  323
            +AS+ I+ +L+   Q
Sbjct  62   FASERISGRLKLTKQ  76



>ref|XP_002864184.1| hypothetical protein ARALYDRAFT_495330 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40443.1| hypothetical protein ARALYDRAFT_495330 [Arabidopsis lyrata subsp. 
lyrata]
Length=674

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 81/162 (50%), Gaps = 29/162 (18%)
 Frame = +3

Query  150  AASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD-------------  290
            +A I    +S+ +S +RK  + + + D+ I  L     V   ++A D             
Sbjct  217  SADIGNRVSSVIQSGLRKHKSHDPTRDLSIHLLEKFSLVT--KFARDTTTQLFSENNGFG  274

Query  291  -----WIN-------NQLRQINQGKPILTKSSFRKHD--HDEEPATKVQPLINYNKFDNV  428
                 W N        +L  I + K    + S+ ++D   DEE +  +    +  +F+ +
Sbjct  275  SVDKRWNNLPVHSYPEKLSNIAEEKHNEIRHSYSENDLLKDEEISNDIDVPADPLEFNKL  334

Query  429  SLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            SLVWGKPRQP MG +E+   LDSEGRV+  +ALR+R+FYGG+
Sbjct  335  SLVWGKPRQPPMGHKEFTALLDSEGRVVESKALRERVFYGGI  376


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S+ ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSDSGKRSSPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_008785780.1| PREDICTED: TBC1 domain family member 15 [Phoenix dactylifera]
Length=666

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD + LVWGK R+P +  +EWA FLDSEGRVM+ +A RKRIFYGG+
Sbjct  321  EFDKLPLVWGKQREPPLCLEEWAAFLDSEGRVMDSKAFRKRIFYGGV  367



>gb|AIU48683.1| RabGAP/TBC domain-containing protein, partial [Ceratophyllum 
platyacanthum subsp. oryzetorum]
Length=615

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 53/78 (68%), Gaps = 0/78 (0%)
 Frame = +3

Query  321  QGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSE  500
            Q  P++T +        ++ A +V  ++++ +FD + LVWGKPRQP++  QEW  F+DSE
Sbjct  253  QENPLVTSAPEYGQLDTKKVADEVPVVLDHLEFDKLPLVWGKPRQPALSLQEWEKFMDSE  312

Query  501  GRVMNPQALRKRIFYGGL  554
            GR+ + ++LR+ +FYGG+
Sbjct  313  GRINDSKSLRRHVFYGGV  330



>gb|AIU48664.1| RabGAP/TBC domain-containing protein, partial [Asparagus officinalis]
Length=625

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            K D ++LVWGKPRQ  +G +EW  FLDSEGR+++ +ALRKRIFYGG+
Sbjct  289  KSDELNLVWGKPRQRPLGVEEWEAFLDSEGRIVDSKALRKRIFYGGV  335



>ref|NP_200071.2| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
 gb|AED96237.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
Length=673

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD +SL+WGKPRQP MG +E+   LDSEGRV+  +ALR+R+FYGG+
Sbjct  329  EFDKLSLMWGKPRQPPMGHKEFTALLDSEGRVVESKALRERVFYGGI  375


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S  ++ +D  +  L D VA++P Q+
Sbjct  2    SMEATELQDLSDDADYAASQQQGSASMMRSDSGKRSLQSEHEDAVLIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_010482627.1| PREDICTED: TBC1 domain family member 15-like isoform X3 [Camelina 
sativa]
Length=679

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  320  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  379

Query  549  GL  554
            G+
Sbjct  380  GI  381


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_010442797.1| PREDICTED: TBC1 domain family member 15-like [Camelina sativa]
Length=672

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  313  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  372

Query  549  GL  554
            G+
Sbjct  373  GI  374


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_010445069.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Camelina 
sativa]
Length=678

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  319  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  378

Query  549  GL  554
            G+
Sbjct  379  GI  380


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_010445073.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Camelina 
sativa]
Length=672

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  313  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  372

Query  549  GL  554
            G+
Sbjct  373  GI  374


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_010482626.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Camelina 
sativa]
Length=672

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  313  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  372

