BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF046B08

Length=524
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAR00230.1|  flavonoid 3'-hydroxylase                                290   5e-95   Ipomoea purpurea
dbj|BAD00187.1|  flavonoid 3'-hydroxylase                               294   5e-94   Ipomoea nil [qian niu]
gb|AAR00229.1|  flavonoid 3'-hydroxylase                                289   5e-92   Ipomoea purpurea
gb|ABW69693.1|  flavonoid 3'-hydrogenase                                289   6e-92   Ipomoea purpurea
dbj|BAD00189.1|  flavonoid 3'-hydroxylase                               281   9e-89   Ipomoea tricolor [campanilla]
gb|AAS46257.1|  flavonoid 3'-hydroxylase                                261   4e-81   Ipomoea quamoclit [bejuco de cipres]
gb|ACS71532.1|  flavonoid 3' hydroxylase                                261   4e-81   Ipomoea horsfalliae [Kuhio-vine]
gb|ACL26685.1|  flavonoid 3'-hydroxylase                                261   5e-81   Ipomoea coccinea [red morning-glory]
gb|ABW86861.1|  flavonoid 3'-hydroxylase                                257   1e-79   Ipomoea batatas [batate]
gb|AEH42499.1|  flavonoid 3'-hydroxylase                                256   4e-79   Ipomoea batatas [batate]
gb|ACL26686.1|  flavonoid 3'-hydroxylase                                255   8e-79   Ipomoea ternifolia
gb|ACB29666.1|  flavonoid 3'-hydroxylase                                249   2e-76   Ipomoea batatas [batate]
gb|AEH42501.1|  flavonoid 3'-hydroxylase                                248   2e-76   Ipomoea batatas [batate]
gb|AEH42500.1|  flavonoid 3'-hydroxylase                                246   3e-75   Ipomoea batatas [batate]
dbj|BAJ11756.1|  flavonoid 3'-hydroxylase                               241   1e-73   Calystegia pubescens
dbj|BAJ08322.1|  flavonoid 3'-hydroxylase                               239   7e-73   Calystegia soldanella
gb|AGM46642.1|  flavonoid 3'-hydroxylase protein                        216   5e-68   Apium graveolens
dbj|BAE47005.1|  flavonoid 3'-hydroxylase                               221   8e-66   Vitis vinifera
dbj|BAE47003.1|  flavonoid 3'-hydroxylase                               216   8e-66   Vitis vinifera
emb|CAI54278.1|  flavonoid-3'-hydroxylase                               220   1e-65   Vitis vinifera
emb|CAN68303.1|  hypothetical protein VITISV_041731                     220   2e-65   Vitis vinifera
emb|CAN62275.1|  hypothetical protein VITISV_007552                     219   2e-65   Vitis vinifera
ref|XP_002284151.1|  PREDICTED: flavonoid 3'-monooxygenase              219   3e-65   Vitis vinifera
gb|ACN38268.1|  flavonoid 3' hydroxylase                                218   9e-65   Vitis amurensis
ref|NP_001267916.1|  flavonoid 3' hydroxylase                           218   1e-64   Vitis vinifera
sp|Q9SBQ9.1|F3PH_PETHY  RecName: Full=Flavonoid 3'-monooxygenase;...    218   1e-64   Petunia x hybrida [garden petunia]
dbj|BAE47004.1|  flavonoid 3'-hydroxylase                               218   1e-64   Vitis vinifera
gb|ABA64468.1|  flavonoid 3'-hydroxylase                                216   4e-64   Gerbera hybrid cultivar
ref|XP_009788494.1|  PREDICTED: flavonoid 3'-monooxygenase              216   6e-64   Nicotiana sylvestris
gb|AHZ08763.1|  flavonoid 3'-monooxygenase                              216   7e-64   Nicotiana tabacum [American tobacco]
dbj|BAO58432.1|  flavonoid 3'-hydroxylase                               214   3e-63   Vaccinium ashei
dbj|BAJ16330.1|  flavonoid 3'-hydroxylase                               213   7e-63   Antirrhinum kelloggii
ref|XP_009597267.1|  PREDICTED: flavonoid 3'-monooxygenase              213   7e-63   Nicotiana tomentosiformis
gb|AJO67965.1|  flavonoid-3'-hydroxylase                                204   8e-63   Prunus avium [gean]
gb|AHI58943.1|  flavonoid 3'-hydroxylase                                213   8e-63   Nicotiana tabacum [American tobacco]
emb|CDP19009.1|  unnamed protein product                                213   8e-63   Coffea canephora [robusta coffee]
gb|AGO02167.1|  flavonoid 3'-hydroxylase                                213   8e-63   Nekemias grossedentata
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                212   2e-62   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_006345132.1|  PREDICTED: flavonoid 3'-monooxygenase-like         211   7e-62   Solanum tuberosum [potatoes]
gb|AFQ92056.1|  flavonoid 3' hydroxylase                                210   7e-62   Pyrus pyrifolia [sha li]
emb|CDP19008.1|  unnamed protein product                                210   1e-61   Coffea canephora [robusta coffee]
ref|XP_008374610.1|  PREDICTED: flavonoid 3'-monooxygenase-like         210   1e-61   Malus domestica [apple tree]
gb|AIY22749.1|  flavonoid 3'-hydroxylase                                210   1e-61   Iochroma cyaneum
gb|AHA49900.1|  flavonoid 3' hydroxylase                                209   1e-61   Malus hybrid cultivar
gb|ACO35752.1|  flavonoid 3'-hydroxylase                                209   2e-61   Cosmos sulphureus [orange cosmos]
gb|ABB29899.1|  flavonoid 3'-hydroxylase                                209   2e-61   Osteospermum hybrid cultivar
gb|ACR14869.1|  flavonoid 3' hydroxylase IIb                            209   2e-61   Malus domestica [apple tree]
gb|ADB77826.1|  flavonoid 3'-hydroxylase allele 2                       209   2e-61   Dahlia pinnata
ref|NP_001289844.1|  flavonoid 3'-monooxygenase                         209   4e-61   Solanum lycopersicum
gb|ABM46853.1|  flavonoid 3'-hydroxylase                                208   7e-61   Ageratina adenophora
gb|AIY22747.1|  flavonoid 3'-hydroxylase                                207   9e-61   Iochroma calycinum
gb|AIY22748.1|  flavonoid 3'-hydroxylase                                207   9e-61   Iochroma calycinum
dbj|BAJ17668.1|  flavonoid 3' hydroxylase                               207   2e-60   Gynura bicolor
gb|KDP31334.1|  hypothetical protein JCGZ_11710                         207   2e-60   Jatropha curcas
gb|ACO35753.1|  flavonoid 3'-hydroxylase                                207   2e-60   Bidens aurea
gb|ADA85883.1|  flavonoid 3'-hydroxylase                                206   3e-60   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85879.1|  flavonoid 3'-hydroxylase                                206   3e-60   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85882.1|  flavonoid 3'-hydroxylase                                206   3e-60   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACN65825.1|  flavonoid 3'-hydroxylase                                206   3e-60   Cichorium intybus [radicchio]
gb|ADA85878.1|  flavonoid 3'-hydroxylase                                206   3e-60   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_009338402.1|  PREDICTED: flavonoid 3'-monooxygenase              206   3e-60   Pyrus x bretschneideri [bai li]
gb|AFI25037.1|  flavonoid 3'-hydroxylase                                197   5e-60   Populus deltoides x Populus tremuloides
ref|XP_010695197.1|  PREDICTED: flavonoid 3'-monooxygenase              205   6e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011072866.1|  PREDICTED: flavonoid 3'-monooxygenase              205   8e-60   Sesamum indicum [beniseed]
gb|ADA85881.1|  flavonoid 3'-hydroxylase                                205   1e-59   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACR14867.1|  flavonoid 3' hydroxylase                                204   1e-59   Malus domestica [apple tree]
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              204   1e-59   Prunus avium [gean]
ref|XP_008393217.1|  PREDICTED: flavonoid 3'-monooxygenase-like         204   1e-59   
ref|XP_010259651.1|  PREDICTED: flavonoid 3'-monooxygenase              204   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_006399285.1|  hypothetical protein EUTSA_v10013289mg             204   2e-59   Eutrema salsugineum [saltwater cress]
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                      204   2e-59   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_007209917.1|  hypothetical protein PRUPE_ppa004433mg             204   2e-59   Prunus persica
gb|AJA79074.1|  flavonoid 3' hydroxylase                                204   2e-59   Prunus persica
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         204   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002319761.1|  hypothetical protein POPTR_0013s07050g             204   3e-59   Populus trichocarpa [western balsam poplar]
emb|CDX69984.1|  BnaA10g23330D                                          204   3e-59   
gb|ABC58722.1|  flavonoid 3'-hydroxylase                                204   3e-59   Brassica napus [oilseed rape]
gb|AEA06595.1|  flavonoid 3'-hydroxylase                                203   3e-59   Chromolaena odorata
gb|ABC47161.1|  flavonoid 3'-hydroxylase                                204   3e-59   Pilosella officinarum [mouse-ear hawkweed]
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase              203   3e-59   Brassica rapa
ref|XP_007037547.1|  Flavonoid 3'-hydroxylase isoform 1                 203   3e-59   
gb|KDO54631.1|  hypothetical protein CISIN_1g020877mg                   198   3e-59   Citrus sinensis [apfelsine]
gb|ABY89688.1|  flavonoid 3` hydroxylase 2 protein                      203   4e-59   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_007037548.1|  Flavonoid 3'-hydroxylase isoform 2                 203   4e-59   Theobroma cacao [chocolate]
gb|ACV74415.1|  putative flavonoid-3'-hydroxylase                       203   5e-59   Camellia sinensis [black tea]
gb|ADB77825.1|  flavonoid 3'-hydroxylase allele 1                       203   5e-59   Dahlia pinnata
ref|XP_011011227.1|  PREDICTED: flavonoid 3'-monooxygenase              203   5e-59   Populus euphratica
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         203   6e-59   Camelina sativa [gold-of-pleasure]
ref|XP_009771410.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    203   6e-59   Nicotiana sylvestris
gb|AGC29948.1|  CYP75B65                                                202   6e-59   Sinopodophyllum hexandrum [Himalayan mayapple]
dbj|BAN62871.1|  flavonoid 3'-hydroxylase                               202   7e-59   Dianthus caryophyllus [carnation]
dbj|BAF49324.1|  flavonoid 3'-hydroxylase                               202   8e-59   Lobelia erinus
ref|XP_010030596.1|  PREDICTED: flavonoid 3'-monooxygenase-like         202   1e-58   Eucalyptus grandis [rose gum]
gb|KDO37751.1|  hypothetical protein CISIN_1g042286mg                   196   1e-58   Citrus sinensis [apfelsine]
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632             202   1e-58   
ref|XP_008240031.1|  PREDICTED: flavonoid 3'-monooxygenase              202   1e-58   Prunus mume [ume]
gb|ACO35754.1|  flavonoid 3'-hydroxylase                                201   2e-58   Dahlia pinnata
emb|CDX99037.1|  BnaC09g47980D                                          204   3e-58   
gb|ADA85880.1|  flavonoid 3'-hydroxylase                                201   4e-58   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ACO35756.1|  flavonoid 3'-hydroxylase                                200   5e-58   Tagetes erecta [big marigold]
gb|AIY51699.1|  flavonoid 3'-hydroxylase                                200   6e-58   Penstemon barbatus
gb|ABB53383.1|  flavonoid-3'-hydroxylase                                200   7e-58   Antirrhinum majus [garden snapdragon]
dbj|BAN05297.1|  flavonoid 3'-hydroxylase                               200   7e-58   Dianthus caryophyllus [carnation]
gb|KJB51033.1|  hypothetical protein B456_008G198200                    197   8e-58   Gossypium raimondii
gb|AJD25177.1|  cytochrome P450 CYP75B79                                199   2e-57   Salvia miltiorrhiza [Chinese salvia]
gb|AAG49298.1|AF313488_1  putative flavonoid 3'-hydroxylase             199   2e-57   Callistephus chinensis [Chinese aster]
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              198   3e-57   Camelina sativa [gold-of-pleasure]
gb|KHG07922.1|  Flavonoid 3',5'-hydroxylase                             198   3e-57   Gossypium arboreum [tree cotton]
ref|XP_010258076.1|  PREDICTED: flavonoid 3'-monooxygenase-like         198   3e-57   Nelumbo nucifera [Indian lotus]
dbj|BAF96945.1|  flavonoid 3'-hydroxylase                               197   4e-57   Rhododendron x pulchrum
ref|XP_006440736.1|  hypothetical protein CICLE_v10019637mg             198   4e-57   
gb|ACN65826.1|  flavonoid 3'-hydroxylase                                197   5e-57   Echinops bannaticus
gb|AEF30421.1|  flavonoid 3'-hydroxylase                                191   9e-57   Fagopyrum tataricum [Kangra buckwheat]
gb|AIY51698.1|  flavonoid 3'-hydroxylase                                197   1e-56   Penstemon neomexicanus
gb|KJB51032.1|  hypothetical protein B456_008G198200                    197   1e-56   Gossypium raimondii
gb|ADK56126.1|  putative flavonoid 3'-hydroxylase                       196   1e-56   Coreopsis grandiflora
ref|XP_006477655.1|  PREDICTED: flavonoid 3'-monooxygenase-like         196   2e-56   Citrus sinensis [apfelsine]
dbj|BAB59005.1|  flavonoid 3'-hydroxylase                               196   2e-56   Perilla frutescens var. crispa
gb|ADP24158.1|  flavonoid 3'-hydroxylase                                196   4e-56   Gossypium hirsutum [American cotton]
ref|NP_196416.1|  Flavonoid 3'-monooxygenase                            195   4e-56   Arabidopsis thaliana [mouse-ear cress]
gb|ADM26615.1|  flavonoid 3'-hydroxylase                                195   5e-56   Cynara cardunculus var. scolymus [artichoke]
gb|AAG49301.1|AF313491_1  flavonoid 3'-hydroxylase                      195   5e-56   Matthiola incana
gb|ACY06905.1|  flavonoid 3'-hydroxylase                                195   6e-56   Gossypium hirsutum [American cotton]
gb|AHZ31753.1|  flavonoid 3'-hydroxylase                                194   9e-56   Viola x wittrockiana
gb|AHY35313.1|  flavonoid 3'-hydroxylase 1                              194   1e-55   Morus notabilis
ref|XP_010105826.1|  Flavonoid 3'-monooxygenase                         194   1e-55   Morus notabilis
gb|AGL81348.1|  flavanone 3' hydroxylase                                194   1e-55   Pyrus communis
gb|AIU98513.1|  flavonoid 3'-hydroxylase                                194   1e-55   Paeonia suffruticosa [moutan peony]
gb|AEN71546.1|  flavanone 3'-hydroxylase                                194   1e-55   Paeonia suffruticosa [moutan peony]
gb|ACO35757.1|  flavonoid 3'-hydroxylase                                194   2e-55   Rudbeckia hirta
gb|EPS57881.1|  flavonoid 3'-hydroxylase                                192   2e-55   Genlisea aurea
dbj|BAD91808.1|  flavonoid 3'-hydroxylase                               194   2e-55   Gentiana triflora
gb|ACM62746.1|  flavonoid 3'-hydroxylase                                192   4e-55   Garcinia mangostana [mangosteen]
gb|EYU23554.1|  hypothetical protein MIMGU_mgv1a004224mg                193   4e-55   Erythranthe guttata [common monkey flower]
gb|AIT52346.1|  flavonoid 3'-monooxygenase 1                            193   4e-55   Daucus carota [carrots]
gb|ACO35755.1|  chalcone 3-hydroxylase                                  192   7e-55   Cosmos sulphureus [orange cosmos]
gb|ACN65827.1|  flavonoid 3'-hydroxylase                                192   1e-54   Centaurea cyanus [bachelor's-button]
gb|ADZ28515.1|  flavonoid-3'-hydroxylase                                191   2e-54   Camellia nitidissima
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             191   2e-54   Capsella rubella
gb|AGO03824.1|  flavonoid 3`5`-hydroxylase                              191   2e-54   Echinops bannaticus
gb|KEH32010.1|  flavonoid hydroxylase                                   190   5e-54   Medicago truncatula
gb|ADE80941.1|  flavonoid 3'-hydroxylase                                189   7e-54   Epimedium sagittatum
emb|CDP16353.1|  unnamed protein product                                179   7e-54   Coffea canephora [robusta coffee]
dbj|BAE71221.1|  putative flavonoid 3'-hydroxylase                      189   7e-54   Trifolium pratense [peavine clover]
gb|AGI16386.1|  flavonoid 3' hydroxylase                                189   8e-54   Ribes nigrum [European black currant]
gb|AJD25178.1|  cytochrome P450 CYP75B80                                189   1e-53   Salvia miltiorrhiza [Chinese salvia]
gb|AEX07282.1|  F3'H                                                    189   1e-53   Arachis hypogaea [goober]
gb|AAO47850.1|  defective flavonoid 3'-hydroxylase                      183   1e-53   Glycine max [soybeans]
gb|AGO03826.1|  flavonoid 3`5`-hydroxylase                              188   2e-53   Billardiera heterophylla
gb|AAG49315.1|AF315465_1  flavonoid 3'-hydroxylase                      188   2e-53   Pelargonium x hortorum [bedding geranium]
gb|ADT63065.1|  flavonoid 3'-hydroxylase                                187   2e-53   Fagopyrum esculentum
ref|XP_004508739.1|  PREDICTED: flavonoid 3'-monooxygenase-like         187   4e-53   
gb|ABB43031.1|  flavonoid 3'5'-hydroxylase                              187   5e-53   Osteospermum hybrid cultivar
gb|AFI71898.1|  flavonoid 3'-hydroxylase                                187   6e-53   Paeonia lactiflora [common garden peony]
gb|AAO47844.1|  gray pubescence flavonoid 3'-hydroxylase                184   8e-53   Glycine max [soybeans]
gb|ACJ85671.1|  unknown                                                 184   9e-53   Medicago truncatula
ref|XP_007138248.1|  hypothetical protein PHAVU_009G192400g             185   3e-52   Phaseolus vulgaris [French bean]
gb|AGO03825.1|  flavonoid 3`5`-hydroxylase                              184   6e-52   Cichorium intybus [radicchio]
gb|AES69199.2|  flavonoid hydroxylase                                   183   1e-51   Medicago truncatula
ref|XP_003598945.1|  Flavonoid 3'-hydroxylase                           183   1e-51   Medicago truncatula
gb|KHN17812.1|  Flavonoid 3'-monooxygenase                              183   2e-51   Glycine soja [wild soybean]
ref|NP_001237015.1|  flavonoid 3'-hydroxylase                           183   2e-51   Glycine max [soybeans]
gb|ACR33790.1|  flavonoid 3'-hydroxylase                                183   2e-51   Glycine max [soybeans]
gb|KEH33153.1|  flavonoid hydroxylase                                   183   2e-51   Medicago truncatula
gb|AEE60888.1|  flavonoid 3'-hydroxylase                                182   3e-51   Fragaria chiloensis
gb|ABB43030.1|  flavonoid 3'5'-hydroxylase                              182   3e-51   Pericallis cruenta
dbj|BAL63027.1|  flavonoid 3'-hydroxylase                               182   5e-51   Fragaria x ananassa
gb|AIB06740.1|  flavanone 3'-hydroxylase                                182   5e-51   Mangifera indica
ref|XP_003598948.1|  Flavonoid 3'-hydroxylase                           183   6e-51   
gb|AEE60886.1|  flavonoid 3'-hydroxylase                                181   8e-51   Fragaria x ananassa
gb|AEE60885.1|  flavonoid 3'-hydroxylase                                181   8e-51   Fragaria x ananassa
gb|AEE60887.1|  flavonoid 3'-hydroxylase                                181   9e-51   Fragaria virginiana
ref|NP_001274347.1|  uncharacterized protein LOC101314754               181   9e-51   Fragaria vesca [alpine strawberry]
gb|AEE60883.1|  flavonoid 3'-hydroxylase                                181   9e-51   Fragaria vesca [alpine strawberry]
gb|AGT28741.1|  flavonoid 3'-hydroxylase                                181   1e-50   Fragaria x ananassa
gb|AAG49299.1|AF313489_1  flavonoid 3',5'-hydroxylase                   181   2e-50   Callistephus chinensis [Chinese aster]
ref|XP_004515962.1|  PREDICTED: flavonoid 3'-monooxygenase-like         179   6e-50   
gb|AAX19888.1|  flavonoid-3',5'-hydroxylase                             179   6e-50   Pericallis cruenta
ref|XP_010030575.1|  PREDICTED: flavonoid 3'-monooxygenase-like         177   2e-49   Eucalyptus grandis [rose gum]
ref|XP_010522799.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    174   4e-49   
gb|ADX95997.1|  flavonoid 3'-hydroxylase                                166   5e-49   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010522791.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    175   7e-49   Tarenaya hassleriana [spider flower]
gb|AGT50310.1|  flavonoid 3'-hydroxylase                                175   8e-49   Meconopsis simplicifolia
gb|AGT50309.1|  flavonoid 3'-hydroxylase                                175   1e-48   Meconopsis delavayi
ref|XP_010522758.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    175   1e-48   Tarenaya hassleriana [spider flower]
ref|XP_010522775.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    175   1e-48   Tarenaya hassleriana [spider flower]
dbj|BAB17054.1|  unnamed protein product                                165   3e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AGT50311.1|  flavonoid 3'-hydroxylase                                174   3e-48   Meconopsis horridula [prickly blue-poppy]
gb|AGY55961.1|  flavonoid 3'-hydroxylase                                170   4e-48   Punica granatum [granado]
ref|XP_010522740.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    174   6e-48   Tarenaya hassleriana [spider flower]
ref|XP_010522750.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    174   7e-48   
gb|AGT50313.1|  flavonoid 3'-hydroxylase                                172   8e-48   Meconopsis lancifolia
gb|AGT50318.1|  flavonoid 3'-hydroxylase                                172   2e-47   Meconopsis punicea [red poppywort]
dbj|BAM28972.1|  flavonoid 3'-hydroxylase                               171   3e-47   Lilium hybrid division I
dbj|BAE72874.1|  flavonoid 3'-hydroxylase                               169   1e-46   Glandularia x hybrida [garden verbena]
ref|XP_010105825.1|  Flavonoid 3'-monooxygenase                         170   1e-46   Morus notabilis
dbj|BAM28971.1|  flavonoid 3'-hydroxylase                               170   1e-46   Lilium hybrid division I
emb|CDP16533.1|  unnamed protein product                                168   2e-46   Coffea canephora [robusta coffee]
dbj|BAB87838.1|  flavonoid 3'-hydroxylase                               169   3e-46   Torenia hybrid cultivar
dbj|BAB87839.1|  flavonoid 3'-hydroxalase                               166   1e-45   Torenia hybrid cultivar
gb|AHL83556.1|  flavonoid-3'-hydroxylase                                166   2e-45   Iris x hollandica [Dutch iris]
ref|XP_002514665.1|  flavonoid 3-hydroxylase, putative                  164   1e-44   
ref|XP_010030579.1|  PREDICTED: flavonoid 3'-monooxygenase-like         164   1e-44   Eucalyptus grandis [rose gum]
ref|XP_006665050.1|  PREDICTED: flavonoid 3'-monooxygenase-like         164   2e-44   Oryza brachyantha
gb|KHN18348.1|  Flavonoid 3'-monooxygenase                              164   2e-44   Glycine soja [wild soybean]
gb|AFK73718.1|  cytochrome P450                                         163   3e-44   Papaver somniferum
ref|XP_003525447.1|  PREDICTED: flavonoid 3'-monooxygenase-like         163   4e-44   Glycine max [soybeans]
gb|AAS48419.1|  flavonoid 3'-hydroxylase                                163   5e-44   Allium cepa
gb|AFP95893.1|  F3'H                                                    162   1e-43   Narcissus tazetta
ref|XP_003525448.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    161   2e-43   Glycine max [soybeans]
ref|XP_003550701.1|  PREDICTED: flavonoid 3'-monooxygenase-like         162   2e-43   
gb|KHN48735.1|  Flavonoid 3'-monooxygenase                              161   2e-43   Glycine soja [wild soybean]
ref|XP_004983036.1|  PREDICTED: flavonoid 3'-monooxygenase-like         161   3e-43   Setaria italica
gb|AFW72123.1|  red aleurone1                                           161   3e-43   
gb|AIC73642.1|  flavonoid 3'-hydroxylase                                160   3e-43   Anthurium andraeanum [flamingo-lily]
ref|NP_001064338.1|  Os10g0320100                                       160   7e-43   
gb|AHY35314.1|  flavonoid 3'-hydroxylase 2                              159   8e-43   Morus notabilis
ref|XP_008453263.1|  PREDICTED: flavonoid 3'-monooxygenase              159   1e-42   Cucumis melo [Oriental melon]
gb|AGJ50589.1|  flavonoid 3'-hydroxylase                                159   2e-42   Tulipa fosteriana
ref|XP_009394321.1|  PREDICTED: flavonoid 3'-monooxygenase              158   4e-42   
gb|AGG40645.1|  flavanone 3'-hydroxylase                                157   7e-42   Narcissus tazetta
gb|AAO47856.1|  flavonoid 3'-hydroxylase                                148   1e-41   Glycine max [soybeans]
dbj|BAM28973.1|  flavonoid 3'-hydroxylase                               155   2e-41   Lilium hybrid division I
dbj|BAH22519.1|  flavonoid 3' hydroxylase                               155   3e-41   Tricyrtis hirta
