BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF045L12

Length=673
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP29763.1|  hypothetical protein JCGZ_18698                         281   1e-99   Jatropha curcas
ref|XP_006353172.1|  PREDICTED: uncharacterized protein At1g04910...    275   2e-99   
ref|XP_006353173.1|  PREDICTED: uncharacterized protein At1g04910...    275   3e-99   Solanum tuberosum [potatoes]
ref|XP_008347789.1|  PREDICTED: uncharacterized protein At1g04910...    284   6e-99   
ref|XP_008347790.1|  PREDICTED: uncharacterized protein At1g04910...    284   6e-99   
ref|XP_009783617.1|  PREDICTED: uncharacterized protein At1g04910...    276   7e-99   Nicotiana sylvestris
ref|XP_010312647.1|  PREDICTED: uncharacterized protein At1g04910...    276   1e-98   
gb|AAK84479.1|  putative auxin growth promotor protein                  276   1e-98   Solanum lycopersicum
ref|XP_010312649.1|  PREDICTED: uncharacterized protein At1g04910...    276   1e-98   Solanum lycopersicum
ref|XP_008385667.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    284   1e-98   Malus domestica [apple tree]
ref|XP_010312648.1|  PREDICTED: uncharacterized protein At1g04910...    275   1e-98   
ref|XP_007207425.1|  hypothetical protein PRUPE_ppa004921mg             281   2e-98   
ref|XP_007207426.1|  hypothetical protein PRUPE_ppa004921mg             281   2e-98   
ref|XP_011021848.1|  PREDICTED: uncharacterized protein At1g04910       280   3e-98   Populus euphratica
gb|KHG05570.1|  hypothetical protein F383_31127                         283   5e-98   Gossypium arboreum [tree cotton]
emb|CDP01562.1|  unnamed protein product                                278   5e-98   Coffea canephora [robusta coffee]
gb|KDO60569.1|  hypothetical protein CISIN_1g009234mg                   280   5e-98   Citrus sinensis [apfelsine]
ref|XP_007047791.1|  O-fucosyltransferase family protein isoform 1      284   5e-98   
ref|XP_009797993.1|  PREDICTED: uncharacterized protein At1g04910...    271   6e-98   Nicotiana sylvestris
ref|XP_006587571.1|  PREDICTED: uncharacterized protein At1g04910...    276   7e-98   Glycine max [soybeans]
ref|XP_002310868.1|  hypothetical protein POPTR_0007s14280g             279   7e-98   Populus trichocarpa [western balsam poplar]
ref|XP_009797995.1|  PREDICTED: uncharacterized protein At1g04910...    271   7e-98   Nicotiana sylvestris
ref|XP_006426272.1|  hypothetical protein CICLE_v10025329mg             280   7e-98   Citrus clementina [clementine]
ref|XP_006466306.1|  PREDICTED: uncharacterized protein At1g04910...    280   8e-98   Citrus sinensis [apfelsine]
ref|XP_003534239.1|  PREDICTED: uncharacterized protein At1g04910...    276   9e-98   Glycine max [soybeans]
gb|KJB44061.1|  hypothetical protein B456_007G232700                    280   1e-97   Gossypium raimondii
gb|KHG27420.1|  hypothetical protein F383_15612                         280   3e-97   Gossypium arboreum [tree cotton]
gb|KJB44059.1|  hypothetical protein B456_007G232700                    279   3e-97   Gossypium raimondii
ref|XP_008440542.1|  PREDICTED: uncharacterized protein At1g04910       276   7e-97   Cucumis melo [Oriental melon]
gb|KJB18178.1|  hypothetical protein B456_003G038000                    273   3e-96   Gossypium raimondii
gb|EYU39303.1|  hypothetical protein MIMGU_mgv1a004838mg                276   3e-96   Erythranthe guttata [common monkey flower]
ref|XP_004143441.1|  PREDICTED: DUF246 domain-containing protein ...    274   4e-96   Cucumis sativus [cucumbers]
gb|KJB18177.1|  hypothetical protein B456_003G038000                    272   5e-96   Gossypium raimondii
gb|KJB18179.1|  hypothetical protein B456_003G038000                    272   6e-96   Gossypium raimondii
gb|KJB18182.1|  hypothetical protein B456_003G038000                    272   7e-96   Gossypium raimondii
ref|XP_009623753.1|  PREDICTED: uncharacterized protein At1g04910...    271   8e-96   
ref|XP_009623754.1|  PREDICTED: uncharacterized protein At1g04910...    271   1e-95   Nicotiana tomentosiformis
ref|XP_004288516.2|  PREDICTED: uncharacterized protein At1g04910       273   1e-95   Fragaria vesca subsp. vesca
ref|XP_010523310.1|  PREDICTED: uncharacterized protein At1g04910...    272   7e-95   
ref|XP_009130514.1|  PREDICTED: uncharacterized protein At1g04910...    272   1e-94   Brassica rapa
ref|XP_010523312.1|  PREDICTED: uncharacterized protein At1g04910...    272   1e-94   Tarenaya hassleriana [spider flower]
ref|XP_009130513.1|  PREDICTED: uncharacterized protein At1g04910...    272   1e-94   Brassica rapa
emb|CDY37829.1|  BnaAnng04900D                                          272   1e-94   Brassica napus [oilseed rape]
emb|CDY33958.1|  BnaC02g43790D                                          272   1e-94   Brassica napus [oilseed rape]
ref|XP_010547595.1|  PREDICTED: uncharacterized protein At1g04910...    274   1e-94   Tarenaya hassleriana [spider flower]
ref|XP_010113429.1|  hypothetical protein L484_026763                   272   1e-94   
ref|XP_010523308.1|  PREDICTED: uncharacterized protein At1g04910...    272   2e-94   Tarenaya hassleriana [spider flower]
ref|XP_010519195.1|  PREDICTED: uncharacterized protein At1g04910...    269   2e-93   Tarenaya hassleriana [spider flower]
gb|AFK40388.1|  unknown                                                 268   6e-93   Lotus japonicus
ref|XP_010254530.1|  PREDICTED: uncharacterized protein At1g04910...    270   1e-92   Nelumbo nucifera [Indian lotus]
gb|ABJ96379.1|  expressed protein                                       271   3e-91   Prunus persica
ref|XP_007222858.1|  hypothetical protein PRUPE_ppa004255mg             271   4e-91   Prunus persica
ref|XP_010937178.1|  PREDICTED: uncharacterized protein At1g04910...    268   4e-91   Elaeis guineensis
emb|CAN78778.1|  hypothetical protein VITISV_029752                     266   7e-91   Vitis vinifera
ref|XP_010107675.1|  hypothetical protein L484_007693                   264   8e-91   
ref|XP_002283844.1|  PREDICTED: uncharacterized protein At1g04910...    266   8e-91   Vitis vinifera
ref|XP_008219267.1|  PREDICTED: uncharacterized protein At1g04910...    270   1e-90   Prunus mume [ume]
ref|XP_010692399.1|  PREDICTED: uncharacterized protein At1g04910       263   1e-90   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007047792.1|  O-fucosyltransferase family protein isoform 2      283   2e-90   
ref|XP_009401410.1|  PREDICTED: uncharacterized protein At1g04910...    265   2e-90   
ref|XP_006852943.1|  hypothetical protein AMTR_s00033p00238220          266   5e-90   
ref|XP_009350347.1|  PREDICTED: uncharacterized protein At1g04910...    285   1e-89   Pyrus x bretschneideri [bai li]
ref|XP_009364252.1|  PREDICTED: uncharacterized protein At1g04910...    285   1e-89   Pyrus x bretschneideri [bai li]
ref|XP_009350346.1|  PREDICTED: uncharacterized protein At1g04910...    285   1e-89   Pyrus x bretschneideri [bai li]
ref|XP_009364251.1|  PREDICTED: uncharacterized protein At1g04910...    285   1e-89   Pyrus x bretschneideri [bai li]
ref|XP_010939815.1|  PREDICTED: uncharacterized protein At1g04910...    263   1e-89   
ref|XP_006338062.1|  PREDICTED: uncharacterized protein At1g04910...    263   2e-89   Solanum tuberosum [potatoes]
gb|EPS73888.1|  hypothetical protein M569_00867                         266   2e-89   Genlisea aurea
ref|XP_004237994.1|  PREDICTED: uncharacterized protein At1g04910       264   2e-89   Solanum lycopersicum
ref|XP_010523344.1|  PREDICTED: uncharacterized protein At1g04910       263   3e-89   Tarenaya hassleriana [spider flower]
ref|XP_007018221.1|  O-fucosyltransferase family protein                265   4e-89   
gb|KCW68511.1|  hypothetical protein EUGRSUZ_F02148                     263   4e-89   Eucalyptus grandis [rose gum]
ref|XP_010061545.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    263   4e-89   Eucalyptus grandis [rose gum]
ref|XP_009624657.1|  PREDICTED: uncharacterized protein At1g04910...    263   6e-89   Nicotiana tomentosiformis
gb|KDP41479.1|  hypothetical protein JCGZ_15886                         266   9e-89   Jatropha curcas
ref|XP_004301363.1|  PREDICTED: uncharacterized protein At1g04910       262   2e-88   Fragaria vesca subsp. vesca