Query  549  GL  554
            G+
Sbjct  373  GI  374


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_010482625.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Camelina 
sativa]
Length=678

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +3

Query  369  DEEPATKVQPLINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYG  548
            DEE +  V    +  +F+ +SLVWGKPRQ  MG +E+  FLDSEGRV+  +ALR+R+FYG
Sbjct  319  DEEISNDVDVPADPLEFNKLSLVWGKPRQSPMGHKEFTAFLDSEGRVVESKALRERVFYG  378

Query  549  GL  554
            G+
Sbjct  379  GI  380


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RSN  K S  ++ DD  +  L D VA++P Q+
Sbjct  2    SMEASELQDLSDDADYAASQQQGSASMMRSNSGKRSLPSEHDDAELIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+   Q   + 
Sbjct  62   ASERISGRLKLTKQDSVLF  80



>ref|XP_008362894.1| PREDICTED: TBC1 domain family member 17-like [Malus domestica]
Length=659

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +FD  S+VWGKPRQP +G  EW  F DSEGR+++ +  RKRIFYGG+
Sbjct  313  EFDKESMVWGKPRQPPLGSDEWEAFFDSEGRIIDSEXXRKRIFYGGV  359


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASDWI  296
            E+ D SD+  YAAS+Q GSASM RS+  K S+S++ D   +  L D VA++P Q+ S+ I
Sbjct  5    ELHDLSDDADYAASLQXGSASMMRSDSGKHSSSSEHDGAEVVFLKDNVAIHPTQFVSERI  64

Query  297  NNQLRQINQGKPIL  338
            + +LR I QG  + 
Sbjct  65   SGRLRLIKQGSSLF  78



>gb|AIU48657.1| RabGAP/TBC domain-containing protein, partial [Illicium henryi]
Length=619

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +3

Query  429  SLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +LVWGK R P +G +EWATFLDSEGR+++ +ALRKRIFYGG+
Sbjct  292  NLVWGKKRLPPLGSEEWATFLDSEGRILDSKALRKRIFYGGV  333



>ref|XP_001783529.1| predicted protein [Physcomitrella patens]
 gb|EDQ51665.1| predicted protein [Physcomitrella patens]
Length=485

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  399  LINYNKFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            L++  + D+ +LVWG+ R P +G +EWATFLDSEGRV++P+AL+KR+F+GG+
Sbjct  139  LVDGTQNDSPALVWGRARPPPLGHEEWATFLDSEGRVVDPKALKKRVFHGGV  190



>gb|AIU48677.1| RabGAP/TBC domain-containing protein, partial [Yucca filamentosa]
Length=624

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D ++LVWGKPRQ  +   EW  FLDSEGR+M+ +ALRKRIFYGG+
Sbjct  290  DGLNLVWGKPRQKPLSIDEWGDFLDSEGRIMDSKALRKRIFYGGV  334



>ref|XP_010911930.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Elaeis guineensis]
Length=532

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 7/105 (7%)
 Frame = +3

Query  237  IACLNDKVAVNPMQYASDWINNQLRQINQGKPILTKSSFRKHDHDEEPATKVQPLINYNK  416
            I  L+  +A  P+ + S  +   L  + Q   I+  +       D+     V    +  +
Sbjct  135  IVVLSSGLAFPPLYFYSGGVREFLGTLKQHIFIMRSA-------DDANVFLVNDFQDPLQ  187

Query  417  FDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            FD + LVWGK R+  +   EWA FLDSEGRV++ +ALRKRIFYGG
Sbjct  188  FDKLPLVWGKQRESPLCLAEWAAFLDSEGRVVDSKALRKRIFYGG  232



>gb|AIU48691.1| RabGAP/TBC domain-containing protein, partial [Cabomba caroliniana]
Length=409

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            + D +SLVWGKPR   +G +EW+ FLD+EGR+ + +ALR++IFYGG+
Sbjct  77   EIDKLSLVWGKPRLHHLGSEEWSKFLDAEGRITDSKALREQIFYGGV  123



>ref|XP_010911929.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Elaeis guineensis]
Length=667

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGG  551
            +FD + LVWGK R+  +   EWA FLDSEGRV++ +ALRKRIFYGG
Sbjct  322  EFDKLPLVWGKQRESPLCLAEWAAFLDSEGRVVDSKALRKRIFYGG  367