ref|XP_002439914.1|  hypothetical protein SORBIDRAFT_09g022480          155   5e-41   Sorghum bicolor [broomcorn]
ref|XP_004138192.1|  PREDICTED: flavonoid 3'-monooxygenase-like         155   6e-41   Cucumis sativus [cucumbers]
gb|KGN63720.1|  Flavonoid 3' hydroxylase                                154   7e-41   Cucumis sativus [cucumbers]
ref|XP_008678758.1|  PREDICTED: flavonoid 3'-monooxygenase-like         154   1e-40   Zea mays [maize]
gb|ABG54319.1|  flavonoid 3'-hydroxylase                                153   2e-40   Sorghum bicolor [broomcorn]
gb|AAV74194.1|  flavonoid 3'-hydroxylase                                152   5e-40   Sorghum bicolor [broomcorn]
gb|ABG54320.1|  flavonoid 3'-hydroxylase                                152   5e-40   Sorghum bicolor [broomcorn]
ref|XP_002452380.1|  hypothetical protein SORBIDRAFT_04g024710          152   5e-40   Sorghum bicolor [broomcorn]
gb|AEF33624.1|  flavonoid 3' hydroxylase                                152   5e-40   Zea mays [maize]
gb|AII26680.1|  flavonoid 3'-hydroxylase                                152   6e-40   Indosasa hispida
ref|XP_002454110.1|  hypothetical protein SORBIDRAFT_04g024750          150   1e-39   
gb|AFW62812.1|  putative cytochrome P450 superfamily protein            153   2e-39   
gb|ABG54321.1|  flavonoid 3'-hydroxylase                                150   2e-39   Sorghum bicolor [broomcorn]
ref|XP_002452385.1|  hypothetical protein SORBIDRAFT_04g024730          150   2e-39   Sorghum bicolor [broomcorn]
gb|KCW83706.1|  hypothetical protein EUGRSUZ_B00580                     149   3e-39   Eucalyptus grandis [rose gum]
gb|KCW83705.1|  hypothetical protein EUGRSUZ_B00580                     149   3e-39   Eucalyptus grandis [rose gum]
gb|AII26679.1|  flavonoid 3'-monooxygenase                              150   3e-39   Indosasa hispida
ref|XP_010939156.1|  PREDICTED: flavonoid 3'-monooxygenase-like         149   4e-39   Elaeis guineensis
ref|XP_003525450.1|  PREDICTED: flavonoid 3'-monooxygenase-like         148   1e-38   Glycine max [soybeans]
gb|KHN48734.1|  Flavonoid 3'-monooxygenase                              147   2e-38   Glycine soja [wild soybean]
dbj|BAJ95115.1|  predicted protein                                      148   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006579509.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    145   2e-38   
ref|XP_008791304.1|  PREDICTED: flavonoid 3'-monooxygenase-like         146   5e-38   Phoenix dactylifera
gb|AGT50312.1|  flavonoid 3'-hydroxylase                                145   5e-38   Meconopsis racemosa
gb|AGT50315.1|  flavonoid 3'-hydroxylase                                145   6e-38   Meconopsis betonicifolia [Himalayan blue-poppy]
gb|AGT50314.1|  flavonoid 3'-hydroxylase                                145   6e-38   Meconopsis henrici
ref|XP_006661696.1|  PREDICTED: flavonoid 3'-monooxygenase-like         146   6e-38   
gb|AGT50323.1|  flavonoid 3'-hydroxylase                                145   7e-38   Meconopsis pseudohorridula
ref|NP_001146311.1|  uncharacterized protein LOC100279887               146   7e-38   Zea mays [maize]
gb|AGT50317.1|  flavonoid 3'-hydroxylase                                145   7e-38   Meconopsis zangnanensis
gb|ACG38346.1|  flavonoid 3-monooxygenase                               146   7e-38   Zea mays [maize]
ref|XP_008678806.1|  PREDICTED: flavonoid 3'-monooxygenase-like         146   8e-38   
gb|AGT50324.1|  flavonoid 3'-hydroxylase                                145   9e-38   Papaver nudicaule [Arctic poppy]
ref|XP_007155246.1|  hypothetical protein PHAVU_003G1855000g            138   1e-37   Phaseolus vulgaris [French bean]
gb|EMS47585.1|  Flavonoid 3'-monooxygenase                              142   2e-37   Triticum urartu
gb|EMS66050.1|  Flavonoid 3'-monooxygenase                              141   2e-37   Triticum urartu
gb|AGT50325.1|  flavonoid 3'-hydroxylase                                144   2e-37   Papaver radicatum
gb|AGT50316.1|  flavonoid 3'-hydroxylase                                144   2e-37   Meconopsis integrifolia [Farrer's lampshade-poppy]
gb|AGT50319.1|  flavonoid 3'-hydroxylase                                144   2e-37   Meconopsis quintuplinervia
gb|AGT50321.1|  flavonoid 3'-hydroxylase                                144   3e-37   Meconopsis wilsonii
ref|XP_010233685.1|  PREDICTED: flavonoid 3'-monooxygenase-like         144   3e-37   Brachypodium distachyon [annual false brome]
dbj|BAJ98136.1|  predicted protein                                      144   5e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001141292.1|  uncharacterized protein LOC100273383               142   2e-36   
ref|NP_001064333.1|  Os10g0317900                                       141   3e-36   
gb|EAY78004.1|  hypothetical protein OsI_33044                          141   3e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_003577475.1|  PREDICTED: flavonoid 3'-monooxygenase-like         141   5e-36   Brachypodium distachyon [annual false brome]
ref|XP_003574810.2|  PREDICTED: flavonoid 3'-monooxygenase-like         140   6e-36   Brachypodium distachyon [annual false brome]
gb|AGT50322.1|  flavonoid 3'-hydroxylase                                139   1e-35   Meconopsis gracilipes
dbj|BAJ93256.1|  predicted protein                                      137   9e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AHX02955.1|  flavonoid 3'5'-hydroxylase                              135   4e-34   Iris x hollandica [Dutch iris]
gb|AGT50320.1|  flavonoid 3'-hydroxylase                                134   6e-34   Meconopsis paniculata
gb|EMT24087.1|  Flavonoid 3'-monooxygenase                              134   2e-33   
dbj|BAF93855.1|  flavonoid 3',5'-hydroxylase                            133   3e-33   Viola x wittrockiana
gb|AFD04990.1|  flavonoid 3'5'-hydroxylase                              128   3e-33   Phlox drummondii
gb|ACN60403.1|  flavonoid-3',5'-hydroxylase                             131   5e-33   Capsicum annuum
ref|XP_002314004.1|  hypothetical protein POPTR_0009s07320g             132   5e-33   
dbj|BAC10997.1|  flavonoid 3',5'-hydroxylase                            132   5e-33   
dbj|BAH89259.1|  putative flavonoid 3'-hydroxylase                      131   9e-33   
gb|AIY22750.1|  flavonoid 3',5'-hydroxylase                             131   1e-32   
gb|ABR16821.1|  unknown                                                 131   1e-32   
gb|AIY22751.1|  flavonoid 3',5'-hydroxylase                             131   1e-32   
ref|XP_010247486.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      130   1e-32   
gb|AIX10138.1|  flavonoid 3',5'-hydroxylase                             131   1e-32   
ref|NP_001234840.1|  putative flavonoid 3'5' hydroxylase                131   2e-32   
gb|AFD05065.1|  flavonoid 3'5'-hydroxylase                              126   2e-32   
gb|AFD05046.1|  flavonoid 3'5'-hydroxylase                              126   2e-32   
gb|AFD04986.1|  flavonoid 3'5'-hydroxylase                              126   2e-32   
gb|AFD05019.1|  flavonoid 3'5'-hydroxylase                              126   2e-32   
gb|AFD05026.1|  flavonoid 3'5'-hydroxylase                              126   2e-32   
gb|AFD05042.1|  flavonoid 3'5'-hydroxylase                              126   2e-32   
gb|AFD04973.1|  flavonoid 3'5'-hydroxylase                              126   2e-32   
gb|AFD05035.1|  flavonoid 3'5'-hydroxylase                              126   2e-32   
gb|AFD05008.1|  flavonoid 3'5'-hydroxylase                              126   2e-32   
gb|AFD04975.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
gb|AFD05037.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
gb|AFD05051.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
gb|AFD05024.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
gb|AFD05017.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
gb|AFD04985.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
gb|AFD05012.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
gb|AFD04971.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
gb|AFD05005.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
gb|AFD04984.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
gb|AFD04980.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
gb|AFD04970.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
gb|AFD05011.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
gb|AFD04969.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
gb|EEE50732.1|  hypothetical protein OsJ_31043                          130   3e-32   
gb|AFD05023.1|  flavonoid 3'5'-hydroxylase                              126   3e-32   
ref|XP_011009110.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      130   3e-32   
ref|XP_010031713.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      130   3e-32   
sp|P37120.1|C75A2_SOLME  RecName: Full=Flavonoid 3',5'-hydroxylas...    130   4e-32   
gb|AAV85472.1|  flavonoid 3',5'-hydroxylase                             127   4e-32   
gb|AIY22752.1|  flavonoid 3',5'-hydroxylase                             130   4e-32   
gb|AFD05020.1|  flavonoid 3'5'-hydroxylase                              125   5e-32   
ref|XP_010247479.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      129   5e-32   
gb|AFD05064.1|  flavonoid 3'5'-hydroxylase                              125   6e-32   
gb|AFD05050.1|  flavonoid 3'5'-hydroxylase                              125   6e-32   
gb|AFD05057.1|  flavonoid 3'5'-hydroxylase                              125   6e-32   
gb|AFD05052.1|  flavonoid 3'5'-hydroxylase                              125   6e-32   
gb|AFD04978.1|  flavonoid 3'5'-hydroxylase                              125   6e-32   
gb|AFD05010.1|  flavonoid 3'5'-hydroxylase                              125   7e-32   
gb|AFD05032.1|  flavonoid 3'5'-hydroxylase                              125   7e-32   
gb|AFD04991.1|  flavonoid 3'5'-hydroxylase                              125   7e-32   
gb|ADV39275.1|  flavonoid 3',5'-hydroxylase                             125   8e-32   
gb|KDP43193.1|  hypothetical protein JCGZ_22745                         129   8e-32   
gb|ADV39279.1|  flavonoid 3',5'-hydroxylase                             125   8e-32   
gb|AFD04994.1|  flavonoid 3'5'-hydroxylase                              125   8e-32   
gb|ADV39278.1|  flavonoid 3',5'-hydroxylase                             125   9e-32   
gb|ADV39277.1|  flavonoid 3',5'-hydroxylase                             125   9e-32   
gb|ADV39282.1|  flavonoid 3',5'-hydroxylase                             125   9e-32   
gb|ADV39273.1|  flavonoid 3',5'-hydroxylase                             125   9e-32   
gb|ADV39281.1|  flavonoid 3',5'-hydroxylase                             125   9e-32   
ref|XP_003636773.1|  Flavonoid 3' 5'-hydroxylase                        124   1e-31   
gb|AIX10137.1|  flavonoid 3',5'-hydroxylase                             128   1e-31   
ref|XP_009619846.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1           128   1e-31   
gb|AGC30728.1|  flavonoid 3',5'-hydroxylase                             126   2e-31   
sp|Q96418.1|C75A5_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    128   2e-31   
dbj|BAK64099.1|  flavonoid 3',5'-hydroxylase                            128   2e-31   
dbj|BAH98132.1|  flavonoid 3',5'-hydroxylase                            128   2e-31   
dbj|BAJ16329.1|  flavonoid 3',5'-hydroxylase                            128   2e-31   
gb|ADV39276.1|  flavonoid 3',5'-hydroxylase                             125   2e-31   
dbj|BAJ16328.1|  flavonoid 3',5'-hydroxylase                            127   2e-31   
dbj|BAF96946.1|  flavonoid 3',5'-hydroxylase                            127   2e-31   
ref|XP_010045076.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      127   2e-31   
gb|AFD04977.1|  flavonoid 3'5'-hydroxylase                              123   2e-31   
dbj|BAH98133.1|  flavonoid 3',5'-hydroxylase                            127   2e-31   
gb|KCW87229.1|  hypothetical protein EUGRSUZ_B03742                     127   3e-31   
gb|KCW87228.1|  hypothetical protein EUGRSUZ_B03742                     127   3e-31   
gb|AIX10133.1|  flavonoid 3',5'-hydroxylase                             127   3e-31   
dbj|BAF64483.1|  flavonoid-3',5'-hydroxylase                            125   3e-31   
gb|AFL91704.1|  flavonoid-3',5'-hydroxylase                             127   3e-31   
gb|AFD05049.1|  flavonoid 3'5'-hydroxylase                              123   3e-31   
gb|AAG49300.1|AF313490_1  flavonoid 3',5'-hydroxylase                   127   4e-31   
gb|AFD05059.1|  flavonoid 3'5'-hydroxylase                              123   4e-31   
gb|ADV39274.1|  flavonoid 3',5'-hydroxylase                             124   4e-31   
gb|AIX10140.1|  flavonoid 3',5'-hydroxylase                             127   4e-31   
gb|AIX10142.1|  flavonoid 3',5'-hydroxylase                             127   4e-31   
gb|AIX10135.1|  flavonoid 3',5'-hydroxylase                             127   4e-31   
gb|AIX10136.1|  flavonoid 3',5'-hydroxylase                             127   4e-31   
ref|XP_006446310.1|  hypothetical protein CICLE_v10018289mg             127   4e-31   
ref|XP_010045081.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      127   4e-31   
gb|AFD05054.1|  flavonoid 3'5'-hydroxylase                              123   5e-31   
dbj|BAB20076.1|  flavonoid 3',5'-hydroxylase                            127   5e-31   
ref|NP_001274807.1|  flavonoid 3',5'-hydroxylase                        127   5e-31   
ref|XP_006349127.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    127   5e-31   
gb|AIX10139.1|  flavonoid 3',5'-hydroxylase                             127   5e-31   
gb|AIX10134.1|  flavonoid 3',5'-hydroxylase                             126   6e-31   
dbj|BAJ09746.1|  flavonoid 3',5'-hydroxylase                            126   6e-31   
gb|AGI16385.1|  flavonoid 3', 5'-hydroxylase                            126   6e-31   
gb|AEY80043.1|  flavonoid-3',5'-hydroxylase                             126   9e-31   
gb|AIX10141.1|  flavonoid 3',5'-hydroxylase                             126   9e-31   
dbj|BAF64482.1|  flavonoid-3',5'-hydroxylase                            125   1e-30   
dbj|BAF34566.1|  flavonoid 3',5'-hydroxylase                            125   1e-30   
gb|ACZ63206.1|  flavonoid 3',5'-hydroxylase                             125   1e-30   
gb|KJB09328.1|  hypothetical protein B456_001G134900                    125   2e-30   
gb|ACZ63205.1|  flavonoid 3',5'-hydroxylase                             125   2e-30   
gb|AAP31058.1|  flavonoid 3',5'-hydroxylase                             125   2e-30   
gb|AFD05053.1|  flavonoid 3'5'-hydroxylase                              121   2e-30   
gb|AAX51796.1|  flavonoid 3'5'-hydroxylase                              125   2e-30   
dbj|BAO66642.1|  flavonoid 3',5'-hydroxylase                            125   2e-30   
dbj|BAL61235.1|  flavonoid 3',5'-hydroxylase                            125   2e-30   
dbj|BAJ08041.1|  flavonoid 3',5'-hydroxylase                            125   2e-30   
gb|ACY06904.1|  flavonoid 3'5'-hydroxylase                              125   2e-30   
dbj|BAH89265.1|  flavonoid 3'5' hydroxylase                             125   2e-30   
ref|XP_007015254.1|  Flavonoid 3',5'-hydroxylase 2 isoform 1            125   2e-30   
emb|CAA50442.1|  P450 hydroxylase                                       124   2e-30   
ref|XP_010045077.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      125   2e-30   
ref|XP_003562884.1|  PREDICTED: flavonoid 3'-monooxygenase-like         125   2e-30   
ref|XP_006856442.1|  hypothetical protein AMTR_s00047p00229040          125   2e-30   
dbj|BAO04188.1|  flavonoid 3'5'-hydroxylase                             125   3e-30   
dbj|BAF34558.1|  flavonoid 3',5'-hydroxylase                            124   3e-30   
dbj|BAF34571.1|  flavonoid 3',5'-hydroxylase                            124   3e-30   
dbj|BAF34563.1|  flavonoid 3',5'-hydroxylase                            124   3e-30   
dbj|BAF34559.1|  flavonoid 3',5'-hydroxylase                            124   3e-30   
gb|ABN42195.1|  flavonoid-3',5'-hydroxylase                             124   3e-30   
dbj|BAF34572.1|  flavonoid 3',5'-hydroxylase                            124   3e-30   
sp|P48418.1|C75A1_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    124   3e-30   
dbj|BAF34575.1|  flavonoid 3',5'-hydroxylase                            124   3e-30   
dbj|BAF34569.1|  flavonoid 3',5'-hydroxylase                            124   3e-30   
dbj|BAF34562.1|  flavonoid 3',5'-hydroxylase                            124   3e-30   
dbj|BAF34561.1|  flavonoid 3',5'-hydroxylase                            124   3e-30   
dbj|BAF34560.1|  flavonoid 3',5'-hydroxylase                            124   3e-30   
dbj|BAF34567.1|  flavonoid 3',5'-hydroxylase                            124   3e-30   
gb|AIY51702.1|  flavonoid 3',5'-hydroxylase                             124   3e-30   
gb|ACH56524.1|  flavonoid 3'5'-hydroxylase                              124   3e-30   
dbj|BAF34557.1|  flavonoid 3',5'-hydroxylase                            124   3e-30   
gb|AAV85470.1|  flavonoid 3',5'-hydroxylase                             124   3e-30   
gb|ABY77007.1|  flavonoid 3',5'-hydroxylase                             124   4e-30   
dbj|BAC97831.1|  Flavonoid 3',5'-hydroxylase                            124   4e-30   
sp|O04790.1|C75A7_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    124   4e-30   
gb|ACX37698.1|  flavonoid 3',5'-hydroxylase                             124   4e-30   
gb|AJD25176.1|  cytochrome P450 CYP75A57                                124   4e-30   
ref|XP_003638766.1|  Flavonoid 3' 5'-hydroxylase                        124   4e-30   
gb|AEX12304.1|  hypothetical protein 0_8089_01                          118   5e-30   
gb|KEH33357.1|  flavonoid hydroxylase                                   124   5e-30   
dbj|BAE72871.1|  flavonoid 3',5'-hdyroxylase                            124   6e-30   
dbj|BAF34568.1|  flavonoid 3',5'-hydroxylase                            124   6e-30   
gb|AAT34974.1|  flavonoid 3',5'-hydroxylase                             124   6e-30   
gb|AAY23287.1|  flavonoid 3',5'-hydroxylase                             124   7e-30   
dbj|BAE86871.1|  flavonoid 3',5'-hydroxylase                            123   7e-30   
gb|AEX12309.1|  hypothetical protein 0_8089_01                          117   1e-29   
gb|AFF59221.1|  flavonoid 3'5'-hydroxylase                              123   1e-29   
gb|ABA40923.1|  flavonoid 3',5'-hydroxylase                             123   1e-29   
gb|KHF97502.1|  Flavonoid 3',5'-hydroxylase 2                           122   1e-29   
sp|O04773.1|C75A6_CAMME  RecName: Full=Flavonoid 3',5'-hydroxylas...    122   2e-29   
dbj|BAF34573.1|  flavonoid 3',5'-hydroxylase                            122   2e-29   
sp|Q96581.1|C75A4_GENTR  RecName: Full=Flavonoid 3',5'-hydroxylas...    121   4e-29   
gb|ACN58569.1|  flavonoid 3',5'-hydroxylase                             121   4e-29   
sp|P48419.1|C75A3_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    121   6e-29   
gb|ABQ96219.1|  flavonoid 3'5' hydroxylase                              120   7e-29   
gb|ADW66657.1|  flavonoid-3',5'-hydroxylase                             120   7e-29   
gb|AAM51564.1|  flavonoid 3', 5'-hydroxylase                            120   7e-29   
dbj|BAJ14025.1|  flavonoid 3'5'-hydroxylase                             120   8e-29   
dbj|BAE72872.1|  flavonoid 3',5'-hdyroxylase                            120   8e-29   
dbj|BAM09186.1|  flavonoid 3'5'-hydroxylase                             120   8e-29   
gb|AJA40049.1|  flavonoid 3'5'-hydroxylase                              120   8e-29   
ref|XP_003638760.1|  Flavonoid 3' 5'-hydroxylase                        120   8e-29   
ref|XP_006593479.1|  PREDICTED: flavonoid 3', 5'-hydroxylase isof...    120   8e-29   
ref|NP_001236632.1|  flavonoid 3', 5'-hydroxylase                       120   8e-29   
gb|ABQ96218.1|  flavonoid 3'5' hydroxylase                              120   9e-29   
gb|AEX12307.1|  hypothetical protein 0_8089_01                          114   9e-29   
dbj|BAK74845.1|  mutated flavonoid 3', 5' hydroxylase                   119   9e-29   
dbj|BAF49293.1|  flavonoid 3',5'-hydroxylase                            120   1e-28   
dbj|BAF49320.1|  flavonoid 3',5'-hydroxylase                            120   1e-28   
dbj|BAE72870.1|  flavonoid 3',5'-hdyroxylase                            120   1e-28   
dbj|BAF49322.1|  flavonoid 3',5'-hydroxylase                            120   1e-28   
gb|AIM58719.1|  flavonoid 3'hydroxylase                                 120   1e-28   
ref|XP_007146175.1|  hypothetical protein PHAVU_006G018800g             119   1e-28   
dbj|BAF49319.1|  flavonoid 3',5'-hydroxylase                            120   2e-28   
gb|AFR67330.1|  flavonoid-3',5'-hydroxylase                             120   2e-28   
dbj|BAF34570.1|  flavonoid 3',5'-hydroxylase                            119   2e-28   
gb|ABR18019.1|  unknown                                                 117   3e-28   
ref|XP_007146174.1|  hypothetical protein PHAVU_006G018800g             119   3e-28   
ref|XP_011024984.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      119   3e-28   
ref|XP_010910221.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      119   4e-28   
ref|XP_002298464.1|  hypothetical protein POPTR_0001s28140g             118   4e-28   
emb|CAA09850.1|  flavonoid 3',5'-hydroxylase                            118   5e-28   
dbj|BAE47007.1|  flavonoid 3',5'-hydroxylase                            118   5e-28   
ref|XP_010651523.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      118   5e-28   
dbj|BAK74846.1|  flavonoid 3', 5' hydroxylase                           118   6e-28   
emb|CAN82588.1|  hypothetical protein VITISV_038260                     118   7e-28   
ref|NP_001268164.1|  uncharacterized protein LOC100261319               118   8e-28   
gb|AHK10251.1|  flavonoid-3',5'-hydroxylase                             117   8e-28   
gb|ADE80942.1|  flavonoid 3',5'-hydroxylase                             117   1e-27   
gb|ACN38269.1|  flavonoid-3',5'-hydroxylase                             117   1e-27   
ref|XP_003556788.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    117   1e-27   
gb|AEX12305.1|  hypothetical protein 0_8089_01                          112   1e-27   
gb|ADW66160.1|  flavonoid 3' 5' hydroxylase                             117   1e-27   
ref|XP_007015255.1|  Flavonoid 3',5'-hydroxylase 2 isoform 2            117   1e-27   
ref|XP_003632209.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           117   2e-27   
emb|CAN81079.1|  hypothetical protein VITISV_007550                     116   2e-27   
ref|XP_009383085.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      116   2e-27   
emb|CAN61852.1|  hypothetical protein VITISV_020443                     116   2e-27   
ref|XP_003632242.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           116   2e-27   
gb|ABF96136.1|  transposon protein, putative, unclassified, expre...    115   2e-27   
ref|XP_010027781.1|  PREDICTED: cytochrome P450 CYP736A12-like          116   3e-27   
emb|CAN82604.1|  hypothetical protein VITISV_005589                     116   3e-27   
gb|ABC86840.1|  flavonoid 3',5'-hydroxylase                             115   3e-27   
ref|XP_010651525.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           116   3e-27   
gb|KDO54767.1|  hypothetical protein CISIN_1g047593mg                   116   4e-27   
ref|XP_006837147.1|  hypothetical protein AMTR_s00110p00149730          115   4e-27   
ref|XP_006470529.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      116   4e-27   
ref|XP_002280939.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           115   5e-27   
ref|XP_002271739.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           115   6e-27   
emb|CAN60738.1|  hypothetical protein VITISV_042284                     114   6e-27   
emb|CAN80142.1|  hypothetical protein VITISV_038979                     115   6e-27   
ref|XP_010041191.1|  PREDICTED: cytochrome P450 CYP736A12-like          114   7e-27   
ref|XP_009411862.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      115   7e-27   
gb|ABV53919.1|  flavonoid 3'-hydroxylase                                108   9e-27   
gb|ABR17846.1|  unknown                                                 115   9e-27   
ref|XP_004513234.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    115   1e-26   
emb|CBI30128.3|  unnamed protein product                                115   1e-26   
gb|AGO02173.1|  flavonoid 3'5'-hydroxylase                              114   1e-26   
ref|XP_010027875.1|  PREDICTED: cytochrome P450 CYP736A12-like          114   1e-26   
dbj|BAJ23912.1|  flavonoid 3',5'-hydroxylase                            114   1e-26   