emb|CDP11502.1|  unnamed protein product                                258   2e-88   Coffea canephora [robusta coffee]
ref|XP_008236140.1|  PREDICTED: uncharacterized protein At1g04910...    281   2e-88   Prunus mume [ume]
ref|XP_008236135.1|  PREDICTED: uncharacterized protein At1g04910...    282   3e-88   Prunus mume [ume]
ref|XP_009785662.1|  PREDICTED: uncharacterized protein At1g04910...    259   3e-88   Nicotiana sylvestris
ref|XP_011016933.1|  PREDICTED: uncharacterized protein At1g04910...    257   3e-88   Populus euphratica
ref|XP_002514041.1|  conserved hypothetical protein                     257   3e-88   Ricinus communis
ref|XP_011016934.1|  PREDICTED: uncharacterized protein At1g04910...    257   4e-88   Populus euphratica
emb|CDY34289.1|  BnaA01g13920D                                          264   4e-88   Brassica napus [oilseed rape]
ref|XP_002301095.2|  hypothetical protein POPTR_0002s10600g             257   4e-88   
ref|XP_006472461.1|  PREDICTED: uncharacterized protein At1g04910...    260   5e-88   Citrus sinensis [apfelsine]
ref|XP_006472463.1|  PREDICTED: uncharacterized protein At1g04910...    260   5e-88   
ref|XP_004501643.1|  PREDICTED: uncharacterized protein At1g04910...    259   6e-88   Cicer arietinum [garbanzo]
gb|AGV54860.1|  O-fucosyltransferase family protein                     265   6e-88   Phaseolus vulgaris [French bean]
ref|XP_011099984.1|  PREDICTED: uncharacterized protein At1g04910...    280   8e-88   Sesamum indicum [beniseed]
ref|XP_008368388.1|  PREDICTED: uncharacterized protein At1g04910...    262   8e-88   
ref|XP_011099981.1|  PREDICTED: uncharacterized protein At1g04910...    280   8e-88   Sesamum indicum [beniseed]
gb|EYU30936.1|  hypothetical protein MIMGU_mgv1a004530mg                280   1e-87   Erythranthe guttata [common monkey flower]
ref|XP_010277497.1|  PREDICTED: uncharacterized protein At1g04910...    253   1e-87   Nelumbo nucifera [Indian lotus]
emb|CDY03446.1|  BnaC01g16360D                                          263   3e-87   
ref|XP_006433826.1|  hypothetical protein CICLE_v10000880mg             260   3e-87   
gb|KHG22139.1|  hypothetical protein F383_05782                         277   3e-87   Gossypium arboreum [tree cotton]
ref|XP_006433827.1|  hypothetical protein CICLE_v10000880mg             260   3e-87   Citrus clementina [clementine]
ref|XP_009138156.1|  PREDICTED: uncharacterized protein At1g04910       263   3e-87   Brassica rapa
gb|KJB58883.1|  hypothetical protein B456_009G229500                    258   4e-87   Gossypium raimondii
ref|XP_003602912.1|  PsRT17-1 like protein                              256   4e-87   Medicago truncatula
gb|KJB58881.1|  hypothetical protein B456_009G229500                    257   4e-87   Gossypium raimondii
ref|XP_010439017.1|  PREDICTED: uncharacterized protein At1g04910...    258   4e-87   
ref|XP_010448552.1|  PREDICTED: uncharacterized protein At1g04910...    258   6e-87   Camelina sativa [gold-of-pleasure]
ref|XP_003523785.1|  PREDICTED: uncharacterized protein At1g04910...    261   7e-87   Glycine max [soybeans]
gb|KHN08263.1|  DUF246 domain-containing protein                        261   8e-87   Glycine soja [wild soybean]
ref|XP_011097478.1|  PREDICTED: uncharacterized protein At1g04910...    278   8e-87   Sesamum indicum [beniseed]
ref|XP_002867661.1|  predicted protein                                  256   1e-86   Arabidopsis lyrata subsp. lyrata
ref|XP_002533683.1|  conserved hypothetical protein                     276   2e-86   Ricinus communis
ref|XP_010433755.1|  PREDICTED: uncharacterized protein At1g04910...    258   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010680342.1|  PREDICTED: uncharacterized protein At1g04910       275   5e-86   Beta vulgaris subsp. vulgaris [field beet]
emb|CAA23010.1|  PsRT17-1 like protein                                  254   7e-86   Arabidopsis thaliana [mouse-ear cress]
gb|EEE69695.1|  hypothetical protein OsJ_29339                          252   8e-86   Oryza sativa Japonica Group [Japonica rice]
gb|KFK28724.1|  hypothetical protein AALP_AA7G039000                    257   9e-86   Arabis alpina [alpine rockcress]
ref|XP_003517397.1|  PREDICTED: uncharacterized protein At1g04910...    275   1e-85   Glycine max [soybeans]
ref|XP_006573005.1|  PREDICTED: uncharacterized protein At1g04910...    275   1e-85   Glycine max [soybeans]
ref|NP_194184.2|  O-fucosyltransferase family protein                   254   1e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007158370.1|  hypothetical protein PHAVU_002G147300g             275   1e-85   Phaseolus vulgaris [French bean]
gb|KHN14510.1|  DUF246 domain-containing protein                        275   1e-85   Glycine soja [wild soybean]
gb|KJB18181.1|  hypothetical protein B456_003G038000                    272   2e-85   Gossypium raimondii
gb|KCW54611.1|  hypothetical protein EUGRSUZ_I00557                     273   2e-85   Eucalyptus grandis [rose gum]
ref|XP_002268599.2|  PREDICTED: uncharacterized protein At1g04910       274   2e-85   Vitis vinifera
ref|XP_010027954.1|  PREDICTED: uncharacterized protein At1g04910       273   3e-85   Eucalyptus grandis [rose gum]
ref|XP_006285210.1|  hypothetical protein CARUB_v10006569mg             254   3e-85   Capsella rubella
gb|KGN62755.1|  hypothetical protein Csa_2G370540                       246   5e-85   
gb|EEC84568.1|  hypothetical protein OsI_31345                          251   8e-85   Oryza sativa Indica Group [Indian rice]
ref|XP_008651492.1|  PREDICTED: LOC100283829 isoform X1                 253   8e-85   Zea mays [maize]
ref|NP_001063155.1|  Os09g0412200                                       251   8e-85   
tpg|DAA61415.1|  TPA: hypothetical protein ZEAMMB73_640362              253   1e-84   
ref|NP_001150199.1|  LOC100283829                                       253   1e-84   Zea mays [maize]
ref|XP_003613050.1|  DUF246 domain-containing protein                   264   2e-84   
ref|XP_006661225.1|  PREDICTED: uncharacterized protein At1g04910...    248   2e-84   
ref|XP_006394028.1|  hypothetical protein EUTSA_v10004041mg             271   2e-84   
ref|XP_006394027.1|  hypothetical protein EUTSA_v10004041mg             271   2e-84   Eutrema salsugineum [saltwater cress]
ref|XP_002864958.1|  hypothetical protein ARALYDRAFT_496780             271   2e-84   
ref|NP_201350.2|  O-fucosyltransferase family protein                   271   2e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13166.1|  unknown protein                                         271   2e-84   Arabidopsis thaliana [mouse-ear cress]
gb|EYU30935.1|  hypothetical protein MIMGU_mgv1a004530mg                271   2e-84   Erythranthe guttata [common monkey flower]
dbj|BAB11569.1|  unnamed protein product                                271   2e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AAB72114.1|  PsRT17-1                                                268   3e-84   Pisum sativum [garden pea]
ref|XP_010444520.1|  PREDICTED: uncharacterized protein At1g04910...    271   3e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010463027.1|  PREDICTED: uncharacterized protein At1g04910...    271   3e-84   Camelina sativa [gold-of-pleasure]
ref|XP_006280335.1|  hypothetical protein CARUB_v10026260mg             271   4e-84   
ref|XP_004956798.1|  PREDICTED: uncharacterized protein At1g04910...    249   4e-84   Setaria italica
ref|XP_010484355.1|  PREDICTED: uncharacterized protein At1g04910...    271   4e-84   Camelina sativa [gold-of-pleasure]
ref|XP_006413418.1|  hypothetical protein EUTSA_v10024936mg             256   4e-84   Eutrema salsugineum [saltwater cress]
ref|XP_008802622.1|  PREDICTED: uncharacterized protein At1g04910...    270   7e-84   Phoenix dactylifera
ref|XP_009150636.1|  PREDICTED: uncharacterized protein At1g04910       269   1e-83   Brassica rapa
emb|CDY14569.1|  BnaC03g48900D                                          269   1e-83   Brassica napus [oilseed rape]
dbj|BAK06980.1|  predicted protein                                      245   2e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW54609.1|  hypothetical protein EUGRSUZ_I00557                     269   2e-83   Eucalyptus grandis [rose gum]