>ref|XP_009420718.1| PREDICTED: TBC1 domain family member 15 [Musa acuminata subsp. 
malaccensis]
Length=667

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +F+ + LVWGK R   +  +EWA FLDSEGR+++ +ALR+RIFYGG+
Sbjct  322  EFEKLPLVWGKQRMHPLCLEEWAAFLDSEGRILDSKALRERIFYGGV  368



>gb|AIU48667.1| RabGAP/TBC domain-containing protein, partial [Canna indica]
Length=628

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 5/91 (5%)
 Frame = +3

Query  285  SDWIN-NQLRQINQGKPILTKSSFRKHDHDEEPATKVQPLINYNKFDNVSLVWGKPRQPS  461
            SD +N  + +Q N    + T SS  K    +       PL    +F+ + L+WGK R   
Sbjct  250  SDGLNAYEKKQQNNYSSVHTSSSDEKEKTSDMSPVASDPL----EFEELRLIWGKQRMHP  305

Query  462  MGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +  +EW +F DSEGR+ + +ALR+RIFYGG+
Sbjct  306  LSFEEWTSFFDSEGRITDSKALRERIFYGGV  336



>dbj|BAA98077.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC42472.1| unknown protein [Arabidopsis thaliana]
 gb|ABH11525.1| rabGAP [Arabidopsis thaliana]
Length=338

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +3

Query  435  VWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +WGKPRQP MG +E+   LDSEGRV+  +ALR+R+FYGG+
Sbjct  1    MWGKPRQPPMGHKEFTALLDSEGRVVESKALRERVFYGGI  40



>ref|NP_001190524.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
 gb|AED96238.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
Length=690

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 39/64 (61%), Gaps = 17/64 (27%)
 Frame = +3

Query  414  KFDNVSLVWGKPRQPSMGPQE-----------------WATFLDSEGRVMNPQALRKRIF  542
            +FD +SL+WGKPRQP MG +E                 +   LDSEGRV+  +ALR+R+F
Sbjct  329  EFDKLSLMWGKPRQPPMGHKERRNDISPSIKCRISTEYFTALLDSEGRVVESKALRERVF  388

Query  543  YGGL  554
            YGG+
Sbjct  389  YGGI  392


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S  ++ +D  +  L D VA++P Q+
Sbjct  2    SMEATELQDLSDDADYAASQQQGSASMMRSDSGKRSLQSEHEDAVLIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQ  323
            AS+ I+ +L+   Q
Sbjct  62   ASERISGRLKLTKQ  75



>gb|AIU48678.1| RabGAP/TBC domain-containing protein, partial [Setaria italica]
Length=628

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D + LVWGK R   +  +EWA FLD EGRVM+ +ALRK++FYGG+
Sbjct  292  DPLPLVWGKQRDRPLSAEEWAAFLDPEGRVMDSKALRKKVFYGGV  336



>ref|XP_004953647.1| PREDICTED: TBC1 domain family member 15-like [Setaria italica]
Length=672

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D + LVWGK R   +  +EWA FLD EGRVM+ +ALRK++FYGG+
Sbjct  329  DPLPLVWGKQRDRPLSAEEWAAFLDPEGRVMDSKALRKKVFYGGV  373



>gb|EEC73873.1| hypothetical protein OsI_08649 [Oryza sativa Indica Group]
Length=682

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  423  NVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            N  L WGKPR+  +   EW +FLD EGRVM+ +ALRK++FYGG+
Sbjct  335  NKILAWGKPREQPLSVDEWRSFLDPEGRVMDSKALRKKVFYGGI  378



>ref|NP_001047892.1| Os02g0709800 [Oryza sativa Japonica Group]
 dbj|BAD72476.1| GTPase activating protein-like [Oryza sativa Japonica Group]
 dbj|BAF09806.1| Os02g0709800 [Oryza sativa Japonica Group]
 dbj|BAG91061.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57667.1| hypothetical protein OsJ_08107 [Oryza sativa Japonica Group]
Length=679