>gb|AAR00230.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
Length=323

 Score =   290 bits (743),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 173/173 (100%), Gaps = 0/173 (0%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ER+GPLMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   ERHGPLMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKITSVHLFSA+ALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  173



>dbj|BAD00187.1| flavonoid 3'-hydroxylase [Ipomoea nil]
 dbj|BAD00190.1| flavonoid 3'-hydroxylase [Ipomoea nil]
Length=519

 Score =   294 bits (753),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 172/173 (99%), Positives = 173/173 (100%), Gaps = 0/173 (0%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGKKPHQSIAAMA
Sbjct  1    MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGKKPHQSIAAMA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ERYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   ERYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKITSVHLFSA+ALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  173



>gb|AAR00229.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00188.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00191.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
Length=519

 Score =   289 bits (739),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 173/173 (100%), Gaps = 0/173 (0%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ER+GPLMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   ERHGPLMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKITSVHLFSA+ALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  173



>gb|ABW69693.1| flavonoid 3'-hydrogenase [Ipomoea purpurea]
Length=519

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 168/173 (97%), Positives = 173/173 (100%), Gaps = 0/173 (0%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ER+GPLMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   ERHGPLMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKITSVHLFSA+ALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  173



>dbj|BAD00189.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
 dbj|BAD00192.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
Length=522

 Score =   281 bits (718),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 165/173 (95%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MATLTLI CTLVFAI LYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLILCTLVFAICLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   QSYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKITSVHLFSA+ALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  173



>gb|AAS46257.1| flavonoid 3'-hydroxylase [Ipomoea quamoclit]
Length=519

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 164/173 (95%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MATLTLI CTL+FAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLILCTLLFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   QKYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKITSVHLFSA+ALDDF HVRQEEVATLTRSLASAGKTPVKLGQLL
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLL  173



>gb|ACS71532.1| flavonoid 3' hydroxylase [Ipomoea horsfalliae]
Length=517

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 166/173 (96%), Gaps = 2/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MATLTLI CT VFA+FLYFL LR+K RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A
Sbjct  1    MATLTLILCTSVFAVFLYFL-LRLK-RYPLPLPPGPKPWPVVGNLPHLGQKPHQSIAALA  58

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  59   QSYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSSRPPNSGAKHIAYNYQDLVFAPY  118

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKITSVHLFSA+ALDDFCHVRQEEVATL RSLASAGKTPVKLGQLL
Sbjct  119  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLARSLASAGKTPVKLGQLL  171



>gb|ACL26685.1| flavonoid 3'-hydroxylase [Ipomoea coccinea]
Length=519

 Score =   261 bits (666),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 164/173 (95%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MATLTLI CTL+FAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLILCTLLFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   QKYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKITSVHLFSA+ALDDF HVRQEEVATLTRSLASAGKTPVKLGQLL
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLL  173



>gb|ABW86861.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=517

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 164/173 (95%), Gaps = 2/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MATLTLIFCT+VF IFLY L LRVK RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A
Sbjct  1    MATLTLIFCTIVFTIFLYCL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPHQSIAALA  58

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  59   QSYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPY  118

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR LRKITSVHLFSA+ALDDF HVRQ EVATLTRSLASAGKTPVKLGQLL
Sbjct  119  GPRWRRLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLL  171



>gb|AEH42499.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 163/172 (95%), Gaps = 2/172 (1%)
 Frame = +2

Query  8    ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  187
            ATLTLI CT+VF IFLYFL LRVK RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A+
Sbjct  3    ATLTLILCTIVFTIFLYFL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPHQSIAALAQ  60

Query  188  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  367
             YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPYG
Sbjct  61   SYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPYG  120

Query  368  PRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            PRWR LRKITSVHLFSA+ALDDF HVRQ EVATLTRSLASAGKTPVKLGQLL
Sbjct  121  PRWRRLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLL  172



>gb|ACL26686.1| flavonoid 3'-hydroxylase [Ipomoea ternifolia]
Length=519

 Score =   255 bits (651),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 162/173 (94%), Positives = 170/173 (98%), Gaps = 0/173 (0%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MATLTLI CTL+FAI LYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLILCTLLFAISLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   KKYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKITSVHLFSA+ALDDF HVRQEEVATLTRSLASAGKTPVKLGQLL
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLL  173



>gb|ACB29666.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 161/172 (94%), Gaps = 2/172 (1%)
 Frame = +2

Query  8    ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  187
            ATLTLI CT VF IFLY L LRVK RYPLPLPPGPKPWP++GNLPHLG+KPHQSIAA+A+
Sbjct  3    ATLTLILCTSVFTIFLYCL-LRVK-RYPLPLPPGPKPWPIVGNLPHLGEKPHQSIAALAQ  60

Query  188  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  367
             YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAY+YQDLVFAPYG
Sbjct  61   SYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYSYQDLVFAPYG  120

Query  368  PRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            PRWRMLRKITSVHLFSA+ALDDF HVRQ  VATLTRSLASAGKTPVKLGQLL
Sbjct  121  PRWRMLRKITSVHLFSAKALDDFSHVRQGVVATLTRSLASAGKTPVKLGQLL  172



>gb|AEH42501.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/172 (88%), Positives = 161/172 (94%), Gaps = 2/172 (1%)
 Frame = +2

Query  8    ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  187
            ATLTLI CT VF IFLY L LRVK RYPLPLPPGPKPWP++GNLPHLG+KPHQSIAA+A+
Sbjct  3    ATLTLILCTSVFTIFLYCL-LRVK-RYPLPLPPGPKPWPIVGNLPHLGEKPHQSIAALAQ  60

Query  188  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  367
             YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAY+YQDLVFAPYG
Sbjct  61   SYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYSYQDLVFAPYG  120

Query  368  PRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            PRWRMLRKITSVHLFSA+ALDDF HVRQ  VATLTRSLASAGKTPVKLGQLL
Sbjct  121  PRWRMLRKITSVHLFSAKALDDFSHVRQGVVATLTRSLASAGKTPVKLGQLL  172



>gb|AEH42500.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 160/172 (93%), Gaps = 2/172 (1%)
 Frame = +2

Query  8    ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  187
            ATLTLI CT V  I LY L LRVK RYPLPLPPGPKPWPV+GNLPHLG+KP+QS+AA+A+
Sbjct  3    ATLTLILCTSVITISLYCL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPNQSLAALAQ  60

Query  188  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  367
             YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPYG
Sbjct  61   SYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPYG  120

Query  368  PRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            PRWRMLRKITSVHLFSA+ALDDF HVRQ EVATLTRSLASAGKTPVKLGQLL
Sbjct  121  PRWRMLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLL  172



>dbj|BAJ11756.1| flavonoid 3'-hydroxylase [Calystegia pubescens]
Length=520

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 157/176 (89%), Gaps = 3/176 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRV---KQRYplplppgpkpwpvlGNLPHLGKKPHQSIA  175
            MA LTL   T +FAIFLYFL+ ++    +RYPL LPPGP PWPV+GNLPHLG KPHQ++A
Sbjct  1    MAILTLFLFTSIFAIFLYFLVCQLLISNKRYPLLLPPGPSPWPVVGNLPHLGPKPHQTLA  60

Query  176  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  355
            A+A+ YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVF
Sbjct  61   ALAQNYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVF  120

Query  356  APYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            APYGPRWRMLRKITSVHLFS++ALDDF HVRQEE+  LTR+LASAGKTPVKLGQLL
Sbjct  121  APYGPRWRMLRKITSVHLFSSKALDDFRHVRQEEIGVLTRALASAGKTPVKLGQLL  176



>dbj|BAJ08322.1| flavonoid 3'-hydroxylase [Calystegia soldanella]
Length=520

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 158/176 (90%), Gaps = 3/176 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRV---KQRYplplppgpkpwpvlGNLPHLGKKPHQSIA  175
            MA LTL   T +FAIF+YFL+ ++    +RYPLPLPPGP PWPV+GNLPHLG KPHQ++A
Sbjct  1    MAILTLFLFTSIFAIFIYFLVCQLLISNKRYPLPLPPGPSPWPVVGNLPHLGPKPHQTLA  60

Query  176  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  355
            A+A+ YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVF
Sbjct  61   ALAQNYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVF  120

Query  356  APYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            APYGPRWRMLRKITSVHLFS++ALDDF HVRQEE+  LTR+LASAG+TPVKLGQLL
Sbjct  121  APYGPRWRMLRKITSVHLFSSKALDDFRHVRQEEIGVLTRALASAGRTPVKLGQLL  176



>gb|AGM46642.1| flavonoid 3'-hydroxylase protein, partial [Apium graveolens]
Length=153

 Score =   216 bits (549),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG KPH S+AA+A+ YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NFS+RPPN
Sbjct  6    GNLPHLGAKPHHSLAALAKNYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFSSRPPN  65

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQDLVFAPYGPRWRMLRKITSVHLFSA+ALDDF HVRQEEV  LTR+LASA
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFRHVRQEEVGILTRALASA  125

Query  491  GKTPVKLGQLL  523
            GKTPVKLGQLL
Sbjct  126  GKTPVKLGQLL  136



>dbj|BAE47005.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 138/173 (80%), Gaps = 4/173 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEVA LTR+LA AG+TPV LGQLL
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLL  169



>dbj|BAE47003.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=334

 Score =   216 bits (550),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 136/173 (79%), Gaps = 4/173 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALSFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFS QALDDF H+RQEEV  L R+LA AG+TPVKLGQLL
Sbjct  117  GPRWRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLL  169



>emb|CAI54278.1| flavonoid-3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 139/173 (80%), Gaps = 4/173 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L LIFCT +F + LY  + R   R P  L P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCVLLYHFLTRRSVRLPPGLKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEVA LTR+LA AG+TPV LGQLL
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLL  169



>emb|CAN68303.1| hypothetical protein VITISV_041731 [Vitis vinifera]
Length=509

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 138/173 (80%), Gaps = 4/173 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L LIFCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEVA LTR+LA AG+TPV LGQLL
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLL  169



>emb|CAN62275.1| hypothetical protein VITISV_007552 [Vitis vinifera]
Length=471

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 137/173 (79%), Gaps = 4/173 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFS QALDDF H+RQEEV  L R+LA AG+TPVKLGQLL
Sbjct  117  GPRWRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLL  169



>ref|XP_002284151.1| PREDICTED: flavonoid 3'-monooxygenase [Vitis vinifera]
 emb|CAN75347.1| hypothetical protein VITISV_002956 [Vitis vinifera]
Length=509

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 137/173 (79%), Gaps = 4/173 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFS QALDDF H+RQEEV  L R+LA AG+TPVKLGQLL
Sbjct  117  GPRWRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLL  169



>gb|ACN38268.1| flavonoid 3' hydroxylase [Vitis amurensis]
Length=509

 Score =   218 bits (555),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 137/173 (79%), Gaps = 4/173 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALFFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEVA LTR+LA AG+TPV LGQLL
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLL  169



>ref|NP_001267916.1| flavonoid 3' hydroxylase [Vitis vinifera]
 dbj|BAE47006.1| flavonoid 3'-hydroxylase [Vitis vinifera]
 gb|ABH06586.1| flavonoid 3' hydroxylase [Vitis vinifera]
Length=509

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 137/173 (79%), Gaps = 4/173 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALFFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEVA LTR+LA AG+TPV LGQLL
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLL  169



>sp|Q9SBQ9.1|F3PH_PETHY RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B2; AltName: Full=Flavonoid 3'-hydroxylase [Petunia 
x hybrida]
 gb|AAD56282.1|AF155332_1 flavonoid 3'-hydroxylase [Petunia x hybrida]
Length=512

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 154/175 (88%), Gaps = 3/175 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILR--VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  178
            M  L+LI  T++F+  L F ILR   ++RYPLPLPPGPKPWP++GNL HLG KPHQS AA
Sbjct  1    MEILSLILYTVIFSFLLQF-ILRSFFRKRYPLPLPPGPKPWPIIGNLVHLGPKPHQSTAA  59

Query  179  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  358
            MA+ YGPLM+L++GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGAEH+AYNYQDLVFA
Sbjct  60   MAQTYGPLMYLKMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAEHMAYNYQDLVFA  119

Query  359  PYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            PYGPRWRMLRKI SVHLFS +ALDDF HVRQ+EV TLTR+LASAG+ PVKLGQLL
Sbjct  120  PYGPRWRMLRKICSVHLFSTKALDDFRHVRQDEVKTLTRALASAGQKPVKLGQLL  174



>dbj|BAE47004.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 136/173 (79%), Gaps = 4/173 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFS QALDDF H+RQEEV  L R+LA  G+TPVKLGQLL
Sbjct  117  GPRWRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALAREGQTPVKLGQLL  169



>gb|ABA64468.1| flavonoid 3'-hydroxylase [Gerbera hybrid cultivar]
Length=512

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 146/173 (84%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  LTL+  T V  +FLY L+ R   R P  LPPGP PWPV+GNLPHLG  PH S+AAMA
Sbjct  1    MTPLTLLIGTCVTGLFLYVLLNRC-TRNPNRLPPGPTPWPVVGNLPHLGTIPHHSLAAMA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFADRPPNSGAKHIAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFS +ALDDF HVRQEEVA L R+L  AGK+PVKLGQLL
Sbjct  120  GPRWRMLRKICSVHLFSTKALDDFRHVRQEEVAILARALVGAGKSPVKLGQLL  172



>ref|XP_009788494.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana sylvestris]
Length=514

 Score =   216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 151/174 (87%), Gaps = 1/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  181
            MA  +L+  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQS AAM
Sbjct  1    MAIFSLLLYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSTAAM  60

Query  182  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  361
            A  YGPLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAP  120

Query  362  YGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            YGPRWRMLRKI  VHLFSA+ALDDF HVRQ+EV TLTR+LASAG+ PVKLGQLL
Sbjct  121  YGPRWRMLRKICFVHLFSAKALDDFSHVRQDEVKTLTRALASAGQKPVKLGQLL  174



>gb|AHZ08763.1| flavonoid 3'-monooxygenase [Nicotiana tabacum]
Length=515

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 151/174 (87%), Gaps = 1/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  181
            MA  +L+  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQS AAM
Sbjct  1    MAIFSLLLYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSTAAM  60

Query  182  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  361
            A  YGPLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAP  120

Query  362  YGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            YGPRWRMLRKI SVHLFSA+ALDDF HVRQ+EV TLTR+LASA + PVKLGQLL
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLL  174



>dbj|BAO58432.1| flavonoid 3'-hydroxylase [Vaccinium ashei]
Length=517

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MA+L  I  +L+  IFLYF++  ++ RYP PLPPGPKPWPV+GNLPHLG  PH SIAA+A
Sbjct  1    MASLAFIIYSLLIGIFLYFVLSLLRNRYPRPLPPGPKPWPVIGNLPHLGTMPHHSIAALA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
              YGPLMHL +G V VVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   RTYGPLMHLWMGSVHVVVAASASVAXQFLKTHDQNFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAG--KTPVKLGQLL  523
            GPRWRMLRKI SVHLFSA+ALDDF HVRQEEVA LTR+LASA   KT V LGQLL
Sbjct  121  GPRWRMLRKICSVHLFSAKALDDFRHVRQEEVAILTRALASAAKSKTTVNLGQLL  175



>dbj|BAJ16330.1| flavonoid 3'-hydroxylase [Antirrhinum kelloggii]
Length=509

 Score =   213 bits (542),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = +2

Query  11   TLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  190
            ++TLI  TL+    L ++ L  K +   PLPPGPKPWP++GNLPHLG KPHQS+AA+A  
Sbjct  4    SITLIASTLILGFLLLYIFLNRKAKAAAPLPPGPKPWPIVGNLPHLGPKPHQSMAALARV  63

Query  191  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  370
            +GPL+HL++GFV VVVAASA+VA +FLKVHD+NFS+RPPNSGA+H+AYNYQDLVFAPYGP
Sbjct  64   HGPLIHLKMGFVHVVVAASASVAEKFLKVHDANFSSRPPNSGAKHVAYNYQDLVFAPYGP  123

Query  371  RWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            RWRMLRKI ++HLFSA+AL DF HVRQEEV  LTR+LA AGKTPVKLGQ+L
Sbjct  124  RWRMLRKICALHLFSAKALTDFTHVRQEEVGILTRALADAGKTPVKLGQML  174



>ref|XP_009597267.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana tomentosiformis]
Length=515

 Score =   213 bits (542),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLI-LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  181
            MA  +LI  T++F+  L+ +  L  ++RYPL LPPGPKPWP++GNL H+G KPHQS AAM
Sbjct  1    MAIFSLILYTVIFSFLLHSIFSLFFRKRYPLTLPPGPKPWPIIGNLVHMGPKPHQSTAAM  60

Query  182  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  361
            A  YGPLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAP  120

Query  362  YGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            YGPRWRMLRKI SVHLFSA+ALDDF HVRQ+EV TLTR+LASA + PVKLGQLL
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLL  174



>gb|AJO67965.1| flavonoid-3'-hydroxylase, partial [Prunus avium]
Length=215

 Score =   204 bits (520),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  20   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  199
            LIF T+VFA FLY L++    R+ LPL PGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLVP-GNRHSLPLAPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  200  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  379
            LMHLRLGFVDV+VAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVIVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  380  MLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            MLRKI+SVHLFS +ALDD  HVRQEEVA L  SLA AG   V L QLL
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHSLAGAGSKTVNLAQLL  170



>gb|AHI58943.1| flavonoid 3'-hydroxylase [Nicotiana tabacum]
Length=515

 Score =   213 bits (542),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLI-LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  181
            MA  +LI  T++F+  L+ +  L  ++RYPL LPPGPKPWP++GNL H+G KPHQS AAM
Sbjct  1    MAIFSLILYTVIFSFLLHSIFSLFFRKRYPLTLPPGPKPWPIIGNLVHMGPKPHQSTAAM  60

Query  182  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  361
            A  YGPLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAP  120

Query  362  YGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            YGPRWRMLRKI SVHLFSA+ALDDF HVRQ+EV TLTR+LASA + PVKLGQLL
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLL  174



>emb|CDP19009.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   213 bits (542),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 148/174 (85%), Gaps = 2/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+TLTLIF + + A FL + IL+        LPPGPKPWP++GNLPHLG KPH S+AAMA
Sbjct  1    MSTLTLIFISSLLA-FLLYSILKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   KTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRS-LASAGKTPVKLGQLL  523
            GPRWR+LRKI S+HLFSA+ALDDF  VRQEEV TL R+ LASAGKTPV LGQLL
Sbjct  120  GPRWRLLRKICSIHLFSAKALDDFHLVRQEEVGTLARALLASAGKTPVNLGQLL  173



>gb|AGO02167.1| flavonoid 3'-hydroxylase [Ampelopsis grossedentata]
Length=509

 Score =   213 bits (542),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 136/173 (79%), Gaps = 4/173 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M +L L+FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNSLALLFCTALFCVLLYRFLTRRSPRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLR+GFVDVVVAASA+VA+QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVASQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI S+HLFS +ALDDF H+RQEE++ LT +LA AG  PV LGQLL
Sbjct  117  GPRWRMLRKICSIHLFSGKALDDFRHIRQEEISVLTSALARAGPAPVNLGQLL  169



>dbj|BAP94456.1| flavonoid 3'-hydroxylas [Eustoma exaltatum subsp. russellianum]
Length=519

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  20   LIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
            L+  T +F++ +Y  L L  ++     LPPGPKPWP++GNLPHLG KPHQ++AAMA+ YG
Sbjct  9    LVVYTAIFSLLIYAILKLLRRENRRPSLPPGPKPWPIIGNLPHLGTKPHQTLAAMAKTYG  68

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHL+LGFVDVVVAASA+VA QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRW
Sbjct  69   PLMHLKLGFVDVVVAASASVAEQFLKKHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRW  128

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            R+LRKI SVHLFSA+ALDDF HVRQEEV  LTRS+ASAG+ P+ LGQLL
Sbjct  129  RLLRKICSVHLFSAKALDDFQHVRQEEVGILTRSIASAGENPINLGQLL  177



>ref|XP_006345132.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=514

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 152/174 (87%), Gaps = 1/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLI-LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  181
            MA  +LI  T++ +  L+F++ L  ++RYP+PLPPGPKPWP++GN+  LG KPHQS A+M
Sbjct  1    MAIFSLILYTIISSFILHFILSLFFRKRYPVPLPPGPKPWPIIGNIVQLGPKPHQSTASM  60

Query  182  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  361
            A  YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPLMHLRMGFVDVVVAASASVAAQFLKNHDANFSSRPPNSGAKHMAYNYHDLVFAP  120

Query  362  YGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            YGPRWRMLRKI SVHLFSA+ALDDF HVRQEEV TLTR+LA+AG+ P+KLGQLL
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANAGQKPIKLGQLL  174



>gb|AFQ92056.1| flavonoid 3' hydroxylase [Pyrus pyrifolia]
Length=511

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 142/169 (84%), Gaps = 0/169 (0%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
             LIF T+V A FLY L    + R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGRSRHGLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            RMLRKI+SVHLFS +ALDD  HVRQEEV  L   LASAG  PV LGQLL
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLL  171



>emb|CDP19008.1| unnamed protein product [Coffea canephora]
 emb|CDP16354.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 147/174 (84%), Gaps = 2/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+TLTLIF + + A FL + I +        LPPGPKPWP++GNLPHLG KPH S+AAMA
Sbjct  1    MSTLTLIFISSLLA-FLLYSIHKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   KTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRS-LASAGKTPVKLGQLL  523
            GPRWR+LRKI S+HLFSA+ALDDF  VRQEEV TL R+ LASAGKTPV LGQLL
Sbjct  120  GPRWRLLRKICSIHLFSAKALDDFHLVRQEEVGTLARALLASAGKTPVNLGQLL  173



>ref|XP_008374610.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
 gb|ACR14868.1| flavonoid 3' hydroxylase IIa [Malus domestica]
Length=511

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
             LIF T+V A FLY L      R+  PLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGGSRHAQPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            RMLRKI+SVHLFS +ALDD  HVRQEEV  L   LASAG  PV LGQLL
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLL  171



>gb|AIY22749.1| flavonoid 3'-hydroxylase [Iochroma cyaneum]
Length=515

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 148/174 (85%), Gaps = 1/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  181
            MA   +I CT++ +  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQS A M
Sbjct  1    MAIFFIILCTIIISFLLHTILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSTADM  60

Query  182  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  361
            A  YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAP  120

Query  362  YGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            YGPRWRMLRKI SVHLFSA+ALDDF HVRQEEV TLTR+LA+A + PVKLGQLL
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLL  174



>gb|AHA49900.1| flavonoid 3' hydroxylase [Malus hybrid cultivar]
Length=511

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
             LIF T+V A FLY L      R+  PLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGGSRHAQPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            RMLRKI+SVHLFS +ALDD  HVRQEEV  L   LASAG  PV LGQLL
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLL  171



>gb|ACO35752.1| flavonoid 3'-hydroxylase [Cosmos sulphureus]
Length=508

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG  PH S+AA+A +YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NF++RPPN
Sbjct  42   GNLPHLGTTPHHSLAALAAKYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFASRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGAEH+AYNYQDLVFAPYGPRWRMLRKI SVHLFS +ALDDF HVRQEEVA LTR+LA A
Sbjct  102  SGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDFRHVRQEEVAVLTRALAGA  161

Query  491  GKTPVKLGQLL  523
            GK+PVKLGQLL
Sbjct  162  GKSPVKLGQLL  172



>gb|ABB29899.1| flavonoid 3'-hydroxylase [Osteospermum hybrid cultivar]
Length=514

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 147/174 (84%), Gaps = 2/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L L+  + +  + +Y L L ++ R+   LPPGP PWP++GNLPHLG  PH S+AAMA
Sbjct  1    MTILPLVLYSCITGLVIYVL-LNLRTRHSNRLPPGPTPWPIVGNLPHLGVVPHHSLAAMA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP-  361
            E+YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NF++RPPNSGA+HIAYNYQDLVFAP 
Sbjct  60   EKYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFASRPPNSGAKHIAYNYQDLVFAPY  119

Query  362  YGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            YGPRWRMLRKI SVHLFS++ALDDF HVRQEEVA LTR+L  AG +PVKLGQLL
Sbjct  120  YGPRWRMLRKICSVHLFSSKALDDFRHVRQEEVAILTRALIGAGDSPVKLGQLL  173



>gb|ACR14869.1| flavonoid 3' hydroxylase IIb [Malus domestica]
Length=511

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
             LIF T+V A FLY L      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGGSRHALPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            RMLRKI+SVHLFS +ALDD  HVRQEEV  L   LASAG  PV LGQLL
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVSLGQLL  171



>gb|ADB77826.1| flavonoid 3'-hydroxylase allele 2 [Dahlia pinnata]
Length=508

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 144/173 (83%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+ LTL+    + A+ LY L L ++ R+   LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MSILTLLLYASITALPLYVL-LNLRTRHSNRLPPGPTPWPIVGNLPHLGTIPHHSLAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            E+YGPLMHLR GFVDVVVAASA+VA+QFLK HD+ F++RPPNSGAEHIAYNYQDLVFAPY
Sbjct  60   EKYGPLMHLRFGFVDVVVAASASVASQFLKTHDAKFASRPPNSGAEHIAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFS +ALDDF HVRQEEVA LTR LA AG + VKLGQLL
Sbjct  120  GPRWRMLRKICSVHLFSGKALDDFRHVRQEEVAILTRVLAGAGNSTVKLGQLL  172



>ref|NP_001289844.1| flavonoid 3'-monooxygenase [Solanum lycopersicum]
 gb|ADK56284.1| putative flavonoid 3' hydroxylase CYP75B49 [Solanum lycopersicum]
Length=514