ref|XP_004509777.1|  PREDICTED: uncharacterized protein At1g04910...    268   2e-83   Cicer arietinum [garbanzo]
ref|XP_002462371.1|  hypothetical protein SORBIDRAFT_02g024540          250   3e-83   Sorghum bicolor [broomcorn]
gb|EPS72903.1|  hypothetical protein M569_01846                         268   3e-83   Genlisea aurea
dbj|BAE71212.1|  hypothetical protein                                   265   3e-83   Trifolium pratense [peavine clover]
ref|XP_010664406.1|  PREDICTED: uncharacterized protein At1g04910...    266   4e-83   Vitis vinifera
ref|XP_007136338.1|  hypothetical protein PHAVU_009G0371000g            266   7e-83   Phaseolus vulgaris [French bean]
gb|EMT16885.1|  hypothetical protein F775_06176                         244   1e-82   
ref|XP_003613049.1|  DUF246 domain-containing protein                   265   4e-82   Medicago truncatula
ref|XP_003578106.1|  PREDICTED: uncharacterized protein At1g04910...    247   2e-81   Brachypodium distachyon [annual false brome]
ref|XP_009376221.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    263   5e-81   Pyrus x bretschneideri [bai li]
gb|KHN09000.1|  DUF246 domain-containing protein                        262   7e-81   Glycine soja [wild soybean]
ref|XP_003526543.1|  PREDICTED: uncharacterized protein At1g04910...    262   7e-81   Glycine max [soybeans]
gb|EMS64135.1|  hypothetical protein TRIUR3_23110                       236   1e-79   Triticum urartu
gb|KJB48896.1|  hypothetical protein B456_008G092600                    256   1e-78   Gossypium raimondii
ref|XP_008444924.1|  PREDICTED: uncharacterized protein At1g04910...    248   3e-75   Cucumis melo [Oriental melon]
ref|XP_004152738.1|  PREDICTED: DUF246 domain-containing protein ...    245   2e-74   Cucumis sativus [cucumbers]
gb|AGV54211.1|  O-fucosyltransferase family protein                     244   5e-74   Phaseolus vulgaris [French bean]
ref|XP_001777077.1|  predicted protein                                  206   1e-68   
ref|XP_010312650.1|  PREDICTED: uncharacterized protein At1g04910...    219   6e-65   Solanum lycopersicum
ref|XP_002967262.1|  hypothetical protein SELMODRAFT_87093              204   5e-59   
ref|XP_002960458.1|  hypothetical protein SELMODRAFT_75338              204   6e-59   
gb|KJB44060.1|  hypothetical protein B456_007G232700                    184   7e-52   Gossypium raimondii
gb|KJB58885.1|  hypothetical protein B456_009G229500                    171   3e-47   Gossypium raimondii
ref|XP_008378640.1|  PREDICTED: uncharacterized protein At1g04910...    169   8e-46   
ref|XP_010277498.1|  PREDICTED: uncharacterized protein At1g04910...    159   1e-42   
ref|XP_002990403.1|  hypothetical protein SELMODRAFT_131659             151   9e-40   
ref|XP_002987806.1|  hypothetical protein SELMODRAFT_126689             151   1e-39   
ref|XP_001765982.1|  predicted protein                                  148   4e-38   
gb|AGE09594.1|  UP7-like protein                                        144   1e-37   Eucalyptus cladocalyx
dbj|BAJ93371.1|  predicted protein                                      145   1e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT12043.1|  hypothetical protein F775_07612                         144   2e-36   
ref|XP_006847061.1|  hypothetical protein AMTR_s00017p00201590          142   9e-36   Amborella trichopoda
ref|XP_008669806.1|  PREDICTED: uncharacterized protein At1g04910...    141   2e-35   Zea mays [maize]
ref|NP_001132122.1|  uncharacterized protein LOC100193539               138   2e-35   
gb|EEC80777.1|  hypothetical protein OsI_23300                          141   2e-35   Oryza sativa Indica Group [Indian rice]
ref|NP_001057817.1|  Os06g0545900                                       141   2e-35   
ref|XP_008669807.1|  PREDICTED: uncharacterized protein At1g04910...    140   2e-35   Zea mays [maize]
ref|XP_008669805.1|  PREDICTED: uncharacterized protein At1g04910...    141   2e-35   Zea mays [maize]
gb|KJB59186.1|  hypothetical protein B456_009G243300                    140   3e-35   Gossypium raimondii
ref|XP_006657039.1|  PREDICTED: uncharacterized protein At1g04910...    140   4e-35   Oryza brachyantha
ref|XP_010274355.1|  PREDICTED: uncharacterized protein At1g04910...    140   9e-35   Nelumbo nucifera [Indian lotus]
gb|KJB59187.1|  hypothetical protein B456_009G243300                    139   1e-34   Gossypium raimondii
gb|EMT33054.1|  hypothetical protein F775_09106                         138   1e-34   
ref|XP_010227672.1|  PREDICTED: uncharacterized protein At1g04910       139   1e-34   
gb|KJB59188.1|  hypothetical protein B456_009G243300                    139   2e-34   Gossypium raimondii
ref|XP_010272863.1|  PREDICTED: uncharacterized protein At1g04910...    139   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_008661414.1|  PREDICTED: uncharacterized protein LOC100193...    139   2e-34   Zea mays [maize]
ref|XP_003578848.1|  PREDICTED: uncharacterized protein At1g04910...    139   2e-34   Brachypodium distachyon [annual false brome]
gb|AFW56213.1|  hypothetical protein ZEAMMB73_697257                    138   2e-34   
ref|XP_008784225.1|  PREDICTED: uncharacterized protein At1g04910...    138   3e-34   Phoenix dactylifera
ref|XP_011101082.1|  PREDICTED: uncharacterized protein At1g04910       132   3e-34   Sesamum indicum [beniseed]
dbj|BAJ97328.1|  predicted protein                                      138   3e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009390063.1|  PREDICTED: uncharacterized protein At1g04910...    137   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006644988.1|  PREDICTED: uncharacterized protein At1g04910...    137   4e-34   
dbj|BAD81763.1|  putative auxin-independent growth promoter             135   4e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004965564.1|  PREDICTED: uncharacterized protein At1g04910...    137   4e-34   Setaria italica
ref|XP_010925619.1|  PREDICTED: uncharacterized protein At1g04910...    138   4e-34   Elaeis guineensis
ref|NP_001044765.1|  Os01g0841200                                       135   9e-34   
ref|XP_006472724.1|  PREDICTED: uncharacterized protein At1g04910...    136   9e-34   Citrus sinensis [apfelsine]
ref|XP_004965563.1|  PREDICTED: uncharacterized protein At1g04910...    137   1e-33   Setaria italica
ref|XP_004965562.1|  PREDICTED: uncharacterized protein At1g04910...    137   1e-33   Setaria italica
ref|XP_006434132.1|  hypothetical protein CICLE_v10000652mg             136   1e-33   Citrus clementina [clementine]
ref|XP_004965561.1|  PREDICTED: uncharacterized protein At1g04910...    137   1e-33   Setaria italica
ref|XP_001760728.1|  predicted protein                                  136   1e-33   
ref|XP_006472723.1|  PREDICTED: uncharacterized protein At1g04910...    136   1e-33   Citrus sinensis [apfelsine]
ref|XP_006434133.1|  hypothetical protein CICLE_v10000652mg             136   1e-33   Citrus clementina [clementine]
gb|EEE55649.1|  hypothetical protein OsJ_04031                          135   1e-33   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71770.1|  hypothetical protein OsI_04380                          135   2e-33   Oryza sativa Indica Group [Indian rice]
gb|EMS55867.1|  hypothetical protein TRIUR3_34733                       135   2e-33   Triticum urartu
ref|XP_002441904.1|  hypothetical protein SORBIDRAFT_08g004650          135   2e-33   
ref|XP_009799750.1|  PREDICTED: uncharacterized protein At1g04910...    135   2e-33   Nicotiana sylvestris
ref|NP_001066285.2|  Os12g0174100                                       135   3e-33   
ref|XP_006664382.1|  PREDICTED: uncharacterized protein At1g04910...    134   3e-33   
ref|XP_002489034.1|  hypothetical protein SORBIDRAFT_0344s002010        135   3e-33   
gb|EEE52851.1|  hypothetical protein OsJ_35390                          135   3e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006841300.1|  hypothetical protein AMTR_s00134p00086190          134   3e-33   
ref|XP_006826849.1|  hypothetical protein AMTR_s00010p00112560          135   3e-33   Amborella trichopoda
emb|CDY50783.1|  BnaA09g54120D                                          135   4e-33   Brassica napus [oilseed rape]