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  423  NVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            N  L WGKPR+  +   EW +FLD EGRVM+ +ALRK++FYGG+
Sbjct  337  NKILAWGKPREQPLSVDEWRSFLDPEGRVMDSKALRKKVFYGGI  380



>gb|AIU48688.1| RabGAP/TBC domain-containing protein, partial [Zea mays]
Length=450

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D + LVWGK R   +  +EW +FLD EGR+M+ +ALRK++FYGG+
Sbjct  114  DPLPLVWGKQRDHPLSVEEWTSFLDREGRIMDSKALRKKVFYGGV  158



>gb|AIU48642.1| RabGAP/TBC domain-containing protein, partial [Lilium brownii]
Length=620

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +3

Query  432  LVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            L+WGK RQ  +  +EWA F+D+EGR+++ ++L+KRIFYGG+
Sbjct  288  LIWGKQRQSPLCLEEWAAFIDTEGRIIDSESLKKRIFYGGV  328



>ref|NP_001168835.1| uncharacterized protein LOC100382640 [Zea mays]
 gb|ACN30830.1| unknown [Zea mays]
 gb|AFW63576.2| hypothetical protein ZEAMMB73_375304 [Zea mays]
Length=671

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D + LVWGK R   +  +EW +FLD EGR+M+ +ALRK++FYGG+
Sbjct  328  DPLPLVWGKQRDHPLSVEEWTSFLDREGRIMDSKALRKKVFYGGV  372



>dbj|BAA98076.1| unnamed protein product [Arabidopsis thaliana]
Length=327

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = +3

Query  102  AMLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            +M A E+ D SD+  YAAS QQGSASM RS+  K S  ++ +D  +  L D VA++P Q+
Sbjct  2    SMEATELQDLSDDADYAASQQQGSASMMRSDSGKRSLQSEHEDAVLIYLKDNVAIHPTQF  61

Query  282  ASDWINNQLRQINQGKPILTKSSFRKH  362
            AS+ I+++        P     S R+H
Sbjct  62   ASERISDRSLYTITAVPFTEVRSIRRH  88



>gb|EMT03185.1| TBC1 domain family member 15 [Aegilops tauschii]
Length=591

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D + LVWGK R   +  +EW  FLD EGR+M+ +ALRK+IFYGG+
Sbjct  289  DELLLVWGKKRGNPLSVEEWRAFLDPEGRIMDSKALRKKIFYGGV  333



>gb|AIU48679.1| RabGAP/TBC domain-containing protein, partial [Sorghum bicolor]
Length=616

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D + LVWGK R   +  +EW  FLD EGRVM+ +ALRK++FYGG+
Sbjct  280  DPLPLVWGKQRDRPLSVEEWTAFLDPEGRVMDSKALRKKVFYGGV  324



>ref|XP_002452666.1| hypothetical protein SORBIDRAFT_04g030250 [Sorghum bicolor]
 gb|EES05642.1| hypothetical protein SORBIDRAFT_04g030250 [Sorghum bicolor]
Length=661

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D + LVWGK R   +  +EW  FLD EGRVM+ +ALRK++FYGG+
Sbjct  318  DPLPLVWGKQRDRPLSVEEWTAFLDPEGRVMDSKALRKKVFYGGV  362



>gb|EPS58476.1| hypothetical protein M569_16338, partial [Genlisea aurea]
Length=340

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   E+ D SD++ YAASIQQGSAS+ R++  K S +++ +      + D V ++P Q+A
Sbjct  1    MHETELSDLSDDVDYAASIQQGSASIYRTDSGKRSQTSEPEGAEAVYIKDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ + QG  + 
Sbjct  61   SERISGRLKLLKQGNALF  78



>gb|AIU48646.1| RabGAP/TBC domain-containing protein, partial [Brachypodium distachyon]
Length=628

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D + LVWGK R   +   EW  FLD EGR+M+ +ALRK++FYGG+
Sbjct  292  DELLLVWGKKRGSPLTVDEWRAFLDPEGRIMDSKALRKKVFYGGV  336



>ref|XP_003570212.1| PREDICTED: TBC1 domain family member 15 [Brachypodium distachyon]
Length=677

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D + LVWGK R   +   EW  FLD EGR+M+ +ALRK++FYGG+
Sbjct  334  DELLLVWGKKRGSPLTVDEWRAFLDPEGRIMDSKALRKKVFYGGV  378