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYF-LILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  181
            MA   LI  T++ +I L+F L L  ++RYP+PLPPGPKPWP++GN+  LG KPHQS A+M
Sbjct  1    MAIFFLILYTIISSIILHFSLSLFFRKRYPVPLPPGPKPWPIIGNIIQLGPKPHQSTASM  60

Query  182  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  361
            A  YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPLMHLRMGFVDVVVAASASVAAQFLKNHDANFSSRPPNSGAKHMAYNYHDLVFAP  120

Query  362  YGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            YGPRWRMLRKI SVHLFS +ALDDF HVRQEEV TLTR+LA+AG+ P+KLGQLL
Sbjct  121  YGPRWRMLRKICSVHLFSTKALDDFRHVRQEEVRTLTRALANAGQNPIKLGQLL  174



>gb|ABM46853.1| flavonoid 3'-hydroxylase [Ageratina adenophora]
Length=510

 Score =   208 bits (529),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 147/173 (85%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  LTL+  T + A+  Y L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MTILTLLLYTSISALAFY-LLLNLRTRHPKRLPPGPTPWPIVGNLPHLGTVPHHSLAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
             +YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NF++RPPNSGA+HIAYNY DLVFAPY
Sbjct  60   TKYGPLMHLRLGFVDVVVAASASVASQFLKSHDANFASRPPNSGAKHIAYNYHDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFSA++LDDF HVRQEEVA LTR L SAG+T VKLGQLL
Sbjct  120  GPRWRMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRVLISAGETTVKLGQLL  172



>gb|AIY22747.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score =   207 bits (528),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 148/174 (85%), Gaps = 1/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  181
            MA   +I  T++F+  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQSIA M
Sbjct  1    MAIFFIILYTIIFSFLLHSILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSIADM  60

Query  182  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  361
            A  YGP MHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPFMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAP  120

Query  362  YGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            YGPRWRMLRKI SVHLFSA+ALDDF HVRQEEV TLTR+LA+A + PVKLGQLL
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLL  174



>gb|AIY22748.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score =   207 bits (528),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 148/174 (85%), Gaps = 1/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  181
            MA   +I  T++F+  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQSIA M
Sbjct  1    MAIFFIILYTIIFSFLLHSILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSIADM  60

Query  182  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  361
            A  YGP MHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPFMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAP  120

Query  362  YGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            YGPRWRMLRKI SVHLFSA+ALDDF HVRQEEV TLTR+LA+A + PVKLGQLL
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLL  174



>dbj|BAJ17668.1| flavonoid 3' hydroxylase [Gynura bicolor]
Length=511

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 145/173 (84%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  LTL+  T + A+ LY L L +  R+P  LPPGP PWP++GNLPHLG  PH  +AA+A
Sbjct  1    MTILTLVLYTSIIALVLYVL-LNLFTRHPNRLPPGPTPWPIVGNLPHLGSIPHHGLAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
             +YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   TKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRKI SVHLFS++ALDDF HVRQEEVA LTR L  A K+PVKLGQLL
Sbjct  120  GPRWRLLRKICSVHLFSSKALDDFRHVRQEEVAILTRDLVGAKKSPVKLGQLL  172



>gb|KDP31334.1| hypothetical protein JCGZ_11710 [Jatropha curcas]
Length=511

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG KPHQS+AA+A  YGPLMHLR+GFVDVVVAASAAVA QFLKVHD+NFS+RPPN
Sbjct  39   GNLPHLGPKPHQSLAALARSYGPLMHLRMGFVDVVVAASAAVATQFLKVHDANFSSRPPN  98

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
             GA+++AYNYQDLVFAPYGPRWRMLRKI+SVHLFS +ALDDF H+RQ+EV+ LTR+LASA
Sbjct  99   CGAKYVAYNYQDLVFAPYGPRWRMLRKISSVHLFSGKALDDFRHIRQQEVSVLTRALASA  158

Query  491  GKTPVKLGQLL  523
            G TPV LGQLL
Sbjct  159  GPTPVNLGQLL  169



>gb|ACO35753.1| flavonoid 3'-hydroxylase [Bidens aurea]
Length=512

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG  PH S+AA+A +YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NF++RPPN
Sbjct  42   GNLPHLGTVPHHSLAALAAKYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFASRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGAEHIAYNYQDLVFAPYGPRWRMLRKI SVHLFS +ALDD+ HVRQEEVA LTR+L  A
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDYRHVRQEEVAILTRALVGA  161

Query  491  GKTPVKLGQLL  523
            GK PVKLGQLL
Sbjct  162  GKAPVKLGQLL  172



>gb|ADA85883.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
 gb|AGX01487.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 144/173 (83%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRKI SVHLFSA+ALDDF HVRQEEVA LTR L SAG +PV+LGQLL
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLL  172



>gb|ADA85879.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 144/173 (83%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRKI SVHLFSA+ALDDF HVRQEEVA LTR L SAG +PV+LGQLL
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLL  172



>gb|ADA85882.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 144/173 (83%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRKI SVHLFSA+ALDDF HVRQEEVA LTR L SAG +PV+LGQLL
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLL  172



>gb|ACN65825.1| flavonoid 3'-hydroxylase [Cichorium intybus]
Length=511

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  LTLI    V  I  Y L L ++ R    LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MTLLTLIIYACVTGIAAYVL-LNLRNRRAKRLPPGPTPWPIVGNLPHLGTIPHHSLAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
             RYGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   TRYGPLMHLRLGFVDVVVAASASVAAQFLKAHDANFASRPPNSGAKHMAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFSA++LDDF HVRQEEVA LTR+L  AGK+ V LGQLL
Sbjct  120  GPRWRMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRALVDAGKSTVILGQLL  172



>gb|ADA85878.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 144/173 (83%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRKI SVHLFSA+ALDDF HVRQEEVA LTR L SAG +PV+LGQLL
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLL  172



>ref|XP_009338402.1| PREDICTED: flavonoid 3'-monooxygenase [Pyrus x bretschneideri]
Length=511

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
             LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPSGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            RMLRKI+SVHLFS +ALDD  HVRQEEV  L   LASAG  PV L QLL
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSRPVNLAQLL  171



>gb|AFI25037.1| flavonoid 3'-hydroxylase, partial [Populus deltoides x Populus 
tremuloides]
Length=201

 Score =   197 bits (500),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 143/162 (88%), Gaps = 3/162 (2%)
 Frame = +2

Query  47   IFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLG  220
            IF+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ YGPLMHLR G
Sbjct  1    IFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPVPHHSMAALAKTYGPLMHLRFG  60

Query  221  FvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS  400
            FVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPRWRMLRKI+S
Sbjct  61   FVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKISS  120

Query  401  VHLFSAQALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLL  523
            VHLFSA++LDDF H+RQEEVA LT +L  +G  TPV LGQLL
Sbjct  121  VHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLL  162



>ref|XP_010695197.1| PREDICTED: flavonoid 3'-monooxygenase [Beta vulgaris subsp. vulgaris]
Length=512

 Score =   205 bits (522),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+ L L F T+  AIF+Y+LI  +  RYP PLPPGPKPWP++GNLPH+G  PHQ +A +A
Sbjct  1    MSPLELTFYTIALAIFIYYLITTIFSRYPGPLPPGPKPWPIVGNLPHMGPVPHQGLAKLA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPL+HLRLG+V VVVAASA+VAA+FLK HD+NFS+RPPNSGA++IAYNYQDLVFAPY
Sbjct  61   QKYGPLLHLRLGYVHVVVAASASVAAEFLKAHDANFSSRPPNSGAKYIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLL  523
            GPRWRMLRKI+S+HLFSA+AL+D+  +RQEEVA LT++LA +G   P++LGQLL
Sbjct  121  GPRWRMLRKISSLHLFSAKALEDYKPIRQEEVAILTKALAKSGSNNPIQLGQLL  174



>ref|XP_011072866.1| PREDICTED: flavonoid 3'-monooxygenase [Sesamum indicum]
Length=511

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 145/171 (85%), Gaps = 3/171 (2%)
 Frame = +2

Query  11   TLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  190
            TLTLI  T +  +FLY  + R   R  + LPPGP+PWP++GNL  LG KPHQS+AA+A  
Sbjct  4    TLTLIVYTSILCLFLYSFLRR---RRSVRLPPGPRPWPIVGNLLQLGPKPHQSMAALARV  60

Query  191  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  370
            YGPLMHL++GFV+VVVAASA VA QFLKVHD+NFSNRPPN+GAE++AYNYQD+VFAPYGP
Sbjct  61   YGPLMHLKMGFVNVVVAASAGVAEQFLKVHDANFSNRPPNAGAEYVAYNYQDMVFAPYGP  120

Query  371  RWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            RWR+LRKI +VH+FSA+ALDDF HVRQEEV  LTR+LASAG+TP +LGQ+L
Sbjct  121  RWRLLRKICAVHVFSAKALDDFRHVRQEEVGILTRALASAGQTPARLGQML  171



>gb|ADA85881.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 144/173 (83%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRKI SVHLFSA+ALDDF HVRQE+VA LTR L SAG +PV+LGQLL
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEKVAVLTRVLVSAGNSPVQLGQLL  172



>gb|ACR14867.1| flavonoid 3' hydroxylase [Malus domestica]
Length=511

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
             LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPGGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            R+LRKI+SVHLFS +ALDD  HVRQEEV  L   LASAG  PV L QLL
Sbjct  123  RLLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLAQLL  171



>gb|ADZ54783.1| flavonoid 3'-monooxygenase [Prunus avium]
Length=510

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = +2

Query  20   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  199
            LIF T+VFA FLY L++    R+ LPL PGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLVP-GNRHSLPLAPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  200  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  379
            LMHLRLGFVDV+VAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVIVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  380  MLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            MLRKI+SVHLFS +ALDD  HVRQEEVA L  SLA AG   V L QLL
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHSLAGAGSKTVNLAQLL  170



>ref|XP_008393217.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=511

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
             LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPGGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            R+LRKI+SVHLFS +ALDD  HVRQEEV  L   LASAG  PV L QLL
Sbjct  123  RLLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLAQLL  171



>ref|XP_010259651.1| PREDICTED: flavonoid 3'-monooxygenase [Nelumbo nucifera]
Length=513

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 140/173 (81%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L  +  TL  A  +YFL   +  RYP PLPPGPKPWP++GNLPHLG  PH S+AAMA
Sbjct  1    MTLLAFVSFTLFVAFLIYFL-FNLLNRYPRPLPPGPKPWPIIGNLPHLGTVPHHSLAAMA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
              YGPL+HLRLG V VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   RTYGPLLHLRLGSVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEVA L R+LA AGK  V +GQLL
Sbjct  120  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLIRALAGAGKAAVNVGQLL  172



>ref|XP_006399285.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
 gb|ESQ40738.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
Length=510

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            +T +F T++ A F++ L+L    R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTTLFITILLATFIFLLVLLFSLRRNHRLPPGPNPWPIIGNLPHMGHKPHQTLAAMVTTY  60

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GP+++LRLGF DVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILYLRLGFADVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            WRMLRKI+SVHLFSA+AL+DF HVRQEEV TL R L+ AG  PV LGQL+
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELSRAGTKPVNLGQLV  170



>gb|ABY89687.1| flavonoid 3` hydroxylase 1 protein [Brassica rapa subsp. oleifera]
Length=511

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            WRMLRKI+SVHLFSA+AL+DF HVRQEEV TL R LA A   PV LGQL+
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLVRELARANTKPVNLGQLV  170



>ref|XP_007209917.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
 gb|AFC62055.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|EMJ11116.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
Length=510

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  20   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  199
            LIF T+VFA  LY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAALLYRLLFS-GNRHSLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  200  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  379
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  380  MLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            MLRKI+SVHLFS +ALDD  HVRQEEVA L   LA AG  PV L QLL
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHGLAGAGSKPVNLAQLL  170



>gb|AJA79074.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|AJA79081.1| flavonoid 3' hydroxylase [Prunus persica]
Length=509

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  20   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  199
            LIF T+VFA  LY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  9    LIFITVVFAALLYRLLFS-GNRHSLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  67

Query  200  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  379
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  68   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  127

Query  380  MLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            MLRKI+SVHLFS +ALDD  HVRQEEVA L   LA AG  PV L QLL
Sbjct  128  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHGLAGAGSKPVNLAQLL  175



>ref|XP_010491421.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            +T +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTTLFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            WRMLRKI+SVHLFSA+AL+DF HVRQEEVAT+TR LA  G   V LGQL+
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVATMTRELAQVGTKAVNLGQLV  170



>ref|XP_002319761.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
 gb|EEE95684.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
Length=521

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 148/171 (87%), Gaps = 3/171 (2%)
 Frame = +2

Query  20   LIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            LI  + + AIF+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ Y
Sbjct  4    LILYSALLAIFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPMPHHSMAALAKTY  63

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GPLMHLR GFVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRFGFVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPR  123

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLL  523
            WRMLRKI+SVHLFSA++LDDF H+RQEEVA LT +L  +G  TPV LGQLL
Sbjct  124  WRMLRKISSVHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLL  174



>emb|CDX69984.1| BnaA10g23330D [Brassica napus]
Length=511

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            WRMLRKI+SVHLFSA+AL+DF HVRQEEV TL R LA A   PV LGQL+
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLV  170



>gb|ABC58722.1| flavonoid 3'-hydroxylase [Brassica napus]
 gb|ABC58723.1| flavonoid 3'-hydroxylase [Brassica napus]
Length=511

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            WRMLRKI+SVHLFSA+AL+DF HVRQEEV TL R LA A   PV LGQL+
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLV  170



>gb|AEA06595.1| flavonoid 3'-hydroxylase [Chromolaena odorata]
Length=507

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 146/173 (84%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+ L  +  T + A+ +++L+L ++ R+   LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MSILISLLYTFITAL-VFYLLLNLRPRHSKRLPPGPSPWPIVGNLPHLGTIPHHSLAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+HIAYNY DLVFAPY
Sbjct  60   KKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHIAYNYHDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEVA LTR L  AG++ VKLGQLL
Sbjct  120  GPRWRMLRKICSVHLFSTKALDDFRHIRQEEVAILTRVLVGAGESTVKLGQLL  172



>gb|ABC47161.1| flavonoid 3'-hydroxylase [Pilosella officinarum]
Length=512

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L+LI    +  +  Y L+  ++ R    LPPGP PWP++GNLPHLG  PH S+A +A
Sbjct  1    MTLLSLIIYLCITGVTAYVLV-NLRTRRANRLPPGPTPWPIVGNLPHLGTIPHHSLADLA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
             RYGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   TRYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFSA++LDDF HVRQEEVA LTR+L  AGK+ VKLGQLL
Sbjct  120  GPRWRMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRALVGAGKSTVKLGQLL  172



>ref|XP_009122411.1| PREDICTED: flavonoid 3'-monooxygenase [Brassica rapa]
Length=511

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            WRMLRKI+SVHLFSA+AL+DF HVRQEEV TL R LA A   PV LGQL+
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLV  170



>ref|XP_007037547.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY22048.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
Length=501

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
            + +  +++ A+FLYF+   +++R+ LPLPPGPKPWP++GNLPH+G  PH S+AA+A+ YG
Sbjct  3    SFLLYSILSAVFLYFIFATLRKRHRLPLPPGPKPWPIIGNLPHMGPVPHHSLAALAKVYG  62

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLGFVDVVVAASA+VAAQFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVAAQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPYGPRW  122

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            RMLRKI+SVHLFS +ALDDF HVRQ+EV  L R+LA A KT V LGQLL
Sbjct  123  RMLRKISSVHLFSGKALDDFRHVRQDEVGVLVRALADA-KTKVNLGQLL  170



>gb|KDO54631.1| hypothetical protein CISIN_1g020877mg [Citrus sinensis]
Length=320

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  47   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  106

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+SVHLFS +ALDD+ HVRQEE+A LTR+LASA
Sbjct  107  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASA  166

Query  491  GKTPVKLGQLL  523
            G  PV L Q L
Sbjct  167  GTEPVNLAQRL  177



>gb|ABY89688.1| flavonoid 3` hydroxylase 2 protein [Brassica rapa subsp. oleifera]
Length=511

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            WRMLRKI+SVHLFSA+AL+DF HVRQEEV TL R LA A   PV LGQL+
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLV  170



>ref|XP_007037548.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
 gb|EOY22049.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
Length=507

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
            + +  +++ A+FLYF+   +++R+ LPLPPGPKPWP++GNLPH+G  PH S+AA+A+ YG
Sbjct  3    SFLLYSILSAVFLYFIFATLRKRHRLPLPPGPKPWPIIGNLPHMGPVPHHSLAALAKVYG  62

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLGFVDVVVAASA+VAAQFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVAAQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPYGPRW  122

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            RMLRKI+SVHLFS +ALDDF HVRQ+EV  L R+LA A KT V LGQLL
Sbjct  123  RMLRKISSVHLFSGKALDDFRHVRQDEVGVLVRALADA-KTKVNLGQLL  170



>gb|ACV74415.1| putative flavonoid-3'-hydroxylase [Camellia sinensis]
Length=518

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 145/177 (82%), Gaps = 4/177 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLI-LRVK--QRYplplppgpkpwpvlGNLPHLGKKPHQSIA  175
            M +L  +  +L+ A+FLY L+ LR     R+P PLPPGP PWPV+GNLPHLG  PH SIA
Sbjct  1    MTSLAFVLYSLLIAVFLYCLLNLRTLLFNRHPRPLPPGPTPWPVIGNLPHLGTMPHHSIA  60

Query  176  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  355
             MA  YGPLMHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF
Sbjct  61   TMARTYGPLMHLRLGLVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVF  120

Query  356  APYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGK-TPVKLGQLL  523
            APYGPRWRMLRKI SVHLFS +ALDDF HVRQEE+A LTR+L SAG+   V LGQLL
Sbjct  121  APYGPRWRMLRKICSVHLFSTKALDDFRHVRQEEIAILTRALESAGQAAAVNLGQLL  177



>gb|ADB77825.1| flavonoid 3'-hydroxylase allele 1 [Dahlia pinnata]
Length=508

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG  PH S+AA+AE+YGPLMHLR GFVDVVVAASA+VA+QFLK HD+ F++RPPN
Sbjct  42   GNLPHLGTIPHHSLAALAEKYGPLMHLRFGFVDVVVAASASVASQFLKTHDAKFASRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGAEHIAYNYQDLVFAPYGPRWRMLRKI SVHLFS +ALDDF HVRQEEVA LTR LA A
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDFRHVRQEEVAILTRVLAGA  161

Query  491  GKTPVKLGQLL  523
            G + VKLGQLL
Sbjct  162  GNSTVKLGQLL  172



>ref|XP_011011227.1| PREDICTED: flavonoid 3'-monooxygenase [Populus euphratica]
Length=521

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 148/171 (87%), Gaps = 3/171 (2%)
 Frame = +2

Query  20   LIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            LI  + + A+F+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ Y
Sbjct  4    LILYSALVAVFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPMPHHSMAALAKTY  63

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GPLMHLR GFVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRFGFVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPR  123

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLL  523
            WRMLRKI+SVHLFSA++LDDF H+RQEEVA LT +L  +G  TPV LGQLL
Sbjct  124  WRMLRKISSVHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLL  174



>ref|XP_010423152.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 139/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            +T +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPH+++ AM   Y
Sbjct  1    MTTLFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHRTLTAMVTTY  60

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            WRMLRKI+SVHLFSA+ALDDF HVRQEEVATLTR LA  G   V LGQL+
Sbjct  121  WRMLRKISSVHLFSAKALDDFKHVRQEEVATLTRELAQVGTKAVNLGQLV  170



>ref|XP_009771410.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Nicotiana sylvestris]
Length=515

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 147/174 (84%), Gaps = 1/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  181
            MA  +LI  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQSIAAM
Sbjct  1    MAIFSLILYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSIAAM  60

Query  182  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  361
            A  YGPLMHL++GFVDVVVAASA+VAAQFLK HD+NFS+RP NS  +H+AYN QDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVAASASVAAQFLKTHDANFSSRPQNSCTKHLAYNSQDLVFAP  120

Query  362  YGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            YGPRWRMLRKI SVHLFSA+ LDDF HVRQ EV  LTR+LASAG+ PVKLGQLL
Sbjct  121  YGPRWRMLRKICSVHLFSAKPLDDFRHVRQNEVRILTRALASAGQKPVKLGQLL  174



>gb|AGC29948.1| CYP75B65 [Sinopodophyllum hexandrum]
Length=510

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+ + LI  TLV    +Y +I ++  R PLPLPPGPKPWP++GNLPHLG  PH S+A++A
Sbjct  1    MSPIELILSTLVIGTIVYTIISKLINRTPLPLPPGPKPWPIVGNLPHLGPVPHHSLASLA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
             +YGPLMHLRLG V+V+VAAS++VA Q  K HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   SKYGPLMHLRLGSVNVIVAASSSVAVQIFKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GP+WRMLRKI SVHLFSA+ALDDF H+RQEEV  LT+ L  AGK PV L +LL
Sbjct  121  GPKWRMLRKICSVHLFSAKALDDFRHIRQEEVMVLTKVLLGAGKAPVDLAKLL  173



>dbj|BAN62871.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=513

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+ L L F T+V A  LY+LI  V + +  PLPPGP+PWP++GNLPH+G+ PHQ +AA+A
Sbjct  1    MSPLELTFYTIVLATILYYLITTVFRGHQKPLPPGPRPWPIVGNLPHMGQAPHQGLAALA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPL+++RLG+VDVVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   QKYGPLLYMRLGYVDVVVAASASVATQFLKTHDLNFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GP+WRMLRKI S+H+FS++ALDDF  VRQEEV+ L  ++A AG  PV+LGQLL
Sbjct  121  GPKWRMLRKICSLHMFSSKALDDFRLVRQEEVSILVNAIAKAGTKPVQLGQLL  173



>dbj|BAF49324.1| flavonoid 3'-hydroxylase [Lobelia erinus]
Length=515

 Score =   202 bits (515),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 140/177 (79%), Gaps = 7/177 (4%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLI-------LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSI  172
            ++LIF T + A  LY L+       L        PLPPGPKPWP++GNLPHLG  PHQ++
Sbjct  1    MSLIFYTCIIAFLLYVLLSTLRTFLLNRNPASRKPLPPGPKPWPIVGNLPHLGTMPHQTM  60

Query  173  AAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLV  352
            AA+A  YGPLMHLRLG VDVVVAAS AVA QFLKVHD+NF NRPPNSGA HIAYNYQDLV
Sbjct  61   AALARTYGPLMHLRLGSVDVVVAASGAVAEQFLKVHDANFLNRPPNSGAVHIAYNYQDLV  120

Query  353  FAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            FAPYGPRWR+LRK+++VHLFSA+ALDDF HVRQEEVA LTR LASAG  PV L QLL
Sbjct  121  FAPYGPRWRLLRKVSAVHLFSAKALDDFRHVRQEEVAVLTRDLASAGNAPVHLNQLL  177



>ref|XP_010030596.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83708.1| hypothetical protein EUGRSUZ_B00582 [Eucalyptus grandis]
Length=514

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MA L+LI  T+  + FLY L L    R   PLPPGP+PWP++GNLPHLG  PH SIAA+A
Sbjct  1    MALLSLILATVAISAFLYSL-LGYLSRPARPLPPGPRPWPLVGNLPHLGPVPHHSIAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
              YGPLMHLRLGFVDVVVAASA+VAA+FLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   RTYGPLMHLRLGFVDVVVAASASVAAEFLKTHDTNFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI+SVHLFS +AL+D+ HVRQEEVA LT +LA AG  P  L QLL
Sbjct  120  GPRWRMLRKISSVHLFSGKALEDYRHVRQEEVAILTSALARAGSAPANLAQLL  172



>gb|KDO37751.1| hypothetical protein CISIN_1g042286mg, partial [Citrus sinensis]
Length=303

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  47   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  106

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+SVHLFS +ALDD+ HVRQEE+A L R+LASA
Sbjct  107  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLARALASA  166

Query  491  GKTPVKLGQLL  523
            G  PV L Q L
Sbjct  167  GTEPVNLAQRL  177



>ref|XP_002871298.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47557.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
Length=514

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            LT++  T++F   L    LR  + + + LPPGP PWP++GNLPH+G KPH+++AAM   Y
Sbjct  6    LTILLATVIFLFLLRVFSLRRNRSHNIRLPPGPNPWPIIGNLPHMGPKPHRTLAAMVSTY  65

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  66   GPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  125

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            WR+LRKI+SVHLFSA+AL+DF HVRQEEV TLTR LA  G  PV LGQL+
Sbjct  126  WRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELARVGTKPVNLGQLV  175



>ref|XP_008240031.1| PREDICTED: flavonoid 3'-monooxygenase [Prunus mume]
Length=510

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = +2

Query  20   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  199
            LIF T+VFA FLY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLFS-GNRHFLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  200  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  379
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  380  MLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            MLRKI+SVHLFS +ALDD  HVRQEE+A L   LA AG   V L QLL
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEIAVLAHGLAGAGSKTVNLAQLL  170



>gb|ACO35754.1| flavonoid 3'-hydroxylase [Dahlia pinnata]
Length=509

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 147/173 (85%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MA LTL+  T + +  LY L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+A +A
Sbjct  1    MAILTLLLYTSITSPVLY-LLLNLRTRHPNRLPPGPTPWPIVGNLPHLGTIPHHSLARLA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
             +YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   VKYGPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPNSGAKHIAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFSA+ALDDF H+RQEEVA LTR+L  AG++ VKLGQLL
Sbjct  120  GPRWRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGAGESTVKLGQLL  172