ref|XP_009115262.1|  PREDICTED: uncharacterized protein At1g04910...    135   4e-33   Brassica rapa
ref|XP_009345471.1|  PREDICTED: uncharacterized protein At1g04910...    128   4e-33   
ref|XP_002513766.1|  conserved hypothetical protein                     135   5e-33   Ricinus communis
gb|EEC68940.1|  hypothetical protein OsI_37646                          134   5e-33   Oryza sativa Indica Group [Indian rice]
ref|NP_001117378.1|  O-fucosyltransferase-like protein                  134   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009799749.1|  PREDICTED: uncharacterized protein At1g04910...    135   6e-33   Nicotiana sylvestris
ref|XP_009604296.1|  PREDICTED: uncharacterized protein At1g04910...    135   6e-33   Nicotiana tomentosiformis
ref|NP_174215.2|  O-fucosyltransferase-like protein                     134   6e-33   Arabidopsis thaliana [mouse-ear cress]
gb|EYU22927.1|  hypothetical protein MIMGU_mgv1a018388mg                134   7e-33   Erythranthe guttata [common monkey flower]
ref|XP_009799748.1|  PREDICTED: uncharacterized protein At1g04910...    135   7e-33   Nicotiana sylvestris
ref|XP_010103337.1|  hypothetical protein L484_014377                   128   7e-33   Morus notabilis
ref|XP_010262908.1|  PREDICTED: uncharacterized protein At1g04910...    134   7e-33   
ref|XP_009373425.1|  PREDICTED: uncharacterized protein At1g04910...    126   7e-33   
ref|XP_009604295.1|  PREDICTED: uncharacterized protein At1g04910...    135   7e-33   Nicotiana tomentosiformis
ref|XP_010262622.1|  PREDICTED: uncharacterized protein At1g04910...    134   7e-33   Nelumbo nucifera [Indian lotus]
ref|XP_004970534.1|  PREDICTED: uncharacterized protein At1g04910...    134   8e-33   
ref|XP_010262851.1|  PREDICTED: uncharacterized protein At1g04910...    134   8e-33   
ref|XP_010262779.1|  PREDICTED: uncharacterized protein At1g04910...    134   8e-33   
ref|XP_010262705.1|  PREDICTED: uncharacterized protein At1g04910...    134   8e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010695805.1|  PREDICTED: uncharacterized protein At1g04910...    134   9e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010274715.1|  PREDICTED: uncharacterized protein At1g04910...    134   9e-33   Nelumbo nucifera [Indian lotus]
ref|XP_007018985.1|  O-fucosyltransferase family protein isoform 2      134   9e-33   Theobroma cacao [chocolate]
gb|EPS60639.1|  hypothetical protein M569_14161                         130   9e-33   Genlisea aurea
ref|XP_009344152.1|  PREDICTED: uncharacterized protein At1g04910...    130   9e-33   Pyrus x bretschneideri [bai li]
gb|AES59903.2|  O-fucosyltransferase family protein                     133   1e-32   Medicago truncatula
ref|XP_007018984.1|  O-fucosyltransferase family protein isoform 1      134   1e-32   
gb|ACG28723.1|  growth regulator                                        134   1e-32   Zea mays [maize]
ref|XP_010104478.1|  hypothetical protein L484_025447                   129   1e-32   
gb|KDP24728.1|  hypothetical protein JCGZ_25329                         128   1e-32   Jatropha curcas
ref|XP_010530190.1|  PREDICTED: uncharacterized protein At1g04910...    133   1e-32   Tarenaya hassleriana [spider flower]
ref|XP_009379852.1|  PREDICTED: uncharacterized protein At1g04910...    133   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008674838.1|  PREDICTED: uncharacterized protein At1g04910...    133   1e-32   
gb|AAF88118.1|AC021043_11  Hypothetical protein                         133   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003589652.1|  hypothetical protein MTR_1g031590                  134   2e-32   
ref|XP_003564587.1|  PREDICTED: uncharacterized protein At1g04910...    133   2e-32   Brachypodium distachyon [annual false brome]
ref|XP_001753764.1|  predicted protein                                  132   2e-32   
ref|XP_010316827.1|  PREDICTED: uncharacterized protein At1g04910...    134   2e-32   Solanum lycopersicum
ref|XP_004233041.1|  PREDICTED: uncharacterized protein At1g04910...    134   2e-32   Solanum lycopersicum
ref|XP_001753325.1|  predicted protein                                  132   2e-32   
ref|NP_001117377.1|  O-fucosyltransferase-like protein                  133   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009416135.1|  PREDICTED: uncharacterized protein At1g04910...    133   2e-32   
ref|XP_009420104.1|  PREDICTED: uncharacterized protein At1g04910...    133   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912508.1|  PREDICTED: uncharacterized protein At1g04910...    132   2e-32   Elaeis guineensis
ref|XP_006582446.1|  PREDICTED: uncharacterized protein At1g04910...    132   2e-32   Glycine max [soybeans]
gb|KHN26036.1|  DUF246 domain-containing protein                        132   2e-32   Glycine soja [wild soybean]
ref|XP_010063352.1|  PREDICTED: uncharacterized protein At1g04910...    132   3e-32   Eucalyptus grandis [rose gum]
gb|AFW75942.1|  LOW QUALITY PROTEIN: auxin-independent growth pro...    126   3e-32   
ref|XP_009768450.1|  PREDICTED: uncharacterized protein At1g04910...    129   3e-32   Nicotiana sylvestris
emb|CDP07301.1|  unnamed protein product                                127   3e-32   Coffea canephora [robusta coffee]
gb|KJB30799.1|  hypothetical protein B456_005G161000                    132   3e-32   Gossypium raimondii
ref|XP_010930789.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    132   3e-32   
emb|CBI37793.3|  unnamed protein product                                125   3e-32   
ref|XP_010246043.1|  PREDICTED: uncharacterized protein At1g04910...    132   3e-32   
ref|XP_007045152.1|  O-fucosyltransferase family protein                132   3e-32   
gb|KJB57392.1|  hypothetical protein B456_009G161400                    133   4e-32   
ref|XP_003526401.1|  PREDICTED: uncharacterized protein At1g04910...    132   4e-32   
ref|XP_003635616.2|  PREDICTED: uncharacterized protein At1g04910...    128   4e-32   
ref|NP_001132314.1|  growth regulator                                   132   4e-32   
gb|EEE51747.1|  hypothetical protein OsJ_33163                          131   5e-32   
ref|XP_010246041.1|  PREDICTED: uncharacterized protein At1g04910...    131   5e-32   
dbj|BAJ88036.1|  predicted protein                                      131   5e-32   
ref|XP_010246042.1|  PREDICTED: uncharacterized protein At1g04910...    131   5e-32   
ref|XP_009591037.1|  PREDICTED: uncharacterized protein At1g04910...    125   6e-32   
gb|EPS63860.1|  hypothetical protein M569_10923                         130   6e-32   
emb|CDP10650.1|  unnamed protein product                                131   6e-32   
ref|XP_002284399.1|  PREDICTED: uncharacterized protein At1g04910...    132   6e-32   
gb|KHN47089.1|  DUF246 domain-containing protein                        131   6e-32   
ref|XP_006473173.1|  PREDICTED: uncharacterized protein At1g04910...    130   6e-32   
emb|CBI19065.3|  unnamed protein product                                132   7e-32   
ref|XP_008776785.1|  PREDICTED: uncharacterized protein At1g04910...    131   7e-32   
gb|AFK46212.1|  unknown                                                 129   7e-32   
gb|EEC67779.1|  hypothetical protein OsI_35317                          131   7e-32   
ref|XP_006434582.1|  hypothetical protein CICLE_v10000533mg             130   7e-32   
ref|XP_009407491.1|  PREDICTED: uncharacterized protein At1g04910...    131   8e-32   
ref|XP_010922337.1|  PREDICTED: uncharacterized protein At1g04910...    131   8e-32   
ref|XP_010246040.1|  PREDICTED: uncharacterized protein At1g04910...    131   8e-32   
ref|XP_003618102.1|  Auxin-independent growth promoter                  125   8e-32   
ref|XP_009605341.1|  PREDICTED: uncharacterized protein At1g04910...    128   8e-32   
ref|XP_006390216.1|  hypothetical protein EUTSA_v10018355mg             124   8e-32   
ref|XP_004977274.1|  PREDICTED: uncharacterized protein At1g04910...    130   9e-32   
ref|XP_008368399.1|  PREDICTED: uncharacterized protein At1g04910...    130   9e-32   
ref|XP_002301007.2|  hypothetical protein POPTR_0002s08790g             131   1e-31   
ref|XP_004498294.1|  PREDICTED: uncharacterized protein At1g04910...    130   1e-31   