>gb|AIU48672.1| RabGAP/TBC domain-containing protein, partial [Panicum virgatum]
Length=628

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D + LVWGK R   +   EW  FLD EGRVM+ +ALRK++FYGG+
Sbjct  292  DPLPLVWGKQRDCPLSVAEWTAFLDPEGRVMDSKALRKKVFYGGV  336



>gb|KHG10934.1| TBC1 domain family member 17 [Gossypium arboreum]
Length=142

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYA  284
            M   EI D SD+  YAAS  QGSASM R    K S+SN+ +   +  + D V ++P Q+A
Sbjct  1    MQETEIHDLSDDADYAASQHQGSASMMRCESGKRSSSNEPEGAEVVYMEDNVTIHPTQFA  60

Query  285  SDWINNQLRQINQGKPIL  338
            S+ I+ +L+ I Q     
Sbjct  61   SERISGRLKLIKQSSSFF  78



>ref|XP_006381118.1| hypothetical protein POPTR_0006s06510g, partial [Populus trichocarpa]
 gb|ERP58915.1| hypothetical protein POPTR_0006s06510g, partial [Populus trichocarpa]
Length=301

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 49/76 (64%), Gaps = 2/76 (3%)
 Frame = +3

Query  117  EIIDPSDNIYYAASIQQGSASM--TRSNIRKWSTSNKSDDVGIACLNDKVAVNPMQYASD  290
            E+ D SD+  YAAS+QQGSA+M  TR++  + ++S+  +   I  L D V ++P QYAS+
Sbjct  5    ELHDLSDDADYAASLQQGSANMMITRTDSGRSTSSSVPEGAEIVYLKDNVTIHPTQYASE  64

Query  291  WINNQLRQINQGKPIL  338
             I+ +L+ I QG  + 
Sbjct  65   RISGRLKLIKQGSSLF  80



>dbj|BAK05291.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=680

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  420  DNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            D + LVW K R   +  +EW  FLD EGR+M+ +ALRK+IFYGG+
Sbjct  337  DELLLVWEKKRGSPLSVEEWRAFLDPEGRIMDSKALRKKIFYGGV  381



>ref|XP_006647781.1| PREDICTED: TBC1 domain family member 15-like [Oryza brachyantha]
Length=635

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  429  SLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            SL WGK R+  +  +EW +FLD EGRV++ +ALR +IFYGG+
Sbjct  295  SLAWGKQREQPLSVEEWRSFLDPEGRVVDSKALRNKIFYGGV  336



>gb|KDO80158.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=638

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 2/46 (4%)
 Frame = +3

Query  417  FDNVSLVWGKPRQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            +D  ++V   P  P   P EW TFLD+EGRVM+  ALRKRIFYGG+
Sbjct  296  YDTETIVNEIPVAPD--PVEWTTFLDNEGRVMDSNALRKRIFYGGV  339



>ref|XP_010112473.1| hypothetical protein L484_008961 [Morus notabilis]
 gb|EXC33717.1| hypothetical protein L484_008961 [Morus notabilis]
Length=508

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = +3

Query  105  MLAREIIDPSDNIYYAASIQQGSASMTRSNI-RKWSTSNKSDDVGIACLNDKVAVNPMQY  281
            M   ++ D SD+  YAAS QQGSAS+ RS+  R+  +S+ SD   +    D V ++P Q+
Sbjct  1    MQETDLHDLSDDADYAASQQQGSASIMRSDSGRQSCSSSDSDGAEVVYWKDNVTIHPTQF  60

Query  282  ASDWINNQLRQINQGKPIL  338
            AS+ I+ +L+ I QG  + 
Sbjct  61   ASERISGRLKLIKQGTSLF  79



>ref|XP_004338737.1| TBC domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR16724.1| TBC domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=418

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  450  RQPSMGPQEWATFLDSEGRVMNPQALRKRIFYGGL  554
            R+  + PQEW +F D  GR+ N + LRK+IFYGG+
Sbjct  76   RKAPLSPQEWRSFFDETGRITNERKLRKKIFYGGV  110



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840