>emb|CDX99037.1| BnaC09g47980D [Brassica napus]
Length=717

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            WRMLRKI+SVHLFSA+AL+DF HVRQEEV TL R LA A   PV LGQL+
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLV  170



>gb|ADA85880.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPL HLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAP 
Sbjct  60   KKYGPLTHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPC  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRKI SVHLFSA+ALDDF HVRQEEVA LTR L SAG +PV+LGQLL
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLL  172



>gb|ACO35756.1| flavonoid 3'-hydroxylase [Tagetes erecta]
Length=509

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 147/173 (85%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+ LTL+  T + +  LY L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+A +A
Sbjct  1    MSILTLLLYTSITSPVLY-LLLNLRTRHPNRLPPGPTPWPIVGNLPHLGTIPHHSLARLA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
             +YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   VKYGPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPNSGAKHIAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLFSA+ALDDF H+RQEEVA LTR+L  AG++ VKLGQLL
Sbjct  120  GPRWRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGAGESTVKLGQLL  172



>gb|AIY51699.1| flavonoid 3'-hydroxylase [Penstemon barbatus]
Length=517

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 143/175 (82%), Gaps = 3/175 (2%)
 Frame = +2

Query  8    ATLTLIFCTLVFAIFLYFLILRVKQRYplpl---ppgpkpwpvlGNLPHLGKKPHQSIAA  178
            A +TL+ CT +    L + I +  QR        PPGP+PWP++GNLP LG KPHQ++AA
Sbjct  3    AAITLLICTSILGFLLLYWIFQRPQRKAKSTLPLPPGPRPWPIIGNLPQLGPKPHQTMAA  62

Query  179  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  358
            +A  +GPLMHL++GFV VVVAASA++A QFLKV+D+NFS+RPPN+GA+++AYNYQDLVFA
Sbjct  63   LARVHGPLMHLKMGFVHVVVAASASMAEQFLKVNDANFSSRPPNAGAKYVAYNYQDLVFA  122

Query  359  PYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            PYGPRWR+LRKI ++HLFSA+ALDDF HVRQEEV  LTR+LASAG+  +KLGQ+L
Sbjct  123  PYGPRWRLLRKICALHLFSAKALDDFRHVRQEEVGILTRTLASAGEMQMKLGQML  177



>gb|ABB53383.1| flavonoid-3'-hydroxylase [Antirrhinum majus]
Length=520

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 142/171 (83%), Gaps = 3/171 (2%)
 Frame = +2

Query  11   TLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  190
            T  L+ CT +    L +  L    R   PLPPGPKPWP++GNLPHLG KPHQS+AA+A  
Sbjct  17   TSLLVPCTFILGFLLLYSFL---NRKVKPLPPGPKPWPIVGNLPHLGPKPHQSMAALARV  73

Query  191  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  370
            +GPL+HL++GFV VVVA+SA+VA +FLKVHD+NFS+RPPNSGA+H+AYNYQDLVFAPYGP
Sbjct  74   HGPLIHLKMGFVHVVVASSASVAEKFLKVHDANFSSRPPNSGAKHVAYNYQDLVFAPYGP  133

Query  371  RWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            RWRMLRKI ++HLFSA+AL+DF HVRQ+EV  LTR LA AG+TP+KLGQ++
Sbjct  134  RWRMLRKICALHLFSAKALNDFTHVRQDEVGILTRVLADAGETPLKLGQMM  184



>dbj|BAN05297.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=514

 Score =   200 bits (508),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+ L L F T+  A  LY+LI  V + +  PLPPGP+PWP++GNLPH+G+ PHQ +AA+A
Sbjct  1    MSPLELTFYTIALATILYYLIPTVFRGHQKPLPPGPRPWPIVGNLPHMGQAPHQGLAALA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPL+++RLG+VDVVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   QKYGPLLYMRLGYVDVVVAASASVATQFLKTHDLNFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GP+WRMLRKI S+H+FS++ALDDF  VRQEEV+ L  ++A AG  PV+LGQLL
Sbjct  121  GPKWRMLRKICSLHMFSSKALDDFRLVRQEEVSILVNAIAKAGTKPVQLGQLL  173



>gb|KJB51033.1| hypothetical protein B456_008G198200 [Gossypium raimondii]
Length=422

 Score =   197 bits (502),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
            + +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            R+LRKI+S+HLFS +ALDDF  +R+EE+  L R+LASA KT V LGQLL
Sbjct  123  RLLRKISSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLL  170



>gb|AJD25177.1| cytochrome P450 CYP75B79 [Salvia miltiorrhiza]
Length=511

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 145/173 (84%), Gaps = 2/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M++LTL+ C+ V    L + IL   +R P  LPPGP+PWP++GNLP LG KPHQS+AA+A
Sbjct  3    MSSLTLLVCSAVLGFLLLYSIL--VRRRPEKLPPGPRPWPIVGNLPQLGPKPHQSMAALA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHL++GFV VVVAASAAVA QFLK HD+NFS+RPPN+GA+++AYNYQDLVFAPY
Sbjct  61   QVYGPLMHLKMGFVHVVVAASAAVAQQFLKAHDANFSSRPPNAGAKYVAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRKI ++HLFSA+ALDDF HVRQEE   L  +LASAG+ PV+LGQ+L
Sbjct  121  GPRWRLLRKICALHLFSAKALDDFRHVRQEEAGILCGALASAGQMPVRLGQML  173



>gb|AAG49298.1|AF313488_1 putative flavonoid 3'-hydroxylase [Callistephus chinensis]
Length=518

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG  PH S+AA+A++YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPN
Sbjct  42   GNLPHLGMIPHHSLAALAQKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI SVHLFS +ALDDF HVR+EEVA LTR L  A
Sbjct  102  SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVREEEVAILTRVLVHA  161

Query  491  GKTPVKLGQLL  523
            G++ VKLGQLL
Sbjct  162  GESAVKLGQLL  172



>ref|XP_010452770.1| PREDICTED: flavonoid 3'-monooxygenase [Camelina sativa]
Length=509

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = +2

Query  23   IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  202
            +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPH+++ AM   YGP+
Sbjct  4    LFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHRALTAMVTTYGPI  63

Query  203  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  382
            +HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWRM
Sbjct  64   LHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  383  LRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            LRKI+SVHLFSA+AL+DF HVRQEEVATLTR LA  G   V LGQL+
Sbjct  124  LRKISSVHLFSAKALEDFKHVRQEEVATLTRELAQVGTKAVNLGQLV  170



>gb|KHG07922.1| Flavonoid 3',5'-hydroxylase [Gossypium arboreum]
Length=510

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
            + +  +++  +FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSTVFLYFVFIISRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            R+LRKI+SVHLFS +ALDDF H+R+EE+  L R+LASA KT V LGQLL
Sbjct  123  RLLRKISSVHLFSGKALDDFRHIREEEIRVLVRALASA-KTKVNLGQLL  170



>ref|XP_010258076.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
 ref|XP_010258077.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
Length=516

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 140/173 (81%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L L+  T  F  FL +  L    RYP PLPPGPKPWP++GNLPHLG  PH +IAA+A
Sbjct  1    MTPLALVALT-SFVAFLIYFFLNFSNRYPRPLPPGPKPWPIIGNLPHLGPVPHHTIAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
              YGPL+HLRLG V VVVAASA+VA+QFLK HD+NFS+RPPNSGA+HIAYNY DLVFAPY
Sbjct  60   RVYGPLLHLRLGSVHVVVAASASVASQFLKTHDANFSSRPPNSGAKHIAYNYHDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRKI SVHLFS +ALDDF HVRQEEVA LTR+L+ +G +P+ +GQLL
Sbjct  120  GPRWRLLRKICSVHLFSGKALDDFRHVRQEEVAVLTRALSRSGTSPLNVGQLL  172



>dbj|BAF96945.1| flavonoid 3'-hydroxylase [Rhododendron x pulchrum]
Length=480

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 117/132 (89%), Gaps = 1/132 (1%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG  PH SIAA+A  YGPLMHL +G V VVVAASA+VAAQFLK HD+NFS+RPPN
Sbjct  7    GNLPHLGTMPHHSIAALAREYGPLMHLWMGSVHVVVAASASVAAQFLKTHDANFSSRPPN  66

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI SVHLFSA+ALDDF HVRQEEVA LTR+LA+A
Sbjct  67   SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVAILTRALANA  126

Query  491  GK-TPVKLGQLL  523
            GK T V LGQLL
Sbjct  127  GKSTTVNLGQLL  138



>ref|XP_006440736.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
 gb|ESR53976.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
Length=538

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 146/178 (82%), Gaps = 4/178 (2%)
 Frame = +2

Query  2    SMATLTL-IFCTLVFAI---FLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQS  169
            +M+TL L I  T + AI   FL+ L+   ++     LPPGPKPWP++GNLPHLG  PHQS
Sbjct  22   AMSTLPLLILYTSLLAIVISFLFSLLRNRRRHSSHRLPPGPKPWPIVGNLPHLGPMPHQS  81

Query  170  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  349
            IA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPNSGA+HIAYNYQD+
Sbjct  82   IAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPNSGAKHIAYNYQDI  141

Query  350  VFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            VF PYGPRWRMLRKI+SVHLFS +ALDD+ HVRQEE+A LTR+LASAG  PV L Q L
Sbjct  142  VFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGTEPVNLAQRL  199



>gb|ACN65826.1| flavonoid 3'-hydroxylase [Echinops bannaticus]
Length=508

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG+ PH S+A +A +YGPL+HLRLGFVDVVVA SA+VAAQFLKVHD+NF++RPPN
Sbjct  44   GNLPHLGRVPHHSLADLATKYGPLLHLRLGFVDVVVAGSASVAAQFLKVHDANFASRPPN  103

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+H+AYNYQD+VFAPYGP+WRMLRKI SVHLFS +ALDDF HVRQEEVA L R+L  A
Sbjct  104  SGAKHMAYNYQDMVFAPYGPKWRMLRKICSVHLFSTKALDDFRHVRQEEVAILARALVGA  163

Query  491  GKTPVKLGQLL  523
            G++ VKLGQLL
Sbjct  164  GESTVKLGQLL  174



>gb|AEF30421.1| flavonoid 3'-hydroxylase, partial [Fagopyrum tataricum]
Length=277

 Score =   191 bits (485),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPH+G  PH S+AA+A+ YGPLMHLRLG V V++AASA+VA+QFLK HD+NFS+RPPN
Sbjct  6    GNLPHMGAVPHHSLAALAKVYGPLMHLRLGSVHVIIAASASVASQFLKTHDANFSSRPPN  65

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI  VHLFS +AL+DF  VR+EEV  LTR+L+ A
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKICQVHLFSGKALEDFRFVREEEVGILTRALSKA  125

Query  491  GKTPVKLGQLL  523
            GK  V+LGQLL
Sbjct  126  GKNAVQLGQLL  136



>gb|AIY51698.1| flavonoid 3'-hydroxylase [Penstemon neomexicanus]
Length=517

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 136/175 (78%), Gaps = 3/175 (2%)
 Frame = +2

Query  8    ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwp---vlGNLPHLGKKPHQSIAA  178
            A +TL+ CT +    L + I +  QR      P P       ++GNLP LG KPHQ++AA
Sbjct  3    AAITLLICTSILGFLLLYWIFQRPQRKAKLTLPLPPGPRPWPIIGNLPQLGPKPHQTMAA  62

Query  179  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  358
            +A  +GPLMHL++GFV VVVAASA++A QFLKV+D+NFS+RPPN+GA+++AYNYQDLVFA
Sbjct  63   LARVHGPLMHLKMGFVHVVVAASASMAEQFLKVNDANFSSRPPNAGAKYVAYNYQDLVFA  122

Query  359  PYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            PYGPRWR+LRKI ++HLFSA+ALDDF HVRQEEV  LTR+LASAG+  + LGQ+L
Sbjct  123  PYGPRWRLLRKICALHLFSAKALDDFRHVRQEEVGILTRTLASAGEMQMILGQML  177



>gb|KJB51032.1| hypothetical protein B456_008G198200 [Gossypium raimondii]
Length=510

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
            + +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            R+LRKI+S+HLFS +ALDDF  +R+EE+  L R+LASA KT V LGQLL
Sbjct  123  RLLRKISSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLL  170



>gb|ADK56126.1| putative flavonoid 3'-hydroxylase [Coreopsis grandiflora]
Length=512

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  LTLI    V  I  Y L L ++ R    LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MTLLTLIIYACVTGIAAYVL-LNLRNRRAKRLPPGPTPWPIVGNLPHLGTIPHHSLAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
             RYGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RP +SG +H+AYNYQDLVFAPY
Sbjct  60   TRYGPLMHLRLGFVDVVVAASASVAAQFLKAHDANFASRPLSSGGKHMAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI SVHLF A++LDDF HVRQEEVA LTR+L  AGK+ V LGQLL
Sbjct  120  GPRWRMLRKICSVHLFPAKSLDDFRHVRQEEVAILTRALVDAGKSTVILGQLL  172



>ref|XP_006477655.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=516

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  47   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  106

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+SVHLFS +ALDD+ HVRQEE+A L R+LASA
Sbjct  107  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLARALASA  166

Query  491  GKTPVKLGQLL  523
            G  PV L Q L
Sbjct  167  GTEPVNLAQRL  177



>dbj|BAB59005.1| flavonoid 3'-hydroxylase [Perilla frutescens var. crispa]
Length=523

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 140/173 (81%), Gaps = 1/173 (1%)
 Frame = +2

Query  8    ATLTLIFCTLVFAIFLYFLILR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            A ++LI CT +  + +YFL LR        PLPPGP+PWP++GNLP LG KPHQS+AA+A
Sbjct  4    AAVSLIICTSILGVLVYFLFLRRGGGSNGRPLPPGPRPWPIVGNLPQLGPKPHQSMAALA  63

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
              +GPLMHL++GFV VVVAASA VA +FLKVHD+NF +RPPNSGAEHIAYNY DLVFAP+
Sbjct  64   RVHGPLMHLKMGFVHVVVAASATVAEKFLKVHDTNFLSRPPNSGAEHIAYNYNDLVFAPH  123

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRKI ++HLFS++ALDDF HVR+EEV  L R+LAS G+ P  +GQ++
Sbjct  124  GPRWRLLRKICALHLFSSKALDDFRHVREEEVGILIRNLASVGEMPASIGQMM  176



>gb|ADP24158.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
 gb|ADP24159.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
            + +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            R+LRK++S+HLFS +ALDDF  +R+EE+  L R+LASA KT V LGQLL
Sbjct  123  RLLRKMSSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLL  170



>ref|NP_196416.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
 sp|Q9SD85.1|F3PH_ARATH RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B1; AltName: Full=Flavonoid 3'-hydroxylase; Short=AtF3'H; 
AltName: Full=Protein TRANSPARENT TESTA 7 [Arabidopsis 
thaliana]
 gb|AAF73253.1|AF155171_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16745.1|AF271650_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16746.1|AF271651_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 emb|CAB62611.1| flavonoid 3'-hydroxylase-like protein [Arabidopsis thaliana]
 gb|AAF60189.1| flavonoid 3'hydroxylase [Arabidopsis thaliana]
 gb|AED91232.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
Length=513

 Score =   195 bits (496),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 143/178 (80%), Gaps = 9/178 (5%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRV-----KQRYplplppgpkpwpvlGNLPHLGKKPHQS  169
            MATL   F T++ A  L FLILR+      + +   LPPGP PWP++GNLPH+G KPH++
Sbjct  1    MATL---FLTILLATVL-FLILRIFSHRRNRSHNNRLPPGPNPWPIIGNLPHMGTKPHRT  56

Query  170  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  349
            ++AM   YGP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDL
Sbjct  57   LSAMVTTYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDL  116

Query  350  VFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            VFAPYG RWR+LRKI+SVHLFSA+AL+DF HVRQEEV TLTR L   G  PV LGQL+
Sbjct  117  VFAPYGHRWRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELVRVGTKPVNLGQLV  174



>gb|ADM26615.1| flavonoid 3'-hydroxylase [Cynara cardunculus var. scolymus]
Length=512

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG+ PH ++AAMA +YGPLMHLRLG VDVVVAASA+VAAQFLKVHD+NF++RPPN
Sbjct  42   GNLPHLGRIPHHALAAMATKYGPLMHLRLGVVDVVVAASASVAAQFLKVHDANFASRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAY+YQDLVFAPYGP+WRMLRKI SVHLFS +ALDDF HVR+EEVA L R+LA A
Sbjct  102  SGAKHIAYDYQDLVFAPYGPKWRMLRKICSVHLFSNKALDDFRHVREEEVAILARALAGA  161

Query  491  GKTPVKLGQLL  523
            G++ V LGQLL
Sbjct  162  GRSTVALGQLL  172



>gb|AAG49301.1|AF313491_1 flavonoid 3'-hydroxylase [Matthiola incana]
Length=513

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPH+G KPHQ++AAM   YGP++HLRLGFV+VVVAAS +VA QFLK+HD+NF++RPPN
Sbjct  43   GNLPHMGPKPHQTLAAMVTTYGPILHLRLGFVNVVVAASKSVAEQFLKIHDANFASRPPN  102

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQDLVFAPYG RWRMLRKI+SVHLFSA+AL+DF HVRQEE+  LTR +A A
Sbjct  103  SGAKHIAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDFKHVRQEEIGRLTREVARA  162

Query  491  GKTPVKLGQLL  523
               PV LGQL+
Sbjct  163  DTKPVNLGQLV  173



>gb|ACY06905.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +2

Query  23   IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  202
            +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP +GNLPH+   PHQ +AAMA+ YGPL
Sbjct  5    VLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPSIGNLPHMSPVPHQGLAAMAKVYGPL  64

Query  203  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  382
            MHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRWR+
Sbjct  65   MHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRWRL  124

Query  383  LRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            LRK++S+HLFS +ALDDF  +R+EE+  L R+LASA KT V LGQLL
Sbjct  125  LRKMSSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLL  170



>gb|AHZ31753.1| flavonoid 3'-hydroxylase [Viola x wittrockiana]
Length=508

 Score =   194 bits (494),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG  PH++IAA+A  YGPLMHLRLG V+VVVAASA+VAAQFLK HDSNFS+RPPN
Sbjct  40   GNLPHLGPAPHRNIAALARTYGPLMHLRLGSVNVVVAASASVAAQFLKTHDSNFSSRPPN  99

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI+SVHLFS +ALDD  +VRQEEVA LTR+LASA
Sbjct  100  SGAKHIAYNYQDLVFAPYGPRWRMLRKISSVHLFSGKALDDGRYVRQEEVALLTRTLASA  159

Query  491  GKTPVKLGQLL  523
            G   V L QLL
Sbjct  160  GDAAVNLAQLL  170



>gb|AHY35313.1| flavonoid 3'-hydroxylase 1 [Morus notabilis]
Length=508

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 143/173 (83%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MA++T I  +++FA+ +Y L+  +  R    LPPGP+ WPV+GNLPHLG+ PHQ++A +A
Sbjct  1    MASITTILLSILFAVLVYRLVNNLI-RSRRKLPPGPRQWPVIGNLPHLGQAPHQTMATLA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
             ++GPLMHLRLG VDVVVAASA++AAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF PY
Sbjct  60   RKHGPLMHLRLGQVDVVVAASASMAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFRPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            G RWR+LRKITSVHLFS +AL+DF HVRQEEVA L  +LA+ G T V LGQLL
Sbjct  120  GQRWRLLRKITSVHLFSGKALEDFRHVRQEEVAVLISALANRGSTAVNLGQLL  172



>ref|XP_010105826.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19303.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06425.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=508

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 143/173 (83%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MA++T I  +++FA+ +Y L+  +  R    LPPGP+ WPV+GNLPHLG+ PHQ++A +A
Sbjct  1    MASITTILLSILFAVLVYRLVNNLI-RSRRKLPPGPRQWPVIGNLPHLGQAPHQTMATLA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
             ++GPLMHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF PY
Sbjct  60   RKHGPLMHLRLGQVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFRPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            G RWR+LRKITSVHLFS +AL+DF HVRQEEVA L  +LA+ G T V LGQLL
Sbjct  120  GQRWRLLRKITSVHLFSGKALEDFRHVRQEEVAVLISALANRGSTAVNLGQLL  172



>gb|AGL81348.1| flavanone 3' hydroxylase [Pyrus communis]
Length=511

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
             LI  T+VFA FLY +      R+ LPLPPGPKPWP+ GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPGWSRHSLPLPPGPKPWPIXGNLPHLGPVPHHSLAALARQYG  62

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLGFVDVVVA SA+VA+QF K  D NFS+RPPNSGA+H+AYNYQ LVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAXSASVASQFXKTXDXNFSSRPPNSGAKHLAYNYQXLVFAPYGPRW  122

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            RM RKI+SVHLFS +ALDD  HVRQEEV  L   LASAG  PV L QLL
Sbjct  123  RMXRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSRPVNLAQLL  171



>gb|AIU98513.1| flavonoid 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  178
            M  +T +  TL    F+Y L+ LR +   +P  LPPGP+PWP++GNLPHLG KPHQS+A+
Sbjct  1    MTPVTFLLFTLAVTCFVYLLVNLRTLVNSHPHRLPPGPRPWPIVGNLPHLGSKPHQSLAS  60

Query  179  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  358
            +A  YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+NF+NRPPNSGA++IAYNYQDLVFA
Sbjct  61   LARSYGPLMHLRLGFVDVVVAASASVAAQFLKTNDANFANRPPNSGAKYIAYNYQDLVFA  120

Query  359  PYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            PYGPRWR+LRK++S+HLFS +ALDDF H+RQEEVA LT +LASA  + V LGQLL
Sbjct  121  PYGPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLTHALASARDSLVNLGQLL  175



>gb|AEN71546.1| flavanone 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  178
            M  +T +  TL    F+Y L+ LR +   +P  LPPGP+PWP++GNLPHLG KPHQS+A+
Sbjct  1    MTPVTFLLFTLAVTCFVYLLVNLRTLVNSHPHRLPPGPRPWPIVGNLPHLGSKPHQSLAS  60

Query  179  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  358
            +A  YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+NF+NRPPNSGA++IAYNYQDLVFA
Sbjct  61   LARSYGPLMHLRLGFVDVVVAASASVAAQFLKTNDANFANRPPNSGAKYIAYNYQDLVFA  120

Query  359  PYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            PYGPRWR+LRK++S+HLFS +ALDDF H+RQEEVA LT +LASA  + V LGQLL
Sbjct  121  PYGPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLTHALASARDSLVNLGQLL  175



>gb|ACO35757.1| flavonoid 3'-hydroxylase [Rudbeckia hirta]
Length=509

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG  PH S+A +A +YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPN
Sbjct  42   GNLPHLGTIPHHSLARLAAKYGPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI SVHLFSA+ALDDF H+RQEEVA LTR+L  A
Sbjct  102  SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGA  161

Query  491  GKTPVKLGQLL  523
            G++ VKLGQLL
Sbjct  162  GESTVKLGQLL  172



>gb|EPS57881.1| flavonoid 3'-hydroxylase, partial [Genlisea aurea]
Length=425

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = +2

Query  44   AIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLGF  223
            A+FL+     +++R     PPGP PWP+LGN+P LG KPHQS+AA+A  YGPL+HL++GF
Sbjct  10   ALFLFLAYAFIRRRATKRFPPGPTPWPLLGNIPQLGVKPHQSMAALAGVYGPLLHLKMGF  69

Query  224  vdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITSV  403
              VVVAASA+VA QFLKVHD+NFS+RPPN+G +++AYNYQDLVFAPYGPRWR+LRKI ++
Sbjct  70   QHVVVAASASVAEQFLKVHDANFSSRPPNAGGKYVAYNYQDLVFAPYGPRWRLLRKICAL  129

Query  404  HLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            HLFSA+ALDDF HVRQEEV  L R L SAGK PV LGQ+L
Sbjct  130  HLFSAKALDDFVHVRQEEVGILGRVLVSAGKNPVALGQVL  169



>dbj|BAD91808.1| flavonoid 3'-hydroxylase [Gentiana triflora]
Length=524

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 137/171 (80%), Gaps = 2/171 (1%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRY--plplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  190
            T +F   V  IF++  ++  K+ +   LPLPPGP+PWP+LGN+PHLG KPHQ++A MA+ 
Sbjct  12   TAVFGLFVVFIFIFLKLVSRKKGHGRSLPLPPGPRPWPILGNIPHLGSKPHQTLAEMAKT  71

Query  191  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  370
            YGPLMHL+ G  D VVA+SA+VA QFLK HD NFSNRPPNSGA+HIAYNYQDLVFAPYGP
Sbjct  72   YGPLMHLKFGLKDAVVASSASVAEQFLKKHDVNFSNRPPNSGAKHIAYNYQDLVFAPYGP  131

Query  371  RWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            RWR+LRKI SVHLFS++ALDDF HVR EE+  L R++AS G  PV LG+LL
Sbjct  132  RWRLLRKICSVHLFSSKALDDFQHVRHEEICILIRAIASGGHAPVNLGKLL  182



>gb|ACM62746.1| flavonoid 3'-hydroxylase [Garcinia mangostana]
Length=507

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +2

Query  23   IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  202
            I  +++ AI +Y LI          LPPGP+P P++GNLPHLG  PHQSIA++ ++YGPL
Sbjct  5    ILYSILIAILVYVLIKLGSLSSGRRLPPGPRPLPLVGNLPHLGSMPHQSIASLVKKYGPL  64