ref|XP_002893927.1|  hypothetical protein ARALYDRAFT_473732             131   1e-31   
emb|CDY15638.1|  BnaA07g08090D                                          131   1e-31   
ref|XP_002458744.1|  hypothetical protein SORBIDRAFT_03g039450          131   1e-31   
ref|XP_002893554.1|  hypothetical protein ARALYDRAFT_473137             131   1e-31   
ref|NP_001055751.1|  Os05g0459600                                       130   1e-31   
ref|XP_006304663.1|  hypothetical protein CARUB_v10011867mg             131   1e-31   
ref|XP_009102867.1|  PREDICTED: uncharacterized protein At1g04910       131   1e-31   
ref|XP_004498293.1|  PREDICTED: uncharacterized protein At1g04910...    130   1e-31   
ref|XP_010931259.1|  PREDICTED: uncharacterized protein At1g04910...    130   1e-31   
emb|CDX92640.1|  BnaC07g38980D                                        91.7    1e-31   
gb|EEC79353.1|  hypothetical protein OsI_20224                          130   1e-31   
ref|XP_010460701.1|  PREDICTED: uncharacterized protein At1g04910...    131   1e-31   
gb|KJB28879.1|  hypothetical protein B456_005G074200                    130   1e-31   
emb|CBI18521.3|  unnamed protein product                                130   1e-31   
ref|XP_010931258.1|  PREDICTED: uncharacterized protein At1g04910...    130   1e-31   
ref|XP_006473171.1|  PREDICTED: uncharacterized protein At1g04910...    130   2e-31   
ref|XP_008443407.1|  PREDICTED: uncharacterized protein At1g04910...    129   2e-31   
gb|KDO83867.1|  hypothetical protein CISIN_1g008308mg                   130   2e-31   
ref|NP_849755.1|  O-fucosyltransferase-like protein                     130   2e-31   
ref|XP_009352746.1|  PREDICTED: uncharacterized protein At1g04910...    129   2e-31   
ref|XP_011046291.1|  PREDICTED: uncharacterized protein At1g04910...    127   2e-31   
ref|XP_006434583.1|  hypothetical protein CICLE_v10000533mg             130   2e-31   
ref|XP_009352742.1|  PREDICTED: uncharacterized protein At1g04910...    129   2e-31   
ref|XP_009352745.1|  PREDICTED: uncharacterized protein At1g04910...    129   2e-31   
ref|XP_008368398.1|  PREDICTED: uncharacterized protein At1g04910...    130   2e-31   
ref|XP_006307011.1|  hypothetical protein CARUB_v10008597mg             130   2e-31   
ref|XP_011046290.1|  PREDICTED: uncharacterized protein At1g04910...    127   2e-31   
gb|KFK42045.1|  hypothetical protein AALP_AA2G204600                    122   2e-31   
gb|EMS47472.1|  hypothetical protein TRIUR3_14732                       129   2e-31   
emb|CDX99802.1|  BnaC05g22240D                                          130   2e-31   
ref|XP_008235937.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    130   2e-31   
gb|KJB28877.1|  hypothetical protein B456_005G074200                    130   2e-31   
dbj|BAD46055.1|  putative axi 1                                         127   2e-31   
ref|XP_010499443.1|  PREDICTED: uncharacterized protein At1g04910...    130   2e-31   
ref|XP_010100749.1|  hypothetical protein L484_005816                   130   2e-31   
ref|XP_007214626.1|  hypothetical protein PRUPE_ppa002927mg             130   2e-31   
ref|XP_007141089.1|  hypothetical protein PHAVU_008G166600g             130   2e-31   
ref|XP_009383238.1|  PREDICTED: uncharacterized protein At1g04910...    130   2e-31   
emb|CDX73250.1|  BnaC06g36980D                                          122   2e-31   
ref|XP_009383237.1|  PREDICTED: uncharacterized protein At1g04910...    130   2e-31   
ref|XP_002306226.1|  hypothetical protein POPTR_0004s19390g             127   2e-31   
ref|XP_006596302.1|  PREDICTED: uncharacterized protein At1g04910...    130   2e-31   
ref|XP_009145111.1|  PREDICTED: uncharacterized protein At1g04910       130   3e-31   
ref|XP_002272758.2|  PREDICTED: uncharacterized protein At1g04910       130   3e-31   
ref|XP_004299893.1|  PREDICTED: uncharacterized protein At1g04910       130   3e-31   
ref|XP_008349205.1|  PREDICTED: uncharacterized protein At1g04910...    128   3e-31   
emb|CDX73383.1|  BnaC05g27230D                                          130   3e-31   
ref|XP_008349206.1|  PREDICTED: uncharacterized protein At1g04910...    128   3e-31   
ref|XP_006434581.1|  hypothetical protein CICLE_v10000533mg             130   3e-31   
emb|CDX87622.1|  BnaA07g32510D                                          121   3e-31   
ref|XP_004499554.1|  PREDICTED: uncharacterized protein At1g04910...    129   3e-31   
ref|XP_009793733.1|  PREDICTED: uncharacterized protein At1g04910...    124   3e-31   
ref|XP_009344792.1|  PREDICTED: uncharacterized protein At1g04910...    130   3e-31   
ref|XP_002889072.1|  hypothetical protein ARALYDRAFT_476779             122   3e-31   
ref|XP_010680324.1|  PREDICTED: uncharacterized protein At1g04910...    130   3e-31   
ref|XP_002450409.1|  hypothetical protein SORBIDRAFT_05g004890          129   3e-31   
ref|XP_004499553.1|  PREDICTED: uncharacterized protein At1g04910...    129   3e-31   
ref|XP_002891187.1|  hypothetical protein ARALYDRAFT_473680             129   3e-31   
ref|XP_002312912.2|  hypothetical protein POPTR_0009s14510g             125   4e-31   
gb|KFK32890.1|  hypothetical protein AALP_AA6G300900                    130   4e-31   
ref|XP_009106283.1|  PREDICTED: uncharacterized protein At1g04910...    121   4e-31   
ref|XP_010680244.1|  PREDICTED: uncharacterized protein At1g04910...    130   4e-31   
ref|XP_009106284.1|  PREDICTED: uncharacterized protein At1g04910...    121   4e-31   
ref|XP_004299674.1|  PREDICTED: uncharacterized protein At1g04910...    129   4e-31   
ref|NP_683362.1|  O-fucosyltransferase-like protein                     129   4e-31   
ref|XP_007025345.1|  O-fucosyltransferase family protein isoform 1      130   4e-31   
ref|XP_006387761.1|  hypothetical protein POPTR_0603s002102g            127   4e-31   
ref|XP_011464606.1|  PREDICTED: uncharacterized protein At1g04910...    129   4e-31   
gb|EEE63981.1|  hypothetical protein OsJ_18808                          131   4e-31   
ref|XP_009149531.1|  PREDICTED: uncharacterized protein At1g04910       122   4e-31   
emb|CDY29524.1|  BnaA06g14460D                                          122   5e-31   
ref|XP_007142562.1|  hypothetical protein PHAVU_008G291300g             121   5e-31   
ref|XP_003598018.1|  DUF246 domain-containing protein                   129   5e-31   
ref|XP_010066619.1|  PREDICTED: uncharacterized protein At1g04910       129   5e-31   
ref|XP_011460620.1|  PREDICTED: uncharacterized protein At1g04910...    129   5e-31   
emb|CDY57756.1|  BnaCnng32400D                                          129   5e-31   
ref|XP_010666088.1|  PREDICTED: uncharacterized protein At1g04910...    126   5e-31   
ref|XP_006415594.1|  hypothetical protein EUTSA_v10007505mg             128   5e-31   
ref|XP_010471775.1|  PREDICTED: uncharacterized protein At1g04910       122   5e-31   
ref|XP_010478287.1|  PREDICTED: uncharacterized protein At1g04910...    129   6e-31   
gb|KCW64186.1|  hypothetical protein EUGRSUZ_G01835                     124   6e-31   
ref|XP_006358125.1|  PREDICTED: uncharacterized protein At1g04910...    128   6e-31   
gb|EYU17502.1|  hypothetical protein MIMGU_mgv1a003569mg                124   6e-31   
ref|XP_011045156.1|  PREDICTED: uncharacterized protein At1g04910...    125   6e-31   
ref|XP_010266129.1|  PREDICTED: uncharacterized protein At1g04910       124   6e-31   
ref|XP_011027600.1|  PREDICTED: uncharacterized protein At1g04910...    129   6e-31   
ref|XP_011027599.1|  PREDICTED: uncharacterized protein At1g04910...    129   6e-31   
gb|KHG28222.1|  hypothetical protein F383_11890                         128   6e-31   
ref|XP_008443399.1|  PREDICTED: uncharacterized protein At1g04910...    129   6e-31   
ref|XP_008443392.1|  PREDICTED: uncharacterized protein At1g04910...    129   7e-31   
ref|XP_010066322.1|  PREDICTED: uncharacterized protein At1g04910...    124   7e-31   
ref|XP_010645346.1|  PREDICTED: uncharacterized protein At1g04910...    129   7e-31   
gb|AAT64033.1|  putative growth regulator                               129   7e-31   
ref|XP_004150223.1|  PREDICTED: DUF246 domain-containing protein ...    129   7e-31   