Query  203  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  382
            M+LRLG+VDVVVAASA+VAAQ  K HD+NFS+RPPNSGA+++AYNY DLVFAPYGPRWRM
Sbjct  65   MYLRLGYVDVVVAASASVAAQIFKNHDANFSSRPPNSGAKYVAYNYHDLVFAPYGPRWRM  124

Query  383  LRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            LRKI+SVHLFS +ALDDF H+R+ E+A LT++LASAGK PV LGQLL
Sbjct  125  LRKISSVHLFSNKALDDFRHIREAELAVLTQTLASAGKAPVNLGQLL  171



>gb|EYU23554.1| hypothetical protein MIMGU_mgv1a004224mg [Erythranthe guttata]
Length=538

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG KPHQS+A +A+ +GPLMHL++G V VVVAASA VA QFLKVHD+NFS+RPPN
Sbjct  65   GNLPQLGPKPHQSMATLAQVHGPLMHLKMGVVHVVVAASAGVAEQFLKVHDANFSSRPPN  124

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+++AYNYQDLVFAPYGPRWRMLRKI ++HLFS +ALDDF HVRQEEV  LTRSLASA
Sbjct  125  SGAKYMAYNYQDLVFAPYGPRWRMLRKICTLHLFSTKALDDFRHVRQEEVGILTRSLASA  184

Query  491  GKTPVKLGQLL  523
            GKT   +GQ+L
Sbjct  185  GKTAASIGQML  195



>gb|AIT52346.1| flavonoid 3'-monooxygenase 1 [Daucus carota]
Length=524

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 131/175 (75%), Gaps = 7/175 (4%)
 Frame = +2

Query  20   LIFCTLVFAIFLYFLIL-------RVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  178
            LI  TLV A+ +Y L+        R       P P GPKPWP++GNLPHLG  PH S+A 
Sbjct  8    LILYTLVLALLIYCLLNLRTLFFNRRSSHPLPPGPKGPKPWPIIGNLPHLGAIPHHSLAE  67

Query  179  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  358
            MA+ YGPL+HLRLG V VVVA+SA VAAQFLK HD+ FSNRPPNSGA+HIAYNYQDLVFA
Sbjct  68   MAQTYGPLLHLRLGLVHVVVASSAGVAAQFLKTHDAKFSNRPPNSGAKHIAYNYQDLVFA  127

Query  359  PYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            PYGP+WR LRKI SVHLFSA+ALDDF HVRQEEV  L   LA AGK  V LGQLL
Sbjct  128  PYGPKWRKLRKICSVHLFSAKALDDFRHVRQEEVGVLVSGLAGAGKRAVHLGQLL  182



>gb|ACO35755.1| chalcone 3-hydroxylase [Cosmos sulphureus]
Length=512

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG  PHQS+A +A +YGPLM+LRLGFVDVVVAASA+VAAQFLKVHD NF++RP +
Sbjct  42   GNLPHLGASPHQSLATLAAKYGPLMYLRLGFVDVVVAASASVAAQFLKVHDLNFASRPLS  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SG ++IAYNYQD+VFAPYGPRWRMLRKI SVH+FSA+A+D F HVRQEEVA LTR+L SA
Sbjct  102  SGGKYIAYNYQDMVFAPYGPRWRMLRKICSVHMFSAKAMDGFRHVRQEEVAILTRTLVSA  161

Query  491  GKTPVKLGQLL  523
            GK+PVKLGQ+L
Sbjct  162  GKSPVKLGQIL  172



>gb|ACN65827.1| flavonoid 3'-hydroxylase [Centaurea cyanus]
Length=514

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLGK PH ++AAMA++YGPLMHLR G VDVVVAASA+VAAQFLKVHD+NF++RPPN
Sbjct  43   GNLPHLGKMPHHALAAMADKYGPLMHLRFGVVDVVVAASASVAAQFLKVHDANFASRPPN  102

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+H+AY+YQDLVFAPYG +WRMLRKI SVHLFS +ALDDF HVR+EEVA LTR+LA A
Sbjct  103  SGAKHLAYDYQDLVFAPYGLKWRMLRKICSVHLFSNKALDDFRHVREEEVAVLTRALAGA  162

Query  491  GKTPVKLGQLL  523
            G + V LGQLL
Sbjct  163  GGSTVALGQLL  173



>gb|ADZ28515.1| flavonoid-3'-hydroxylase [Camellia nitidissima]
Length=518

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 141/177 (80%), Gaps = 4/177 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLI-LRVK--QRYplplppgpkpwpvlGNLPHLGKKPHQSIA  175
            M +L  +  +L+   FLY L+ LR     R+P PLPPGPKPWPV+GNLPHLG  PH SIA
Sbjct  1    MTSLAFVLYSLLIGFFLYCLLNLRTLLFNRHPRPLPPGPKPWPVIGNLPHLGTMPHHSIA  60

Query  176  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  355
            AMA  YGPLMHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF
Sbjct  61   AMARTYGPLMHLRLGLVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVF  120

Query  356  APYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTR-SLASAGKTPVKLGQLL  523
            APYGPRWRMLRKI SVHLFS +ALDDF HVRQEE+A LTR   ++     V LGQLL
Sbjct  121  APYGPRWRMLRKICSVHLFSTKALDDFRHVRQEEIAILTRALASAGQAAAVNLGQLL  177



>ref|XP_006287545.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
 gb|EOA20443.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
Length=509

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 136/170 (80%), Gaps = 0/170 (0%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            +T +F T+V A  L+ L+     R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTPLFLTIVLATVLFCLLFLFSLRRNHRLPPGPNPWPIVGNLPHMGTKPHQTLAAMVTTY  60

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GP++HLRLGFVDVVVAAS +VA QFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFVDVVVAASKSVAEQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            WRMLRKI+SVHLFSA+AL+DF H+RQEEV TL+  LA  G   V LGQL+
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHIRQEEVGTLSGELARVGTKAVNLGQLV  170



>gb|AGO03824.1| flavonoid 3`5`-hydroxylase [Echinops bannaticus]
Length=510

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 137/174 (79%), Gaps = 1/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFL-ILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  181
            M  LTL+  T +  +  Y L +L ++  +P  LPPGP PWP++GNLPH+G  PHQS+AA+
Sbjct  1    MTILTLLLYTCITGLVFYVLQLLNLRTPHPNRLPPGPTPWPIVGNLPHIGTAPHQSLAAL  60

Query  182  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  361
            A +YGPLMHLRLGFVDVVVA SA+VAAQ  K HD NFSNRP  SG +HIAYNYQDLVFAP
Sbjct  61   ATKYGPLMHLRLGFVDVVVAGSASVAAQIFKAHDVNFSNRPRVSGGKHIAYNYQDLVFAP  120

Query  362  YGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            YGP+WRMLRKI SVHLFS +ALDDF HVRQEE A L  +LA AG++ VKLG+L+
Sbjct  121  YGPKWRMLRKICSVHLFSTKALDDFRHVRQEEAAILAGTLAGAGESTVKLGELV  174



>gb|KEH32010.1| flavonoid hydroxylase [Medicago truncatula]
Length=510

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 144/173 (83%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+ L ++F T+  AI +Y L L +  +  LPLPPGP PWP++GNLPH+G  PH ++A +A
Sbjct  1    MSPLIIVFATIAAAILIYRL-LNLITKPSLPLPPGPSPWPIVGNLPHMGPVPHHALAVLA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
             ++GPLMHLRLG+VDV+VAASA+VA QFLKVHD+NFS+RP NSGA+++AYNYQDLVFAPY
Sbjct  60   LKHGPLMHLRLGYVDVIVAASASVAEQFLKVHDTNFSSRPTNSGAKYLAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRKI+ VH+FS++ALD+F H+RQEEVA L R+LAS+G   V LGQ+L
Sbjct  120  GPRWRLLRKISYVHMFSSKALDEFRHIRQEEVARLIRNLASSGSKAVNLGQML  172



>gb|ADE80941.1| flavonoid 3'-hydroxylase [Epimedium sagittatum]
Length=514

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 134/173 (77%), Gaps = 0/173 (0%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L L+  TL+ +  LY LI  +    P  LPPGPKPWP++GNL HLG+ PH S+AA+A
Sbjct  1    MTPLELVLATLIISTILYTLINSLLNPAPRGLPPGPKPWPIIGNLLHLGRVPHHSLAALA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPLMHLRLG V V+VAAS++VA Q  K HD NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   KKYGPLMHLRLGSVHVIVAASSSVATQIFKTHDVNFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GP+WRMLRKI SVHLFSA+ALDDF H+RQEEV  L  +L  AGK P  L +LL
Sbjct  121  GPKWRMLRKICSVHLFSAKALDDFRHIRQEEVLVLINALFQAGKAPTDLAKLL  173



>emb|CDP16353.1| unnamed protein product [Coffea canephora]
Length=151

 Score =   179 bits (455),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 129/152 (85%), Gaps = 1/152 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+TLTLIF + + A FL + IL+        LPPGPKPWP++GNLPHLG KPH S+AAMA
Sbjct  1    MSTLTLIFISSLLA-FLLYSILKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   KTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEV  460
            GPRWR+LRKI S+HLFSA+ALDDF  VRQ ++
Sbjct  120  GPRWRLLRKICSIHLFSAKALDDFHLVRQVKI  151



>dbj|BAE71221.1| putative flavonoid 3'-hydroxylase [Trifolium pratense]
Length=510

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 145/173 (84%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+   ++F T+V AI +  L+  +K +  LPLPPGP PWP++GNLPH+G  PH ++AA+A
Sbjct  1    MSLWIIVFVTIVAAILINRLLNLIK-KPTLPLPPGPSPWPIVGNLPHMGPVPHHALAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
             ++GPLMHL+LGFVDV+VAASA+VA QFLKVHD+NFS+RPPNSGA++IAYNYQDLVFAPY
Sbjct  60   LKHGPLMHLQLGFVDVIVAASASVAEQFLKVHDANFSSRPPNSGAKYIAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRKI+ VH+FS++ALDDF H+RQ+EVA L R+L+++G     LGQ+L
Sbjct  120  GPRWRLLRKISYVHMFSSKALDDFRHIRQDEVARLIRNLSNSGSKAANLGQML  172



>gb|AGI16386.1| flavonoid 3' hydroxylase [Ribes nigrum]
Length=524

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG KPHQSIA +A  YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RP N
Sbjct  51   GNLPHLGTKPHQSIAELARTYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPQN  110

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA++IAYNYQDLVFAPYGPRWRMLRKI+ VHLFS +ALDDF HVRQEEVA LTR++ + 
Sbjct  111  SGAKYIAYNYQDLVFAPYGPRWRMLRKISQVHLFSNKALDDFRHVRQEEVAVLTRAIVNE  170

Query  491  GKTPVKLGQLL  523
            G   V L +LL
Sbjct  171  GDASVDLPRLL  181



>gb|AJD25178.1| cytochrome P450 CYP75B80 [Salvia miltiorrhiza]
Length=514

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 128/170 (75%), Gaps = 5/170 (3%)
 Frame = +2

Query  8    ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  187
            AT +LI CT +  +  Y    + ++  P P P         GNLP LG KPHQS+AA+A 
Sbjct  3    ATASLIICTSILGLLFYLFFQKRRRLPPGPRPWPIV-----GNLPQLGAKPHQSMAALAR  57

Query  188  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  367
             +GPL+HL++GFV VVVAASA VA QFL+VHD+NF +RPPN+GAEH+AYNYQDLVFAPYG
Sbjct  58   VHGPLLHLKMGFVHVVVAASAGVAEQFLRVHDTNFLSRPPNAGAEHVAYNYQDLVFAPYG  117

Query  368  PRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  517
            PRWR+LRKI ++HLFSA+ALDDF HVR+EEV  + R+LA AG  PV++ +
Sbjct  118  PRWRLLRKICALHLFSAKALDDFRHVREEEVGIIVRTLADAGHKPVRISE  167



>gb|AEX07282.1| F3'H [Arachis hypogaea]
Length=517

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 143/171 (84%), Gaps = 3/171 (2%)
 Frame = +2

Query  17   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
            ++ F T+  AI +Y  I++   R  LPLPPGPKPWP++GNLPHLG  PH +IAA+A+ +G
Sbjct  6    SIAFATIALAILIY-RIVKFVTRPSLPLPPGPKPWPIIGNLPHLGPVPHHAIAALAKVHG  64

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            PLMHLRLG VDVVVAASA VA QFLKVHD+NFS+RPPN+GA++IAYNYQDLVFAPYGPRW
Sbjct  65   PLMHLRLGMVDVVVAASAKVAEQFLKVHDANFSSRPPNAGAKYIAYNYQDLVFAPYGPRW  124

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTP--VKLGQLL  523
            RMLRKI+S+HLFSA+ALDDF H+RQ EVA LT+++AS+  T   V LGQLL
Sbjct  125  RMLRKISSLHLFSAKALDDFKHLRQGEVARLTKNIASSTDTSKAVNLGQLL  175



>gb|AAO47850.1| defective flavonoid 3'-hydroxylase [Glycine max]
Length=298

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS +A+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  491  GKTPVKLGQLL  523
                V LGQLL
Sbjct  162  DTKAVNLGQLL  172



>gb|AGO03826.1| flavonoid 3`5`-hydroxylase [Billardiera heterophylla]
Length=521

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 140/174 (80%), Gaps = 4/174 (2%)
 Frame = +2

Query  8    ATLTLIFCTLVFAIFLYFLILRVK---QRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  178
             TL  I C  + A+   + IL ++    R+P  LPPGP+PWP++GNLPHLG KPH SIAA
Sbjct  3    TTLEFILCFTITALPFLYCILNMRILLNRHPRSLPPGPRPWPIVGNLPHLGTKPHHSIAA  62

Query  179  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  358
            MA +YGPL+HLR+G V VVVAASA VAAQFLK +D+NFS+RPPNSGA+H+AYNY D+VFA
Sbjct  63   MARKYGPLLHLRMGIVHVVVAASADVAAQFLK-NDANFSSRPPNSGAKHMAYNYHDMVFA  121

Query  359  PYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQL  520
            PYGPRWRMLRKI ++H+FSA+ALDDF  VR+EEVA L R+LA AG+ PV LGQL
Sbjct  122  PYGPRWRMLRKICALHIFSAKALDDFHRVREEEVAILARTLAHAGQKPVNLGQL  175



>gb|AAG49315.1|AF315465_1 flavonoid 3'-hydroxylase [Pelargonium x hortorum]
Length=511

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPH+G  PHQ++AAMA  YGPL++LRLGFVDVVVA SA++A+QFLK HDSNFS+RPPN
Sbjct  44   GNLPHMGSMPHQNLAAMARTYGPLVYLRLGFVDVVVALSASMASQFLKTHDSNFSSRPPN  103

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            +GA+HIAYNY DLVFAPYGPRWR+ RKITS+HLFS +ALDD+ HVRQEEV  L  +LA A
Sbjct  104  AGAKHIAYNYHDLVFAPYGPRWRLFRKITSIHLFSGKALDDYRHVRQEEVGVLASNLARA  163

Query  491  GKTPVKLGQLL  523
              T V LGQLL
Sbjct  164  VSTIVNLGQLL  174



>gb|ADT63065.1| flavonoid 3'-hydroxylase, partial [Fagopyrum esculentum]
Length=457

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPH+G  PH S+AA+A+ YGPLMHLRLG V V++AASA+VA+QFLK HD+NFS+RPPN
Sbjct  6    GNLPHMGAVPHHSLAALAKVYGPLMHLRLGSVHVIIAASASVASQFLKTHDANFSSRPPN  65

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI  VHLFS +AL+DF  VR+EEV  LT +L+ A
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKICQVHLFSGKALEDFRFVREEEVGILTGALSKA  125

Query  491  GKTPVKLGQLL  523
            GK  V+LGQLL
Sbjct  126  GKNAVQLGQLL  136



>ref|XP_004508739.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=503

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+     F T+  AI +Y  I ++  R  +PLPPGP+PWP++GNLPH+G  PH ++AA+A
Sbjct  1    MSNWISAFATIAAAILIY-RIFKLITRPSIPLPPGPRPWPIVGNLPHMGPVPHHALAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
             ++GPLMHLRLGFVDV+VAASA VA QFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPY
Sbjct  60   HKHGPLMHLRLGFVDVIVAASATVAEQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRKI  VH+FS +ALDD  H+RQEEV  L R+LAS+G   V L Q+L
Sbjct  120  GPRWRLLRKIAYVHMFSTKALDDVRHLRQEEVGRLIRNLASSGSKAVNLSQML  172



>gb|ABB43031.1| flavonoid 3'5'-hydroxylase [Osteospermum hybrid cultivar]
Length=508

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            MA +  +       + +++++L ++ R+P  LPPGP PWP++GNLPHLG  PH ++AA A
Sbjct  1    MAIIMTLLMDTCITVLVFYVLLNLRTRHPNRLPPGPTPWPIVGNLPHLGPLPHHTLAAFA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPL+HLR GFVDVVVA+S  VA+QFL+ +D NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  61   KKYGPLIHLRFGFVDVVVASSPTVASQFLRDNDLNFASRPPNSGAKHMAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRW MLRKI   HLFS++ALD+F HVR+EEVA LTR LASAG++ VKL QLL
Sbjct  121  GPRWTMLRKICKDHLFSSKALDNFRHVREEEVAILTRILASAGESTVKLSQLL  173



>gb|AFI71898.1| flavonoid 3'-hydroxylase [Paeonia lactiflora]
Length=507

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 138/173 (80%), Gaps = 3/173 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  +T +      A F+Y L   V   +P  LPPGP+PWP++GNLPHLG KPHQS+A++A
Sbjct  1    MTPVTFLLTNFAVASFVYLL---VNNGHPHRLPPGPRPWPIVGNLPHLGPKPHQSLASLA  57

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
              YGPLMHLRLG VDVVVAASA+VAAQFLK +D+NF NRPPNSGA++IAYNYQDLVFAPY
Sbjct  58   RSYGPLMHLRLGSVDVVVAASASVAAQFLKTNDANFVNRPPNSGAKYIAYNYQDLVFAPY  117

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRK++S+HLFS +ALDDF H+RQEEVA L  +L SA  + V LGQLL
Sbjct  118  GPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLVHALTSASNSLVNLGQLL  170



>gb|AAO47844.1| gray pubescence flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47845.1| gray pubescence flavonoid 3'-hydroxylase [Glycine max]
Length=394

 Score =   184 bits (467),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS +A+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  491  GKTPVKLGQLL  523
                V LGQLL
Sbjct  162  DTKAVNLGQLL  172



>gb|ACJ85671.1| unknown [Medicago truncatula]
Length=418

 Score =   184 bits (468),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+   + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +A
Sbjct  1    MSLWLIAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            E YGPLMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PY
Sbjct  61   ETYGPLMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLL  523
            GPRWR+LRKIT+VHLFS Q+LD+F H+RQEEV  L  +LAS  +    V LGQLL
Sbjct  121  GPRWRLLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLL  175



>ref|XP_007138248.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
 gb|ESW10242.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
Length=506

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+   + F T+   I ++ LI  + +   LPLPPGPKPWPV+GN PH+G  PH S+AA+ 
Sbjct  1    MSPFMVAFATVAAVILVHRLIKFLTRNSSLPLPPGPKPWPVVGNFPHMGPVPHHSLAALV  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + +GPLMHLRLGFVD+VVAASA+VA QFLK+HDSNFS+RPPN+GA++IAYNYQDLVFAPY
Sbjct  61   QVHGPLMHLRLGFVDMVVAASASVAEQFLKIHDSNFSSRPPNAGAKYIAYNYQDLVFAPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR+LRK+TSVHLFS +ALD F H+R+EEV  LTR+L S+    V LGQ+L
Sbjct  121  GPRWRLLRKLTSVHLFSGKALDVFRHLREEEVGRLTRNLGSSDAKAVNLGQVL  173



>gb|AGO03825.1| flavonoid 3`5`-hydroxylase [Cichorium intybus]
Length=514

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG+ PH+S+AA+A +YGPL+HLRLGF+DVVVAASA+VAAQFLK HD+NF++RPPN
Sbjct  42   GNLPHLGQSPHRSLAALATKYGPLIHLRLGFIDVVVAASASVAAQFLKAHDANFASRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNY D+VF PYGPRWRMLRK+  VHLFS +AL+DF H+RQEEVA LTR+L  A
Sbjct  102  SGAKHIAYNYNDMVFEPYGPRWRMLRKLCLVHLFSNKALNDFRHIRQEEVAILTRALGGA  161

Query  491  GKTPVKLGQLL  523
            G++ V+L +LL
Sbjct  162  GQSIVQLDKLL  172



>gb|AES69199.2| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+   + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +A
Sbjct  1    MSLWLIAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            E YGPLMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PY
Sbjct  61   ETYGPLMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLL  523
            GPRWR+LRKIT+VHLFS Q+LD+F H+RQEEV  L  +LAS  +    V LGQLL
Sbjct  121  GPRWRLLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLL  175



>ref|XP_003598945.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
 gb|AES69196.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 116/133 (87%), Gaps = 2/133 (2%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GN+PHLG  PHQSIAA+A+ +GPLMHL+LGFVDV+VAAS +VA QFLKVHD+NFS+RPPN
Sbjct  43   GNMPHLGPAPHQSIAALAKIHGPLMHLKLGFVDVIVAASGSVAEQFLKVHDANFSSRPPN  102

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLAS-  487
            +GA++IAYNYQDLVFAPYGPRWRMLRKI+SVHLFS + +++F H+RQEEVA LT +LAS 
Sbjct  103  TGAKYIAYNYQDLVFAPYGPRWRMLRKISSVHLFSNKVMEEFKHLRQEEVARLTSNLASN  162

Query  488  -AGKTPVKLGQLL  523
             +    V LGQLL
Sbjct  163  YSNTKAVNLGQLL  175



>gb|KHN17812.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=513

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS +A+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  491  GKTPVKLGQLL  523
                V LGQLL
Sbjct  162  DTKAVNLGQLL  172



>ref|NP_001237015.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAB83261.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47846.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47847.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAD97828.1| flavonoid 3'- hydroxylase [Glycine max]
 gb|ABW69385.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ABW69386.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ACN81827.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS +A+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  491  GKTPVKLGQLL  523
                V LGQLL
Sbjct  162  DTKAVNLGQLL  172



>gb|ACR33790.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS +A+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  491  GKTPVKLGQLL  523
                V LGQLL
Sbjct  162  DTKAVNLGQLL  172



>gb|KEH33153.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 116/133 (87%), Gaps = 2/133 (2%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GN+PHLG  PHQSIAA+A+ +GPLMHL+LGFVDV+VAAS +VA QFLKVHD+NFS+RPPN
Sbjct  43   GNMPHLGPAPHQSIAALAKIHGPLMHLKLGFVDVIVAASGSVAEQFLKVHDANFSSRPPN  102

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLAS-  487
            +GA++IAYNYQDLVFAPYGPRWRMLRKI+SVHLFS + +++F H+RQEEVA LT +LAS 
Sbjct  103  TGAKYIAYNYQDLVFAPYGPRWRMLRKISSVHLFSNKVMEEFKHLRQEEVARLTSNLASN  162

Query  488  -AGKTPVKLGQLL  523
             +    V LGQLL
Sbjct  163  YSDTKAVNLGQLL  175



>gb|AEE60888.1| flavonoid 3'-hydroxylase [Fragaria chiloensis]
Length=512

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  32   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  208
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++GPLMH
Sbjct  8    TLLVALVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKHGPLMH  67

Query  209  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  388
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPRWRQFR  127

Query  389  KITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            KI+SVHLFS +ALDD  HVRQEEVA L  +LA+AG   V L QLL
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLL  172



>gb|ABB43030.1| flavonoid 3'5'-hydroxylase [Pericallis cruenta]
Length=504

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+ LTLI CT +  +  Y L+  +  R    LPPGP PWP++GNL HLGK PH S+A +A
Sbjct  1    MSILTLI-CTFITGLMFYGLV-NLLSRRASRLPPGPTPWPIIGNLMHLGKLPHHSLADLA  58

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPL+H+RLG VDVVVA+SA+VA QFLKVHD+NF+NRPPNSGA+H+AYNY D+VFAPY
Sbjct  59   KKYGPLIHVRLGSVDVVVASSASVAGQFLKVHDANFANRPPNSGAKHMAYNYHDMVFAPY  118

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRK+ S+HLFSA+AL DF  VRQEEV  LTR LA  G++ VKL Q L
Sbjct  119  GPRWRMLRKMCSMHLFSAKALTDFRQVRQEEVTILTRVLARTGQSAVKLDQQL  171



>dbj|BAL63027.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=510

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 133/170 (78%), Gaps = 0/170 (0%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            L  +   LV  +   FL     QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++
Sbjct  3    LIAVITLLVALVLFRFLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKH  62

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GPLMHLRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPR
Sbjct  63   GPLMHLRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPR  122

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            WR  RKI+SVHLFS +ALDD  HVRQEEVA L  +LA+AG   V L QLL
Sbjct  123  WRQFRKISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLL  172



>gb|AIB06740.1| flavanone 3'-hydroxylase [Mangifera indica]
Length=515

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 137/171 (80%), Gaps = 4/171 (2%)
 Frame = +2

Query  23   IFCTLVFAIFLYFL--ILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  196
            I  +L+F + +YFL  I     R  L LPPGPKP P++GNLPH+G  PH S+AA+A  YG
Sbjct  5    ILVSLLFGVLIYFLFNIRSFFNRKSLRLPPGPKPRPIIGNLPHMGPMPHHSLAALARTYG  64

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            P+MHLRLGFVDV+VAASA+VAAQFLKVHD+NFS+RPPNSGA++IAYNYQDLVF PYG +W
Sbjct  65   PIMHLRLGFVDVIVAASASVAAQFLKVHDANFSSRPPNSGAKYIAYNYQDLVFRPYGAKW  124

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAG--KTPVKLGQLL  523
            R+LRKITSVHLFS +ALDD+  VRQ EVA LTR+LASAG     V L QLL
Sbjct  125  RLLRKITSVHLFSGKALDDYRLVRQGEVAVLTRALASAGLKSELVNLAQLL  175



>ref|XP_003598948.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
Length=597

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+   + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +A
Sbjct  1    MSLWLIAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLA  60

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            E YGPLMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PY
Sbjct  61   ETYGPLMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPY  120

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLL  523
            GPRWR+LRKIT+VHLFS Q+LD+F H+RQEEV  L  +LAS  +    V LGQLL
Sbjct  121  GPRWRLLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLL  175



>gb|AEE60886.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  32   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  208
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  209  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  388
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  389  KITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            KI+SVHLFS +ALDD  HVRQEEVA L  +LA+AG   V L QLL
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLL  172



>gb|AEE60885.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  32   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  208
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  209  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  388
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  389  KITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            KI+SVHLFS +ALDD  HVRQEEVA L  +LA+AG   V L QLL
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLL  172



>gb|AEE60887.1| flavonoid 3'-hydroxylase [Fragaria virginiana]
Length=512

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  32   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  208
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  209  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  388
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  389  KITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            KI+SVHLFS +ALDD  HVRQEEVA L  +LA+AG   V L QLL
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLL  172



>ref|NP_001274347.1| uncharacterized protein LOC101314754 [Fragaria vesca]
 gb|AEE60884.1| flavonoid 3'-hydroxylase [Fragaria vesca]
 gb|AGT28740.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  32   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  208
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  209  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  388
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  389  KITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            KI+SVHLFS +ALDD  HVRQEEVA L  +LA+AG   V L QLL
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLL  172



>gb|AEE60883.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  32   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  208
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKPQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  209  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  388
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  389  KITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            KI+SVHLFS +ALDD  HVRQEEVA L  +LA+AG   V L QLL
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLL  172



>gb|AGT28741.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=513

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 135/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  32   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  208
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++GPLMH
Sbjct  8    TLLVALVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKHGPLMH  67

Query  209  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  388
            LR G+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPRWR  R
Sbjct  68   LRFGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPRWRQFR  127

Query  389  KITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            KI+SVHLFS +ALDD  HVRQEEVA L  +LA+AG   V L QLL
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLL  172



>gb|AAG49299.1|AF313489_1 flavonoid 3',5'-hydroxylase [Callistephus chinensis]
Length=510

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG  PH ++AA+A +YGPL++LRLGFV VVVA+S +VAAQFLKVHD  F++RPPN
Sbjct  43   GNLPHLGAIPHHTLAALATKYGPLVYLRLGFVHVVVASSPSVAAQFLKVHDLKFASRPPN  102

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQD+VFAPYGP+W M RKI   HLFS++ALDDF HVRQEEVA L R LA A
Sbjct  103  SGAKHIAYNYQDMVFAPYGPQWTMFRKICKDHLFSSKALDDFRHVRQEEVAILARGLAGA  162

Query  491  GKTPVKLGQLL  523
            G++ V LGQ L
Sbjct  163  GRSKVNLGQQL  173



>ref|XP_004515962.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=507

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GN+PHLG  PH S+AA+A+ YGPLMHL+LGFVDV+VAASA+VA QFLKVHD+NFS+RPPN
Sbjct  42   GNIPHLGPVPHHSLAALAKTYGPLMHLKLGFVDVIVAASASVAEQFLKVHDANFSSRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            +GA+++AYNYQDLVFA YGPRWR+LRK++S+HLFS ++LD+F H+RQEEV+ LTR LA +
Sbjct  102  AGAKYMAYNYQDLVFASYGPRWRLLRKLSSIHLFSNKSLDEFKHMRQEEVSRLTRYLADS  161

Query  491  GKTPVKLGQLL  523
                V LG LL
Sbjct  162  DPKSVNLGPLL  172



>gb|AAX19888.1| flavonoid-3',5'-hydroxylase [Pericallis cruenta]
Length=504

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 136/173 (79%), Gaps = 2/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+ LTLI CT +  +  Y L+  +  R    LPPGP PWP++GNL HLGK PH S+A +A
Sbjct  1    MSILTLI-CTFITGLMFYGLV-NLLSRRASRLPPGPTPWPIIGNLMHLGKLPHHSLADLA  58

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            ++YGPL+H+RLG VDVVVA+SA+VA QFLKVHD+NF+NRPPNSGA+H+AYNY D+VFAPY
Sbjct  59   KKYGPLIHVRLGSVDVVVASSASVAGQFLKVHDANFANRPPNSGAKHMAYNYHDMVFAPY  118

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRK+ S+HLFSA+AL DF  VRQEEV  LTR LA   ++ VKL Q L
Sbjct  119  GPRWRMLRKMCSMHLFSAKALADFRQVRQEEVMILTRVLAGTEQSAVKLDQQL  171



>ref|XP_010030575.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83703.1| hypothetical protein EUGRSUZ_B00578 [Eucalyptus grandis]
Length=514

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 134/173 (77%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M   +LI  T+  ++ LY L L    R   PLPPGPKPWP++GNLPHLG  PHQS+AA+A
Sbjct  1    MTPSSLILATIAISVILYSL-LSYLARPARPLPPGPKPWPLVGNLPHLGPMPHQSMAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
              YGPL+HLRLG VDVVVA+SA+VA+QFLK H++NF +RPP+S A+H++YNYQDLV  PY
Sbjct  60   RAYGPLLHLRLGLVDVVVASSASVASQFLKTHEANFLSRPPHSAAKHLSYNYQDLVSLPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWRMLRKI+S+HLFS +ALDD+ HVR EEV  LT +LA    TP KL QLL
Sbjct  120  GPRWRMLRKISSIHLFSGKALDDYRHVRHEEVVVLTHALAHVSSTPKKLAQLL  172



>ref|XP_010522799.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X6 [Tarenaya 
hassleriana]
Length=391

 Score =   174 bits (442),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  146  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  325
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  326  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPV  505
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSA+AL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  506  KLGQLL  523
             L QL+
Sbjct  121  NLSQLV  126



>gb|ADX95997.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=132

 Score =   166 bits (421),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG  PH ++AA+A++YGPLMHLRLG+VDVVVAA+A+VAAQFLKVHD+NF++RPPN
Sbjct  26   GNLPHLGPIPHHALAALAQKYGPLMHLRLGYVDVVVAATASVAAQFLKVHDANFASRPPN  85

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQ  451
            SGA+H+AYNYQDLVFAPYGPRWR+LRKI SVHLFSA+ALDDF HVRQ
Sbjct  86   SGAKHVAYNYQDLVFAPYGPRWRLLRKICSVHLFSAKALDDFRHVRQ  132



>ref|XP_010522791.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X5 [Tarenaya 
hassleriana]
Length=469

 Score =   175 bits (444),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  146  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  325
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  326  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPV  505
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSA+AL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  506  KLGQLL  523
             L QL+
Sbjct  121  NLSQLV  126



>gb|AGT50310.1| flavonoid 3'-hydroxylase, partial [Meconopsis simplicifolia]
Length=468

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 110/135 (81%), Gaps = 4/135 (3%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQDLVFAPYG RWRM RKI +VHL S +ALD+F HVR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLLSGKALDEFRHVREEEVAVLTKALAQS  122

Query  491  GK----TPVKLGQLL  523
             K    +PV L  LL
Sbjct  123  NKNSKGSPVNLADLL  137



>gb|AGT50309.1| flavonoid 3'-hydroxylase, partial [Meconopsis delavayi]
Length=476

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 111/135 (82%), Gaps = 4/135 (3%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQDLVFAPYG RWRM RKI +VHLFS +ALD+F +VR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  122

Query  491  GK----TPVKLGQLL  523
             K    +PV L  LL
Sbjct  123  NKNSKGSPVNLADLL  137



>ref|XP_010522758.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010522767.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X3 [Tarenaya 
hassleriana]
Length=489

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  146  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  325
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  326  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPV  505
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSA+AL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  506  KLGQLL  523
             L QL+
Sbjct  121  NLSQLV  126



>ref|XP_010522775.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X4 [Tarenaya 
hassleriana]
 ref|XP_010522783.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X4 [Tarenaya 
hassleriana]
Length=488

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  146  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  325
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  326  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPV  505
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSA+AL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  506  KLGQLL  523
             L QL+
Sbjct  121  NLSQLV  126



>dbj|BAB17054.1| unnamed protein product [Arabidopsis thaliana]
Length=151

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 127/154 (82%), Gaps = 9/154 (6%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRV-----KQRYplplppgpkpwpvlGNLPHLGKKPHQS  169
            MATL   F T++ A  L FLILR+      + +   LPPGP PWP++GNLPH+G KPH++
Sbjct  1    MATL---FLTILLATVL-FLILRIFSHRRNRSHNNRLPPGPNPWPIIGNLPHMGTKPHRT  56

Query  170  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  349
            ++AM   YGP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDL
Sbjct  57   LSAMVTTYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDL  116

Query  350  VFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQ  451
            VFAPYG RWR+LRKI+SVHLFSA+AL+DF HVRQ
Sbjct  117  VFAPYGHRWRLLRKISSVHLFSAKALEDFKHVRQ  150



>gb|AGT50311.1| flavonoid 3'-hydroxylase, partial [Meconopsis horridula]
Length=484

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 111/135 (82%), Gaps = 4/135 (3%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  11   GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  70

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQDLVFAPYG RWRM RKI +VHLFS +ALD+F +VR+EEVA LT++LA +
Sbjct  71   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  130

Query  491  GK----TPVKLGQLL  523
             K    +PV L  LL
Sbjct  131  NKNSKGSPVNLADLL  145



>gb|AGY55961.1| flavonoid 3'-hydroxylase, partial [Punica granatum]
Length=332

 Score =   170 bits (431),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  QFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCH  442
            QFLK+HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPRWRMLRKI+SVHLFSA+ALDDF H
Sbjct  14   QFLKIHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKISSVHLFSAKALDDFRH  73

Query  443  VRQEEVATLTRSLASAGKTPVKLGQLL  523
            VRQEEVA LTR+LASAGKTPVKLGQLL
Sbjct  74   VRQEEVAILTRALASAGKTPVKLGQLL  100



>ref|XP_010522740.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Tarenaya 
hassleriana]
Length=589

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  146  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  325
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  326  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPV  505
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSA+AL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  506  KLGQLL  523
             L QL+
Sbjct  121  NLSQLV  126



>ref|XP_010522750.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X2 [Tarenaya 
hassleriana]
Length=565

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  146  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  325
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  326  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPV  505
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSA+AL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  506  KLGQLL  523
             L QL+
Sbjct  121  NLSQLV  126



>gb|AGT50313.1| flavonoid 3'-hydroxylase, partial [Meconopsis lancifolia]
Length=476

 Score =   172 bits (437),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 4/135 (3%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYN+QDLVFAPYG RWRM RKI +VHLFS +ALD+F +VR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNHQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  122

Query  491  GK----TPVKLGQLL  523
             K    +PV L  LL
Sbjct  123  NKNSKGSPVNLADLL  137



>gb|AGT50318.1| flavonoid 3'-hydroxylase, partial [Meconopsis punicea]
Length=485

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 111/136 (82%), Gaps = 5/136 (4%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  11   GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  70

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+HIAYNYQDLVFAPYG RWRM RKI ++HLFS +ALD+F +VR+EEVA LT++LA +
Sbjct  71   SGAKHIAYNYQDLVFAPYGRRWRMFRKICALHLFSGKALDEFRYVREEEVAVLTKALAQS  130

Query  491  GK-----TPVKLGQLL  523
             K     +PV L  LL
Sbjct  131  NKNSKAGSPVNLADLL  146



>dbj|BAM28972.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG KPHQ++ A+++ +GPL  LRLG  +V+VAASA++A++FL+ HD+NFSNRPPN
Sbjct  43   GNLPHLGPKPHQTMHALSKLHGPLFRLRLGSAEVIVAASASIASEFLRTHDTNFSNRPPN  102

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGAEHIAYNY DLVFAPYGPRWR LRK+ ++HLFS +AL+D C+VR++EVA L R LA +
Sbjct  103  SGAEHIAYNYNDLVFAPYGPRWRALRKLCALHLFSQKALEDLCYVREQEVAILARDLAGS  162

Query  491  GKTPVKLGQLL  523
             + PV LG+ L
Sbjct  163  SR-PVNLGETL  172



>dbj|BAE72874.1| flavonoid 3'-hydroxylase [Verbena x hybrida]
Length=465

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +2

Query  170  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  349
            +AA++  YGPLMHL++GFV VVVAASA  A QFLKV+D+NFSNRPPN+GA+++AYNYQDL
Sbjct  1    MAALSRVYGPLMHLKMGFVHVVVAASAGAAEQFLKVNDANFSNRPPNAGAKYVAYNYQDL  60

Query  350  VFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            VFAPYGPRWR+LRKI ++HLFSA+AL+DF  VRQEEV  LTR+LASAG+TP  LGQ+L
Sbjct  61   VFAPYGPRWRLLRKICALHLFSAKALEDFRTVRQEEVGILTRALASAGQTPASLGQML  118



>ref|XP_010105825.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19304.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06424.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=517

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 127/176 (72%), Gaps = 3/176 (2%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwp---vlGNLPHLGKKPHQSIA  175
            M ++  I  +++ A+ L+ L  +++ R  +P    P       ++GNLP LG  PHQ+IA
Sbjct  1    MPSIFTILGSILLAVLLFCLFNQLRSRRSVPGRRLPPGPRPWPIIGNLPQLGPAPHQTIA  60

Query  176  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  355
            A+A ++GPLMHLR G VDVV AASA+VAAQFLK HD+NF +RPP+S A+H+ YNY DLV 
Sbjct  61   ALARKHGPLMHLRFGLVDVVAAASASVAAQFLKAHDTNFLSRPPSSAAKHVGYNYHDLVL  120

Query  356  APYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            APYGPRWR++RKI SVHL S +AL+DF +VRQEE A L R LA+AG T + L QLL
Sbjct  121  APYGPRWRLMRKIASVHLLSGKALEDFRYVRQEEAAVLIRGLANAGPTAINLAQLL  176



>dbj|BAM28971.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG KPHQ++ A+++ +GPL  LRLG  +V+VAASA +A++FL+ HD+NFSNRPPN
Sbjct  43   GNLPHLGPKPHQTMHALSKLHGPLFRLRLGSAEVIVAASAPIASEFLRTHDTNFSNRPPN  102

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGAEHIAYNY DLVFAPYGPRWR LRK+ ++HLFS +AL+D C+VR++EVA L R LA +
Sbjct  103  SGAEHIAYNYNDLVFAPYGPRWRTLRKLCALHLFSQKALEDLCYVREQEVAILARDLAGS  162

Query  491  GKTPVKLGQLL  523
             + PV LG+ L
Sbjct  163  CR-PVNLGETL  172



>emb|CDP16533.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 1/116 (1%)
 Frame = +2

Query  179  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  358
            MA+ YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFA
Sbjct  1    MAKTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHMAYNYQDLVFA  60

Query  359  PYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRS-LASAGKTPVKLGQLL  523
            PYGPRWR+LRKI SVHLFSA+ALDDF  VR+EEVA LTR+ LAS GK  V LGQLL
Sbjct  61   PYGPRWRLLRKICSVHLFSAKALDDFHLVREEEVAILTRTLLASVGKDSVNLGQLL  116



>dbj|BAB87838.1| flavonoid 3'-hydroxylase [Torenia hybrid cultivar]
Length=512

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPHLG KPH S+A +A  YGPLMHL++GFV VVVA+SA+ A Q L+VHD+NF +RPPN
Sbjct  45   GNLPHLGPKPHASMAELARAYGPLMHLKMGFVHVVVASSASAAEQCLRVHDANFLSRPPN  104

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGA+H+AYNY+DLVF PYGP+WR+LRKI + H+FS +A+DDF  VR+EEVA L+R+L  A
Sbjct  105  SGAKHVAYNYEDLVFRPYGPKWRLLRKICAQHIFSVKAMDDFRRVREEEVAILSRAL--A  162

Query  491  GKTPVKLGQLL  523
            GK  V +GQ+L
Sbjct  163  GKRAVPIGQML  173



>dbj|BAB87839.1| flavonoid 3'-hydroxalase [Torenia hybrid cultivar]
Length=457

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +2

Query  179  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  358
            MA+ YGPLMHL+ G  D VVA+SA+VA QFLK HD NFSNRPPNSGA+HIAYNYQDLVFA
Sbjct  1    MAKTYGPLMHLKFGLKDAVVASSASVAEQFLKKHDVNFSNRPPNSGAKHIAYNYQDLVFA  60

Query  359  PYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            PYGPRWR+LRKI SVHLFS++ALDDF HVR EE+  L R++AS G  PV LG+LL
Sbjct  61   PYGPRWRLLRKICSVHLFSSKALDDFQHVRHEEICILIRAIASGGHAPVNLGKLL  115



>gb|AHL83556.1| flavonoid-3'-hydroxylase [Iris x hollandica]
Length=514

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 108/134 (81%), Gaps = 3/134 (2%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG KPHQ++AAM++ YGPL  LR G VDVVVAAS+ VAAQFL+ +D+NFSNRPPN
Sbjct  46   GNLPQLGTKPHQTLAAMSKLYGPLFRLRFGSVDVVVAASSTVAAQFLRTYDANFSNRPPN  105

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSL---  481
            SGAEH+AYNYQDLVFAPYGPRWRMLRK+ ++HLFS +ALDD   VRQ EVA L  +L   
Sbjct  106  SGAEHVAYNYQDLVFAPYGPRWRMLRKLCALHLFSLKALDDLRLVRQGEVAALAANLHRH  165

Query  482  ASAGKTPVKLGQLL  523
            A+ G  PV LG+ L
Sbjct  166  AANGHPPVNLGRAL  179



>ref|XP_002514665.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF47771.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=461

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  170  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  349
            +AA+A+ YGPLMHLR+GFVDV+VAASA+VAAQFLK HD NFS+RP N+GA+++AYN+QDL
Sbjct  1    MAALAQVYGPLMHLRMGFVDVIVAASASVAAQFLKTHDVNFSSRPTNAGAKYVAYNHQDL  60

Query  350  VFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            VFAPYGPRWR+LRKI+SVHLFSA+ALDDF HVR++EV  LT +LA A +TP+ LG+LL
Sbjct  61   VFAPYGPRWRLLRKISSVHLFSAKALDDFRHVREQEVGILTHALADACETPINLGRLL  118



>ref|XP_010030579.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
Length=514

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M  L+ I   +  +IFL  L L    R    LPPGPKPWP++GNLPHLG  PH+S+AA+A
Sbjct  1    MMPLSFILAAIAISIFLRSL-LGYLTRPTRALPPGPKPWPLVGNLPHLGPMPHRSMAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
              YGPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP S  +H+ YN+Q +   PY
Sbjct  60   RSYGPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPRSAGKHLGYNHQGIGAVPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            G RWRMLRKI++VHLFS++ALDDF HVRQEEVA LT +LA  G   V L QLL
Sbjct  120  GSRWRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHVGSASVNLAQLL  172



>ref|XP_006665050.1| PREDICTED: flavonoid 3'-monooxygenase-like [Oryza brachyantha]
Length=522

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 2/131 (2%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG KPHQ++ A+A  YGPL  LR G  +VVVAASA VAAQFL+VHD+NFSNRPPN
Sbjct  46   GNLPQLGDKPHQTMCALAREYGPLFRLRFGCAEVVVAASADVAAQFLRVHDANFSNRPPN  105

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLA--  484
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSA+AL+D   VR+ EVA + R+LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALEDLRAVREGEVALMVRNLARQ  165

Query  485  SAGKTPVKLGQ  517
            +A   PV LGQ
Sbjct  166  AAATAPVVLGQ  176



>gb|KHN18348.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=519

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 132/170 (78%), Gaps = 0/170 (0%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  193
            L +   T+V AI  Y L+  + +R  L LPPGP+PWPV+GNLPH+G   H+++A +A  Y
Sbjct  5    LIIGLATIVAAILSYRLLKLIIRRPSLHLPPGPRPWPVVGNLPHIGPLLHRALAVLARTY  64

Query  194  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  373
            GPLM+LRLGFVDVVVAASA+VA QFLKVHD+NFS+RP NS   ++ YN +DL FAPYGPR
Sbjct  65   GPLMYLRLGFVDVVVAASASVAEQFLKVHDANFSSRPLNSMTTYMTYNQKDLAFAPYGPR  124

Query  374  WRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            WR LRKI+SVH+FS +ALDDF  +RQEEV  LT +LAS+G T V LGQL+
Sbjct  125  WRFLRKISSVHMFSVKALDDFRQLRQEEVERLTSNLASSGSTAVNLGQLV  174



>gb|AFK73718.1| cytochrome P450 [Papaver somniferum]
Length=475

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 105/125 (84%), Gaps = 4/125 (3%)
 Frame = +2

Query  161  HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNY  340
            HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNY
Sbjct  4    HQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNY  63

Query  341  QDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGK----TPVK  508
            QDLVFAPYG RWRM RKI +VHLFS +ALD+F +VR+EEVA LT++LA + K    +PV 
Sbjct  64   QDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAKSNKNGQGSPVN  123

Query  509  LGQLL  523
            L  LL
Sbjct  124  LADLL  128



>ref|XP_003525447.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=513

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 134/174 (77%), Gaps = 1/174 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQ-RYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  181
            M+T  + F T++ A+ +Y ++  + +    LPLPPGP+PWP++GNLPH+G  PHQ +A +
Sbjct  1    MSTWVIGFATIIAAVLIYRVLKPISRPSSSLPLPPGPRPWPIVGNLPHMGPAPHQGLANL  60

Query  182  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  361
            A+ +GPLMHLRLGFVDVVVAASA+VA QFLK+HD+NF +RP N    ++AYN QDLVFAP
Sbjct  61   AQTHGPLMHLRLGFVDVVVAASASVAEQFLKIHDANFCSRPLNFRTTYLAYNKQDLVFAP  120

Query  362  YGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            YGP+WR LRK+T+VH+FSA+A+DDF  +RQEEVA LT  LA +    V L QLL
Sbjct  121  YGPKWRFLRKLTTVHMFSAKAMDDFSQLRQEEVARLTCKLARSSSKAVNLRQLL  174



>gb|AAS48419.1| flavonoid 3'-hydroxylase [Allium cepa]
Length=510

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 104/134 (78%), Gaps = 3/134 (2%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG KPHQS+  ++  YGPL  LR G+VDVVVAASA VA QFL+VHD NFSNRPPN
Sbjct  42   GNLPQLGAKPHQSLCELSRTYGPLFGLRFGYVDVVVAASADVAEQFLRVHDVNFSNRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSL---  481
            SGAEHIAYNYQDLVFAPYGPRWRMLRK+ ++HLFS +AL+D   VR  EVATL  +L   
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKLCALHLFSPKALEDLSPVRSLEVATLANTLYLR  161

Query  482  ASAGKTPVKLGQLL  523
            A + +  V L Q+L
Sbjct  162  AQSDQPTVNLAQML  175



>gb|AFP95893.1| F3'H [Narcissus tazetta]
Length=528

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 123/177 (69%), Gaps = 3/177 (2%)
 Frame = +2

Query  2    SMATLTLIFCTLVFAIFL-YFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  178
             MA L +   TL F+ FL Y    R       P PPGPK WP+LGNL  LG KPHQ++ A
Sbjct  19   GMAPLLVFLSTLFFSSFLCYISFKRSINGRSPPRPPGPKGWPILGNLLQLGAKPHQTLCA  78

Query  179  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  358
            ++  YGPL  LR G V+V+   SA VAAQFL+ HD+NFSNRPPNSGAEH+ YNYQDLVFA
Sbjct  79   LSRVYGPLFSLRFGSVNVIAVTSADVAAQFLRTHDANFSNRPPNSGAEHVVYNYQDLVFA  138

Query  359  PYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKT--PVKLGQLL  523
            PYGPRWRMLRK+ ++HLFSA+ALDDF  VR  EVA L  +L S  ++     LG+LL
Sbjct  139  PYGPRWRMLRKLCALHLFSAKALDDFRPVRAGEVAILANTLYSHAQSRREANLGELL  195



>ref|XP_003525448.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Glycine 
max]
Length=512

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 132/173 (76%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+   + F T+V A  +Y L  ++     LPLPPGP+PWP++GNLPH+G  PHQ +AA+A
Sbjct  1    MSAWVIAFATVVAATLIYRL-FKLITVPSLPLPPGPRPWPIVGNLPHMGPAPHQGLAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + +GPLMHLRLGFVDVVVA+SA+VA QFLK+HD+NF +RP NS   ++ YN QDLVFAPY
Sbjct  60   QTHGPLMHLRLGFVDVVVASSASVAEQFLKIHDANFCSRPCNSRTTYLTYNQQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR LRK+++VH+FSA+A+DDF  +RQEEV  LT +LA +    V L QLL
Sbjct  120  GPRWRFLRKLSTVHMFSAKAMDDFRELRQEEVERLTCNLARSSSKVVNLRQLL  172