ref|XP_010645345.1|  PREDICTED: uncharacterized protein At1g04910...    129   8e-31   
emb|CDY50845.1|  BnaC08g47910D                                          128   8e-31   
ref|XP_006581141.1|  PREDICTED: uncharacterized protein At1g04910...    122   8e-31   
gb|KJB15424.1|  hypothetical protein B456_002G178200                    128   8e-31   
ref|XP_004141562.1|  PREDICTED: DUF246 domain-containing protein ...    128   8e-31   
ref|XP_004161210.1|  PREDICTED: DUF246 domain-containing protein ...    129   8e-31   
ref|XP_011096470.1|  PREDICTED: uncharacterized protein At1g04910       129   8e-31   
ref|XP_006397450.1|  hypothetical protein EUTSA_v10001813mg             128   8e-31   
ref|XP_010461317.1|  PREDICTED: uncharacterized protein At1g04910...    128   9e-31   
ref|XP_010461373.1|  PREDICTED: uncharacterized protein At1g04910...    129   9e-31   
ref|XP_010461370.1|  PREDICTED: uncharacterized protein At1g04910...    129   9e-31   
emb|CDP00784.1|  unnamed protein product                                128   9e-31   
ref|XP_009388776.1|  PREDICTED: uncharacterized protein At1g04910...    128   9e-31   
ref|XP_009362464.1|  PREDICTED: uncharacterized protein At1g04910...    127   9e-31   
gb|AAK93632.1|  putative growth regulator protein                       128   9e-31   
ref|NP_564461.1|  O-fucosyltransferase-like protein                     128   9e-31   
ref|XP_008813632.1|  PREDICTED: uncharacterized protein At1g04910...    123   1e-30   
ref|XP_006448248.1|  hypothetical protein CICLE_v10014776mg             128   1e-30   
ref|XP_010461371.1|  PREDICTED: uncharacterized protein At1g04910...    128   1e-30   
ref|XP_006581140.1|  PREDICTED: uncharacterized protein At1g04910...    122   1e-30   
ref|XP_006469184.1|  PREDICTED: uncharacterized protein At1g04910...    128   1e-30   
ref|NP_565129.1|  O-fucosyltransferase-like protein                     121   1e-30   
ref|XP_008372992.1|  PREDICTED: uncharacterized protein At1g04910...    128   1e-30   
ref|XP_010500036.1|  PREDICTED: uncharacterized protein At1g04910...    128   1e-30   
ref|XP_003614789.1|  Growth regulator-related protein                   128   1e-30   
ref|XP_008444126.1|  PREDICTED: uncharacterized protein At1g04910...    128   1e-30   
gb|AAF16673.1|AC012394_22  putative auxin-independent growth prom...    121   1e-30   
ref|XP_007041650.1|  O-fucosyltransferase family protein                122   1e-30   
gb|AAF17638.1|AC009978_14  T23E18.20                                    121   1e-30   
ref|XP_010675873.1|  PREDICTED: uncharacterized protein At1g04910       127   1e-30   
ref|XP_008372993.1|  PREDICTED: uncharacterized protein At1g04910...    127   1e-30   
gb|KDO64642.1|  hypothetical protein CISIN_1g008637mg                   128   1e-30   
gb|KJB29676.1|  hypothetical protein B456_005G113300                    121   1e-30   
ref|XP_007148603.1|  hypothetical protein PHAVU_005G000400g             127   1e-30   
ref|XP_009341670.1|  PREDICTED: uncharacterized protein At1g04910...    128   1e-30   
ref|XP_009367298.1|  PREDICTED: uncharacterized protein At1g04910...    128   1e-30   
emb|CDY31477.1|  BnaC05g15860D                                          120   1e-30   
ref|XP_010691586.1|  PREDICTED: uncharacterized protein At1g04910...    127   1e-30   
gb|KHG09805.1|  hypothetical protein F383_15167                         128   1e-30   
ref|XP_010943931.1|  PREDICTED: uncharacterized protein At1g04910...    124   1e-30   
ref|XP_006579000.1|  PREDICTED: uncharacterized protein At1g04910...    127   1e-30   
ref|XP_006358124.1|  PREDICTED: uncharacterized protein At1g04910...    128   1e-30   
ref|XP_010103919.1|  hypothetical protein L484_000637                   126   1e-30   
emb|CAE01922.2|  OSJNBb0078D11.5                                        125   1e-30   
ref|XP_009373119.1|  PREDICTED: uncharacterized protein At1g04910...    127   1e-30   
gb|EEE61496.1|  hypothetical protein OsJ_15784                          124   1e-30   
emb|CBI32992.3|  unnamed protein product                                129   2e-30   
ref|XP_009786248.1|  PREDICTED: uncharacterized protein At1g04910...    119   2e-30   
gb|KHG09806.1|  hypothetical protein F383_15167                         127   2e-30   
ref|XP_007136010.1|  hypothetical protein PHAVU_009G010300g             121   2e-30   
ref|XP_009348039.1|  PREDICTED: uncharacterized protein At1g04910...    127   2e-30   
gb|EEC77803.1|  hypothetical protein OsI_16985                          124   2e-30   
ref|XP_011012509.1|  PREDICTED: uncharacterized protein At1g04910...    127   2e-30   
ref|XP_009366982.1|  PREDICTED: uncharacterized protein At1g04910...    127   2e-30   
gb|ACD56665.1|  putative growth regulator                               128   2e-30   
ref|XP_006396013.1|  hypothetical protein EUTSA_v10003892mg             128   2e-30   
ref|XP_006365316.1|  PREDICTED: uncharacterized protein At1g04910...    125   2e-30   
gb|AAT64018.1|  putative growth regulator                               128   2e-30   
ref|XP_010478945.1|  PREDICTED: uncharacterized protein At1g04910...    127   2e-30   
ref|XP_002316818.2|  hypothetical protein POPTR_0011s07160g             128   2e-30   
ref|XP_006830245.1|  hypothetical protein AMTR_s00130p00081820          127   2e-30   
gb|EPS69385.1|  hypothetical protein M569_05376                         127   2e-30   
ref|XP_006467631.1|  PREDICTED: uncharacterized protein At1g04910...    127   2e-30   
gb|KHG23960.1|  hypothetical protein F383_02013                         128   2e-30   
ref|XP_009123029.1|  PREDICTED: uncharacterized protein At1g04910...    127   2e-30   
gb|EEC68978.1|  hypothetical protein OsI_37727                          125   2e-30   
ref|XP_003545060.2|  PREDICTED: uncharacterized protein At1g04910...    123   2e-30   
gb|EYU27727.1|  hypothetical protein MIMGU_mgv1a002727mg                128   2e-30   
ref|XP_006578999.1|  PREDICTED: uncharacterized protein At1g04910...    127   2e-30   
gb|KHN46874.1|  DUF246 domain-containing protein                        123   2e-30   
emb|CDY53645.1|  BnaA08g30350D                                          127   2e-30   
ref|XP_009110564.1|  PREDICTED: uncharacterized protein At1g04910...    123   2e-30   
gb|KJB14306.1|  hypothetical protein B456_002G118200                    122   2e-30   
gb|EEE66244.1|  hypothetical protein OsJ_22422                          127   2e-30   
gb|KJB69705.1|  hypothetical protein B456_011G038500                    127   2e-30   
gb|KHN20121.1|  DUF246 domain-containing protein                        122   2e-30   
ref|XP_009362462.1|  PREDICTED: uncharacterized protein At1g04910...    127   2e-30   
ref|XP_008225312.1|  PREDICTED: uncharacterized protein At1g04910...    127   2e-30   
ref|XP_003556095.1|  PREDICTED: uncharacterized protein At1g04910...    127   2e-30   
ref|XP_006306299.1|  hypothetical protein CARUB_v10012165mg             127   2e-30   
ref|XP_004513833.1|  PREDICTED: uncharacterized protein At1g04910...    127   3e-30   
ref|XP_006416385.1|  hypothetical protein EUTSA_v10007203mg             119   3e-30   
ref|XP_011088688.1|  PREDICTED: uncharacterized protein At1g04910       124   3e-30   
ref|XP_010549414.1|  PREDICTED: uncharacterized protein At1g04910...    126   3e-30   
ref|XP_009351481.1|  PREDICTED: uncharacterized protein At1g04910...    127   3e-30   
gb|KJB50369.1|  hypothetical protein B456_008G166900                    127   3e-30   
gb|KJB14302.1|  hypothetical protein B456_002G118200                    122   3e-30   
gb|EEC81207.1|  hypothetical protein OsI_24239                          127   3e-30   
emb|CDY66921.1|  BnaAnng23210D                                          127   3e-30   
ref|XP_009114709.1|  PREDICTED: uncharacterized protein At1g04910       127   3e-30   
ref|XP_002307421.1|  hypothetical protein POPTR_0005s16060g             127   3e-30   
ref|XP_009602405.1|  PREDICTED: uncharacterized protein At1g04910...    119   3e-30   
ref|XP_008378761.1|  PREDICTED: uncharacterized protein At1g04910       126   3e-30   
gb|KDP32763.1|  hypothetical protein JCGZ_12055                         127   3e-30   



>gb|KDP29763.1| hypothetical protein JCGZ_18698 [Jatropha curcas]
Length=509

 Score =   281 bits (720),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 149/176 (85%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDE-----------------GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP+ + E                   +KFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  258  RLRYPSEEPEPFSTNSLRETTDKIDGNKARKFVVIHLRFDKDMAAHSACDFGGGKAEKLA  317

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYG
Sbjct  318  LAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYG  377

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR LFPLME+KKSLASSEER +IKGKASLLAAVDYYVG+HSDIFISASP
Sbjct  378  GEARISTLRTLFPLMEDKKSLASSEERAQIKGKASLLAAVDYYVGLHSDIFISASP  433


 Score =   109 bits (273),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY NLKTIRPNM LLGQLFLNKN++W +F  AV+EGH NR GEIRLRK
Sbjct  433  PGNMHNALVGHRTYKNLKTIRPNMALLGQLFLNKNISWSDFQQAVLEGHENRQGEIRLRK  492

Query  657  PR*SL  671
            P+ S+
Sbjct  493  PKKSI  497



>ref|XP_006353172.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=506

 Score =   275 bits (704),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 146/176 (83%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLR+P S+D                 +G  KF  +HLRFDKDMAAHSACDFGGGKAE L+
Sbjct  255  RLRFPPSEDNMVSNNYLREVTDLKPKQGGGKFAVLHLRFDKDMAAHSACDFGGGKAENLA  314

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG
Sbjct  315  LAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  374

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G  R+SALR LFPLME+KKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  375  GERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLAAVDYYVGMHSDIFVSASP  430


 Score =   114 bits (286),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEF ++VIEGH NR G+IRLRK
Sbjct  430  PGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVIEGHQNRQGQIRLRK  489

Query  657  PR*SL  671
            P+ SL
Sbjct  490  PKQSL  494



>ref|XP_006353173.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=505

 Score =   275 bits (703),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 146/176 (83%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLR+P S+D                 +G  KF  +HLRFDKDMAAHSACDFGGGKAE L+
Sbjct  254  RLRFPPSEDNMVSNNYLREVTDLKPKQGGGKFAVLHLRFDKDMAAHSACDFGGGKAENLA  313

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG
Sbjct  314  LAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  373

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G  R+SALR LFPLME+KKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  374  GERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLAAVDYYVGMHSDIFVSASP  429


 Score =   114 bits (285),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEF ++VIEGH NR G+IRLRK
Sbjct  429  PGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVIEGHQNRQGQIRLRK  488

Query  657  PR*SL  671
            P+ SL
Sbjct  489  PKQSL  493



>ref|XP_008347789.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Malus domestica]
Length=524

 Score =   284 bits (727),  Expect(2) = 6e-99, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 150/176 (85%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP++K                  +G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  273  RLRYPSTKSGXVGTNXLQEMPDVKEKQGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  332

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDNNTRLYLASHKVYG
Sbjct  333  LAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNNTRLYLASHKVYG  392

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARI+ LR+LFPLME+KKSLASSEER +IKGKASLLAAVDYYV MHSDIF+SASP
Sbjct  393  GEARIATLRKLFPLMEDKKSLASSEERAQIKGKASLLAAVDYYVSMHSDIFVSASP  448


 Score =   104 bits (259),  Expect(2) = 6e-99, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EF  +V++GH NR G+IR+RK
Sbjct  448  PGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKTLSWSEFQQSVVKGHENRQGQIRIRK  507

Query  657  PR*SL  671
            P+ S+
Sbjct  508  PKQSI  512



>ref|XP_008347790.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Malus domestica]
Length=513

 Score =   284 bits (727),  Expect(2) = 6e-99, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 150/176 (85%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP++K                  +G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  262  RLRYPSTKSGXVGTNXLQEMPDVKEKQGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  321

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDNNTRLYLASHKVYG
Sbjct  322  LAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNNTRLYLASHKVYG  381

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARI+ LR+LFPLME+KKSLASSEER +IKGKASLLAAVDYYV MHSDIF+SASP
Sbjct  382  GEARIATLRKLFPLMEDKKSLASSEERAQIKGKASLLAAVDYYVSMHSDIFVSASP  437


 Score =   104 bits (259),  Expect(2) = 6e-99, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EF  +V++GH NR G+IR+RK
Sbjct  437  PGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKTLSWSEFQQSVVKGHENRQGQIRIRK  496