>ref|XP_003550701.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=526

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPH+G   H+++A +A  YGPLM+LRLGFVDVVVAASA+VA QFLKVHD+NFS+RP N
Sbjct  51   GNLPHIGPLLHRALAVLARTYGPLMYLRLGFVDVVVAASASVAEQFLKVHDANFSSRPLN  110

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            S   ++ YN +DL FAPYGPRWR LRKI+SVH+FS +ALDDF  +RQEEV  LT +LAS+
Sbjct  111  SMTTYMTYNQKDLAFAPYGPRWRFLRKISSVHMFSVKALDDFRQLRQEEVERLTSNLASS  170

Query  491  GKTPVKLGQLL  523
            G T V LGQL+
Sbjct  171  GSTAVNLGQLV  181



>gb|KHN48735.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=512

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 132/173 (76%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+   + F T+V A  +Y L  ++     LPLPPGP+PWP++GNLPH+G  PHQ +AA+A
Sbjct  1    MSAWVIAFATVVAATLIYRL-FKLITVPSLPLPPGPRPWPIVGNLPHMGPAPHQGLAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + +GPLMHLRLGFVDVVVA+SA+VA QFLK+HD+NF +RP NS   ++ YN QDLVFAPY
Sbjct  60   KTHGPLMHLRLGFVDVVVASSASVAEQFLKIHDANFCSRPCNSRTTYLTYNQQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR LRK+++VH+FSA+A+DDF  +RQEEV  LT +LA +    V L QLL
Sbjct  120  GPRWRFLRKLSTVHMFSAKAMDDFRELRQEEVERLTCNLARSSSKVVNLRQLL  172



>ref|XP_004983036.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=515

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG KPH ++AAMA  +GPL  LR G  +VVVAASAAVAAQFL+ HD+NFSNRPPN
Sbjct  46   GNLPQLGAKPHHTMAAMAREHGPLFRLRFGSAEVVVAASAAVAAQFLRAHDANFSNRPPN  105

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSA+ALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSARALDDLRAVREGEVALMVRELARQ  165

Query  491  GKTPVKLGQ  517
                V LGQ
Sbjct  166  RGPAVALGQ  174



>gb|AFW72123.1| red aleurone1 [Zea mays]
Length=515

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP +G KPH ++ AMA  YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  46   GNLPQVGAKPHHTMCAMAREYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  105

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLA--  484
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSA+ALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARQ  165

Query  485  -SAGKTPVKLGQL  520
               G+  V LGQ+
Sbjct  166  GERGRAAVALGQV  178



>gb|AIC73642.1| flavonoid 3'-hydroxylase [Anthurium andraeanum]
Length=511

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG KPH ++AA++  YGPL+HLRLG V  VVA+SA+VAA FLK HD+NFS+RPPN
Sbjct  46   GNLPQLGAKPHHTLAALSRAYGPLLHLRLGRVHAVVASSASVAAAFLKTHDANFSSRPPN  105

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGAEH+AYNYQDLVFAPYGPRWR LRK+ SVHLF  +AL+ F HVR+EE   L R+L   
Sbjct  106  SGAEHVAYNYQDLVFAPYGPRWRTLRKLCSVHLFCTRALEGFRHVREEEAGVLARALLGR  165

Query  491  GKTPVKLGQ  517
              +   +G+
Sbjct  166  RGSAADVGE  174



>ref|NP_001064338.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|AAM00948.1|AC021892_12 Putative flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
 gb|AAN04937.1| Putative chalcone flavonoid 3' - hydroxylase [Oryza sativa Japonica 
Group]
 gb|AAP52914.1| Flavonoid 3'-monooxygenase, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26252.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|EAY78007.1| hypothetical protein OsI_33047 [Oryza sativa Indica Group]
 gb|EAZ15637.1| hypothetical protein OsJ_31048 [Oryza sativa Japonica Group]
 dbj|BAG89180.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEK31169.1| flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
Length=526

 Score =   160 bits (404),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG KPH ++ A+A +YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  52   GNLPQLGDKPHHTMCALARQYGPLFRLRFGCAEVVVAASAPVAAQFLRGHDANFSNRPPN  111

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSA+ALDD   VR+ EVA + R+LA  
Sbjct  112  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALDDLRAVREGEVALMVRNLARQ  171

Query  491  GKTPVKLGQ  517
                V LGQ
Sbjct  172  QAASVALGQ  180



>gb|AHY35314.1| flavonoid 3'-hydroxylase 2 [Morus notabilis]
Length=490

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +2

Query  143  HLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAE  322
             LG  PHQ+IAA+A ++GPLMHLR G VDVV AASA+VAAQFLK HD+NF +RPP+S A+
Sbjct  23   QLGPAPHQTIAALARKHGPLMHLRFGLVDVVAAASASVAAQFLKAHDTNFLSRPPSSAAK  82

Query  323  HIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTP  502
            H+ Y+Y DLV APYGPRWR++RKI SVHL S +AL+DF +VRQEE A L R LA+AG T 
Sbjct  83   HVGYDYHDLVLAPYGPRWRLMRKIASVHLLSGKALEDFRYVRQEEAAVLIRGLANAGPTA  142

Query  503  VKLGQLL  523
            + L QLL
Sbjct  143  INLAQLL  149



>ref|XP_008453263.1| PREDICTED: flavonoid 3'-monooxygenase [Cucumis melo]
Length=521

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  131  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  307
            GN+P +G  P H  +AAMA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGGAPLHSLLAAMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  308  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLAS  487
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI++VHLFS++ALDD   +RQ+E++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISAVHLFSSKALDDHRRIRQDEISVLVQALAR  162

Query  488  AGKTPVKLGQLL  523
            +G+ P  LG LL
Sbjct  163  SGEAPANLGSLL  174



>gb|AGJ50589.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98427.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98428.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
Length=510

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 105/131 (80%), Gaps = 1/131 (1%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG KPHQ++ A+++ +GPL  L+LG  +VVVAAS+ VAA+FL+ HD+NFSNRPPN
Sbjct  45   GNLPQLGTKPHQTMHALSKVHGPLFRLKLGSAEVVVAASSTVAAEFLRSHDANFSNRPPN  104

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGAEHIAYNY DLVFAPYGPRWR LRK+ ++HLFS +AL+D  +VR++EV  L   LAS 
Sbjct  105  SGAEHIAYNYNDLVFAPYGPRWRALRKLCALHLFSQKALEDLRYVREQEVGILAGDLAST  164

Query  491  GKTPVKLGQLL  523
             + PV LG+ L
Sbjct  165  SR-PVNLGEAL  174



>ref|XP_009394321.1| PREDICTED: flavonoid 3'-monooxygenase [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG KPH+++ A+A+ +GPL  LR G VDVVVAASAAVA+Q L+ HD+ F +RPPN
Sbjct  42   GNLPQLGPKPHRTLHALAKVHGPLFRLRFGSVDVVVAASAAVASQLLRAHDAIFCDRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SGAEH+AYNYQDLVFAPYGPRWRMLRK+ SVHLFSA+ALDD   VRQ EV  L  +L + 
Sbjct  102  SGAEHVAYNYQDLVFAPYGPRWRMLRKLCSVHLFSAKALDDLRWVRQGEVGLLVHALRAC  161

Query  491  GKTPVKLG  514
            G  PV LG
Sbjct  162  GDAPVNLG  169



>gb|AGG40645.1| flavanone 3'-hydroxylase [Narcissus tazetta]
Length=529

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = +2

Query  2    SMATLTLIFCTLVFAIFL-YFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  178
             MA L +   TL F+ FL Y    R       P PPGPK WP+LG+L  LG KPHQ++ A
Sbjct  19   GMAPLLVFLSTLFFSSFLCYISFKRSINGRSPPRPPGPKGWPILGSLLQLGAKPHQTLCA  78

Query  179  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  358
            ++  YGPL  LR G V+V+   SA VAAQFL+ HD+NFSNRPPNSGAEH+AYNYQDLVFA
Sbjct  79   LSRVYGPLFSLRFGSVNVIAVTSADVAAQFLRTHDANFSNRPPNSGAEHVAYNYQDLVFA  138

Query  359  PYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKT--PVKLGQLL  523
            PYGPRWRMLRK+ ++HLFS +ALDD   VR  EVA L  +L +  +T     LG+LL
Sbjct  139  PYGPRWRMLRKLCALHLFSPKALDDLRPVRAGEVAILANTLYNHAQTHGEANLGELL  195



>gb|AAO47856.1| flavonoid 3'-hydroxylase, partial [Glycine max]
 gb|AAO47858.1| truncated flavonoid 3'-hydroxylase, partial [Glycine max]
 gb|AAO47862.1| truncated flavonoid 3'-hydroxylase, partial [Glycine max]
Length=141

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALD  430
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS +A++
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMN  141



>dbj|BAM28973.1| flavonoid 3'-hydroxylase, partial [Lilium hybrid division I]
Length=453

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +2

Query  158  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  337
            PHQ++ A+++ +GPL  LRLG  +V+VAASA++A++FL+ HD+NFSNRPPNSGAEHIAYN
Sbjct  1    PHQTMHALSKLHGPLFRLRLGSAEVIVAASASIASEFLRTHDTNFSNRPPNSGAEHIAYN  60

Query  338  YQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  517
            Y DLVFAPYGPRWR LRK+ ++HLFS +AL+D C+VR++EVA L R LA + + PV LG+
Sbjct  61   YNDLVFAPYGPRWRALRKLCALHLFSQKALEDLCYVREQEVALLARDLAGSSR-PVNLGE  119

Query  518  LL  523
             L
Sbjct  120  TL  121



>dbj|BAH22519.1| flavonoid 3' hydroxylase [Tricyrtis hirta]
Length=505

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 117/162 (72%), Gaps = 6/162 (4%)
 Frame = +2

Query  32   TLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHL  211
            TLVFA  LY L+     R P      P      GNLP LG KPHQ++ A+++ +GPL  L
Sbjct  11   TLVFASLLYHLLSGPAHRLPPGPRGWPIL----GNLPQLGPKPHQTLHALSKAHGPLFLL  66

Query  212  RLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRK  391
            RLG VDVVVAASAAVAA FL+ HD+ FSNRPPNSGAEHIAYNYQDLVFAPYGPRWR LRK
Sbjct  67   RLGSVDVVVAASAAVAAAFLRQHDAIFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRHLRK  126

Query  392  ITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  517
            + S+HLFS++ALDD   +R++E+  LTRSL      PV LG+
Sbjct  127  LCSLHLFSSKALDDLRPIREQEIQRLTRSLLVG--RPVNLGE  166



>ref|XP_002439914.1| hypothetical protein SORBIDRAFT_09g022480 [Sorghum bicolor]
 gb|EES18344.1| hypothetical protein SORBIDRAFT_09g022480 [Sorghum bicolor]
Length=535

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 4/133 (3%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG K HQ++  + + YGPL+ LR G  DVVVA SAAVA QFL+VHD+NFS RPPN
Sbjct  58   GNLPQLGGKTHQTLHELTKVYGPLLRLRFGSSDVVVAGSAAVAEQFLRVHDANFSCRPPN  117

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            SG E +AYNYQD+VFAPYGPRWR +RK+ +V+LFSA+ALDD C VR+ E A + RSLA  
Sbjct  118  SGGELMAYNYQDVVFAPYGPRWRAMRKVCAVNLFSARALDDICDVREREAALMVRSLAEQ  177

Query  491  G----KTPVKLGQ  517
                  TPV LG+
Sbjct  178  AARDRNTPVALGK  190



>ref|XP_004138192.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
 ref|XP_004154949.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=522

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  131  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  307
            GN+P +G+   H  +A MA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGEAHLHSLLATMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  308  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLAS  487
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI++VHLFS++ALDD   +R+EE++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISTVHLFSSKALDDHRRIREEEISVLVQALAR  162

Query  488  AGKTPVKLGQLL  523
            +G+ P  LG LL
Sbjct  163  SGEAPANLGSLL  174



>gb|KGN63720.1| Flavonoid 3' hydroxylase [Cucumis sativus]
Length=488

 Score =   154 bits (389),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  131  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  307
            GN+P +G+   H  +A MA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGEAHLHSLLATMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  308  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLAS  487
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI++VHLFS++ALDD   +R+EE++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISTVHLFSSKALDDHRRIREEEISVLVQALAR  162

Query  488  AGKTPVKLGQLL  523
            +G+ P  LG LL
Sbjct  163  SGEAPANLGSLL  174



>ref|XP_008678758.1| PREDICTED: flavonoid 3'-monooxygenase-like [Zea mays]
 gb|AFW62811.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=521

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 120/159 (75%), Gaps = 2/159 (1%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILR--VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  187
            L L+  +L  ++ ++ L+LR     +   PLPPGP+ WPVLGNLP +G KPH ++ A+A 
Sbjct  5    LPLLLGSLAVSVMVWCLVLRRGGDGKGKRPLPPGPRGWPVLGNLPQVGAKPHHTMCALAR  64

Query  188  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  367
             YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPNSGAEH+AYNY+DLVFAPYG
Sbjct  65   EYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPNSGAEHVAYNYRDLVFAPYG  124

Query  368  PRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLA  484
             RWR LRK+ ++HLFSA+ALDD   VR+ EVA + R LA
Sbjct  125  SRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELA  163



>gb|ABG54319.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP +G  PH ++ A+A+ YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPHHTMCALAKEYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  107

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLA  484
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSA+ALDD   VR+ EVA + R LA
Sbjct  108  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELA  165



>gb|AAV74194.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
 gb|AAV74195.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLA  484
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSA+ALDD   +R+ EVA L R L+
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELS  165



>gb|ABG54320.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLA  484
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSA+ALDD   +R+ EVA L R L+
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELS  165



>ref|XP_002452380.1| hypothetical protein SORBIDRAFT_04g024710 [Sorghum bicolor]
 gb|EES05356.1| hypothetical protein SORBIDRAFT_04g024710 [Sorghum bicolor]
Length=517

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLA  484
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSA+ALDD   +R+ EVA L R L+
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELS  165



>gb|AEF33624.1| flavonoid 3' hydroxylase [Zea mays]
Length=517

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLA  484
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSA+ALDD   +R+ EVA L R L+
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELS  165



>gb|AII26680.1| flavonoid 3'-hydroxylase [Indosasa hispida]
Length=521

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 117/165 (71%), Gaps = 5/165 (3%)
 Frame = +2

Query  38   VFAIFLYFLILRV-KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLR  214
            V AI  Y L  R  K R   PLPPGP+ WPVLGNLP LG K HQ++  M + YGPL+ LR
Sbjct  14   VSAIVCYVLFFRAGKARRRAPLPPGPRGWPVLGNLPQLGGKTHQTLHVMTKVYGPLLRLR  73

Query  215  LGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKI  394
             G  DVVVA SAAVA QFL++HD+ FSNRPPNSG EH+AYNYQD+VF PYGPRWR +RK+
Sbjct  74   FGSSDVVVAGSAAVAEQFLRIHDAKFSNRPPNSGGEHMAYNYQDVVFGPYGPRWRAMRKV  133

Query  395  TSVHLFSAQALDDFCHVRQEEVATLTRSLASA----GKTPVKLGQ  517
             +V+LFSA+ALDD   VR+ E A + RSL  A    G   V LG+
Sbjct  134  CAVNLFSARALDDLRAVREREAALMVRSLVEASAPRGAPAVPLGK  178



>ref|XP_002454110.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
 gb|EES07086.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
Length=517

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP +G  P+ ++ A+A+ YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPYHTMCALAKEYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  107

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLA  484
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSA+ALDD   VR+ EVA + R LA
Sbjct  108  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELA  165



>gb|AFW62812.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=944

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 120/159 (75%), Gaps = 2/159 (1%)
 Frame = +2

Query  14   LTLIFCTLVFAIFLYFLILRV--KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  187
            L L+  +L  ++ ++ L+LR     +   PLPPGP+ WPVLGNLP +G KPH ++ A+A 
Sbjct  5    LPLLLGSLAVSVMVWCLVLRRGGDGKGKRPLPPGPRGWPVLGNLPQVGAKPHHTMCALAR  64

Query  188  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  367
             YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPNSGAEH+AYNY+DLVFAPYG
Sbjct  65   EYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPNSGAEHVAYNYRDLVFAPYG  124

Query  368  PRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLA  484
             RWR LRK+ ++HLFSA+ALDD   VR+ EVA + R LA
Sbjct  125  SRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELA  163



>gb|ABG54321.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=515

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP +G  PH ++ A+A+ YGPL  LR G  DVVVAASA VA QFL+ HD+NFSNRPPN
Sbjct  46   GNLPQVGSHPHHTMYALAKEYGPLFRLRFGSADVVVAASARVAVQFLRAHDANFSNRPPN  105

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLA  484
            SGAEH+AYNYQD+VFAPYG RWR LRK+ ++HLFSA+ALDD   VR+ EVA + R LA
Sbjct  106  SGAEHMAYNYQDMVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRQLA  163



>ref|XP_002452385.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
 gb|EES05361.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
Length=517

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP +G  PH ++ A+A+ YGPL  LR G  DVVVAASA VA QFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPHHTMYALAKEYGPLFRLRFGSADVVVAASARVAVQFLRAHDANFSNRPPN  107

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLA  484
            SGAEH+AYNYQD+VFAPYG RWR LRK+ ++HLFSA+ALDD   VR+ EVA + R LA
Sbjct  108  SGAEHMAYNYQDMVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRQLA  165



>gb|KCW83706.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=465

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  158  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  337
            PH+S+AA+A  YGPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP S  +H+ YN
Sbjct  2    PHRSMAALARSYGPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPRSAGKHLGYN  61

Query  338  YQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  517
            +Q +   PYG RWRMLRKI++VHLFS++ALDDF HVRQEEVA LT +LA  G   V L Q
Sbjct  62   HQGIGAVPYGSRWRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHVGSASVNLAQ  121

Query  518  LL  523
            LL
Sbjct  122  LL  123



>gb|KCW83705.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=478

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = +2

Query  158  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  337
            PH+S+AA+A  YGPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP S  +H+ YN
Sbjct  2    PHRSMAALARSYGPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPRSAGKHLGYN  61

Query  338  YQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  517
            +Q +   PYG RWRMLRKI++VHLFS++ALDDF HVRQEEVA LT +LA  G   V L Q
Sbjct  62   HQGIGAVPYGSRWRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHVGSASVNLAQ  121

Query  518  LL  523
            LL
Sbjct  122  LL  123



>gb|AII26679.1| flavonoid 3'-monooxygenase [Indosasa hispida]
Length=521

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 117/165 (71%), Gaps = 5/165 (3%)
 Frame = +2

Query  38   VFAIFLYFLILRV-KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLR  214
            V AI  Y L  R  K R   PLPPGP+ WPVLGNLP LG K HQ++  M + YGPL+ LR
Sbjct  14   VSAIVCYVLFFRAGKARRRAPLPPGPRGWPVLGNLPQLGGKTHQTLHVMTKVYGPLLRLR  73

Query  215  LGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKI  394
             G  DVVVA SAAVA QFL++HD+ FSNRPP+SG EH+AYNYQD+VF PYGPRWR +RK+
Sbjct  74   FGSSDVVVAGSAAVAEQFLRIHDAKFSNRPPSSGGEHMAYNYQDVVFGPYGPRWRAMRKV  133

Query  395  TSVHLFSAQALDDFCHVRQEEVATLTRSLASA----GKTPVKLGQ  517
             +V+LFSA+ALDD   VR+ E A + RSL  A    G   V LG+
Sbjct  134  CAVNLFSARALDDLRAVREREAALMVRSLVEASAPRGAPAVPLGK  178



>ref|XP_010939156.1| PREDICTED: flavonoid 3'-monooxygenase-like [Elaeis guineensis]
Length=516

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 2/131 (2%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG KPH ++ A++  +GP+  LRLG VDVVVAASAAVA QFL+ HD+NFS+RPPN
Sbjct  45   GNLPQLGSKPHHTLHALSRAHGPIFRLRLGSVDVVVAASAAVATQFLRAHDANFSHRPPN  104

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSL--A  484
            SGAEHIAYNYQDLVFAPYGPRWR  RK+ ++HLFS +AL+D   VR+ E+A L R+L   
Sbjct  105  SGAEHIAYNYQDLVFAPYGPRWRARRKLLNLHLFSGKALEDLRPVREGELAVLVRALWDR  164

Query  485  SAGKTPVKLGQ  517
            +    PV LG+
Sbjct  165  TGANEPVDLGR  175



>ref|XP_003525450.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=511

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 124/173 (72%), Gaps = 1/173 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+   +   T+V AI +Y  +L+      LPLPPGP+PWP++GNLPH+G  PHQ +AA+A
Sbjct  1    MSPWVIAVATIVAAILIY-RVLKHIAGPSLPLPPGPRPWPIVGNLPHMGPAPHQGLAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + +GPLMHLRLGFV VVVAASAAVA QFLKVHD+NF NRP N    ++ YN +D+ F PY
Sbjct  60   KTHGPLMHLRLGFVHVVVAASAAVAEQFLKVHDANFCNRPYNFRTTYMTYNKKDIAFYPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLL  523
            GPRWR LRKI +VH+FS +A+D+F  +RQEEV  L  +L  +    V L QLL
Sbjct  120  GPRWRFLRKICTVHMFSGKAMDNFSQLRQEEVERLACNLTRSNSKAVNLRQLL  172



>gb|KHN48734.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=506

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLPH+G  PHQ +AA+A+ +GPLMHLRLGFV VVVAASAAVA QFLKVHD+NF NRP N
Sbjct  37   GNLPHMGPAPHQGLAALAKTHGPLMHLRLGFVHVVVAASAAVAEQFLKVHDANFCNRPYN  96

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
                ++ YN +D+ F PYGPRWR LRKI +VH+FS +A+D+F  +RQEEV  L  +L  +
Sbjct  97   FRTTYMTYNKKDIAFYPYGPRWRFLRKICTVHMFSGKAMDNFSQLRQEEVERLACNLTRS  156

Query  491  GKTPVKLGQLL  523
                V L QLL
Sbjct  157  NSKAVNLRQLL  167



>dbj|BAJ95115.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 100/131 (76%), Gaps = 2/131 (2%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG KPH ++AA+A R+GPL  LR G  DVVVAASA VAA FL+ HD+NF++RPPN
Sbjct  65   GNLPQLGDKPHHTMAALARRHGPLFRLRFGSADVVVAASAKVAATFLRAHDANFTDRPPN  124

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRS--LA  484
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFS++ALD   +VRQEE   +     L 
Sbjct  125  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSSRALDALRYVRQEEARLMVTRLHLL  184

Query  485  SAGKTPVKLGQ  517
            S+   PV +GQ
Sbjct  185  SSSGLPVAVGQ  195



>ref|XP_006579509.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X2 [Glycine 
max]
Length=365

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = +2

Query  5    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  184
            M+   + F T+V A  +Y L  ++     LPLPPGP+PWP++GNLPH+G  PHQ +AA+A
Sbjct  1    MSAWVIAFATVVAATLIYRL-FKLITVPSLPLPPGPRPWPIVGNLPHMGPAPHQGLAALA  59

Query  185  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  364
            + +GPLMHLRLGFVDVVVA+SA+VA QFLK+HD+NF +RP NS   ++ YN QDLVFAPY
Sbjct  60   QTHGPLMHLRLGFVDVVVASSASVAEQFLKIHDANFCSRPCNSRTTYLTYNQQDLVFAPY  119

Query  365  GPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASA  490
            GPRWR LRK+++VH+FSA+A+DDF  +RQ+     T + +S 
Sbjct  120  GPRWRFLRKLSTVHMFSAKAMDDFRELRQDMFTAGTDTSSST  161



>ref|XP_008791304.1| PREDICTED: flavonoid 3'-monooxygenase-like [Phoenix dactylifera]
Length=517

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +2

Query  131  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  310
            GNLP LG KPH ++ A++  +GPL  LRLG VDVVVAASAAVAAQFL+ HD+NFSNRPPN
Sbjct  45   GNLPQLGPKPHHTLHALSRAHGPLFRLRLGSVDVVVAASAAVAAQFLRAHDANFSNRPPN  104

Query  311  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSL  481
            SGAEHIAYNYQDLVFAPYGP WR  RK+ +VHLFS +AL+D   VR+ E+A L R+L
Sbjct  105  SGAEHIAYNYQDLVFAPYGPGWRARRKLLNVHLFSGKALEDLRPVREGELALLVRAL  161



>gb|AGT50312.1| flavonoid 3'-hydroxylase, partial [Meconopsis racemosa]
Length=445

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 95/113 (84%), Gaps = 4/113 (4%)
 Frame = +2

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLL  523
            RM RKI +VHLFS +ALD+F +VR+EEVA LT++LA + K    +PV L  LL
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLL  113



>gb|AGT50315.1| flavonoid 3'-hydroxylase, partial [Meconopsis betonicifolia]
Length=452

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 95/113 (84%), Gaps = 4/113 (4%)
 Frame = +2

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLL  523
            RM RKI +VHLFS +ALD+F +VR+EEVA LT++LA + K    +PV L  LL
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLL  113



>gb|AGT50314.1| flavonoid 3'-hydroxylase, partial [Meconopsis henrici]
Length=445

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 95/113 (84%), Gaps = 4/113 (4%)
 Frame = +2

Query  197  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  376
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  377  RMLRKITSVHLFSAQALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLL  523
            RM RKI +VHLFS +ALD+F +VR+EEVA LT++LA + K    +PV L  LL
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLL  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800