Query  657  PR*SL  671
            P+ S+
Sbjct  497  PKQSI  501



>ref|XP_009783617.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=512

 Score =   276 bits (706),  Expect(2) = 7e-99, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 147/175 (84%), Gaps = 16/175 (9%)
 Frame = +2

Query  2    RLRYPASK----------------DEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSL  133
            RLR P+SK                 +G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+L
Sbjct  262  RLRDPSSKGNMVGRNYLREVSEKYKQGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLAL  321

Query  134  AKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGG  313
            AKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYGG
Sbjct  322  AKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYGG  381

Query  314  AARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
             ARIS LR LFPLME+KKSLASS+ER  IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  382  EARISTLRSLFPLMEDKKSLASSDERALIKGKASLLAAVDYYVSMHSDIFISASP  436


 Score =   112 bits (279),  Expect(2) = 7e-99, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVGHRTY+NLKTIRP M LLGQLFLNK L+WPEF +AV+EGH NR G+IRLRK
Sbjct  436  PGNMHNAMVGHRTYYNLKTIRPKMALLGQLFLNKTLSWPEFKEAVVEGHKNRKGQIRLRK  495

Query  657  PR*SL  671
            P  SL
Sbjct  496  PNQSL  500



>ref|XP_010312647.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Solanum 
lycopersicum]
Length=506

 Score =   276 bits (705),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 146/176 (83%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLR+P S+D                 +G  KF  +HLRFDKDMAAHSACDFGGGKAE L+
Sbjct  255  RLRFPPSEDNMVSNNYLREVTDLKPKQGVGKFAVLHLRFDKDMAAHSACDFGGGKAENLA  314

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG
Sbjct  315  LAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  374

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G  R+SALR LFPLME+KKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  375  GERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLAAVDYYVGMHSDIFVSASP  430


 Score =   112 bits (279),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEF ++VIEGH NR G+IRLRK
Sbjct  430  PGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVIEGHQNRQGQIRLRK  489

Query  657  PR*SL  671
            P+ SL
Sbjct  490  PKQSL  494



>gb|AAK84479.1| putative auxin growth promotor protein [Solanum lycopersicum]
Length=478

 Score =   276 bits (705),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 146/176 (83%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLR+P S+D                 +G  KF  +HLRFDKDMAAHSACDFGGGKAE L+
Sbjct  227  RLRFPPSEDNMVSNNYLREVTDLKPKQGVGKFAVLHLRFDKDMAAHSACDFGGGKAENLA  286

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG
Sbjct  287  LAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  346

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G  R+SALR LFPLME+KKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  347  GERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLAAVDYYVGMHSDIFVSASP  402


 Score =   112 bits (279),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEF ++VIEGH NR G+IRLRK
Sbjct  402  PGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVIEGHQNRQGQIRLRK  461

Query  657  PR*SL  671
            P+ SL
Sbjct  462  PKQSL  466



>ref|XP_010312649.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Solanum 
lycopersicum]
Length=470

 Score =   276 bits (705),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 146/176 (83%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLR+P S+D                 +G  KF  +HLRFDKDMAAHSACDFGGGKAE L+
Sbjct  219  RLRFPPSEDNMVSNNYLREVTDLKPKQGVGKFAVLHLRFDKDMAAHSACDFGGGKAENLA  278

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG
Sbjct  279  LAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  338

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G  R+SALR LFPLME+KKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  339  GERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLAAVDYYVGMHSDIFVSASP  394


 Score =   112 bits (279),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEF ++VIEGH NR G+IRLRK
Sbjct  394  PGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVIEGHQNRQGQIRLRK  453

Query  657  PR*SL  671
            P+ SL
Sbjct  454  PKQSL  458



>ref|XP_008385667.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Malus domestica]
Length=524

 Score =   284 bits (727),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 150/176 (85%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP+SK                  +G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  273  RLRYPSSKSGGASTNYLQEMPDVNDKQGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  332

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDNNTRLYLASHKVYG
Sbjct  333  LAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNNTRLYLASHKVYG  392

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARI+ LR++FPLME+KKSLASSEER +IKGKASLLAAVDYYV MHSDIF+SASP
Sbjct  393  GEARIATLRKVFPLMEDKKSLASSEERAQIKGKASLLAAVDYYVSMHSDIFVSASP  448


 Score =   103 bits (256),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EF  +V++GH NR G+IR+RK
Sbjct  448  PGNMHNALVGHRTYENLKTIRPSMPLLGQLFLNKTLSWSEFQQSVVKGHENRQGQIRIRK  507

Query  657  PR*SL  671
            P+ S+
Sbjct  508  PKQSI  512



>ref|XP_010312648.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Solanum 
lycopersicum]
Length=505

 Score =   275 bits (704),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 146/176 (83%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLR+P S+D                 +G  KF  +HLRFDKDMAAHSACDFGGGKAE L+
Sbjct  254  RLRFPPSEDNMVSNNYLREVTDLKPKQGVGKFAVLHLRFDKDMAAHSACDFGGGKAENLA  313

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG
Sbjct  314  LAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  373

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G  R+SALR LFPLME+KKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  374  GERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLAAVDYYVGMHSDIFVSASP  429


 Score =   112 bits (279),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEF ++VIEGH NR G+IRLRK
Sbjct  429  PGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVIEGHQNRQGQIRLRK  488

Query  657  PR*SL  671
            P+ SL
Sbjct  489  PKQSL  493



>ref|XP_007207425.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
 gb|EMJ08624.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
Length=474

 Score =   281 bits (718),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            +G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  249  QGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQ  308

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLASSEE
Sbjct  309  GRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASSEE  368

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R +IKGKASLLAA DYYV MHSDIFISASP
Sbjct  369  RAQIKGKASLLAAADYYVSMHSDIFISASP  398


 Score =   105 bits (263),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY NLKTIRP+M LLGQLFLNK+++W +F  +V+EGH NR G+IRLRK
Sbjct  398  PGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKSISWSDFQQSVVEGHQNRQGQIRLRK  457

Query  657  PR*SL  671
            P+ S+
Sbjct  458  PKQSI  462



>ref|XP_007207426.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
 gb|EMJ08625.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
Length=485

 Score =   281 bits (718),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            +G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  260  QGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQ  319

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLASSEE
Sbjct  320  GRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASSEE  379

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R +IKGKASLLAA DYYV MHSDIFISASP
Sbjct  380  RAQIKGKASLLAAADYYVSMHSDIFISASP  409


 Score =   105 bits (263),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY NLKTIRP+M LLGQLFLNK+++W +F  +V+EGH NR G+IRLRK
Sbjct  409  PGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKSISWSDFQQSVVEGHQNRQGQIRLRK  468

Query  657  PR*SL  671
            P+ S+
Sbjct  469  PKQSI  473



>ref|XP_011021848.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=506

 Score =   280 bits (715),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  285  KFVVIHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCP  344

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGFDN+TRLYLASHKVYGG ARIS LR+LFPLME+KKSLASSEER +I
Sbjct  345  LTPEEIGLLLAALGFDNSTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASSEERSQI  404

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            KGKASLLAAVDYYVG+HSDIF+SASP
Sbjct  405  KGKASLLAAVDYYVGLHSDIFVSASP  430


 Score =   106 bits (264),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY NLKTIRPNM LLGQLFLNK ++W +F  AV+EGH NR G+IRLRK
Sbjct  430  PGNMHNALVGHRTYKNLKTIRPNMALLGQLFLNKTISWTDFQQAVVEGHENRQGQIRLRK  489

Query  657  PR*SL  671
            P+ S+
Sbjct  490  PKQSI  494



>gb|KHG05570.1| hypothetical protein F383_31127 [Gossypium arboreum]
Length=518

 Score =   283 bits (724),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 146/176 (83%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP  + E                  PQKFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  267  RLRYPPGETEALSSDYLRVTTDQNDKQRPQKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  326

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYG
Sbjct  327  LAKYRQTIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYG  386

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR LFPLMENKKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  387  GEARISTLRELFPLMENKKSLASSEERARIKGKASLLAAVDYYVGMHSDIFVSASP  442


 Score =   102 bits (254),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ N+KTIRPNM LLGQLFL+KN+TW EF  AV EGH NR G+++LRK
Sbjct  442  PGNMHNALVGHRTFENMKTIRPNMALLGQLFLDKNITWLEFRQAVAEGHQNRQGQLKLRK  501

Query  657  PR*SL  671
            P+ S+
Sbjct  502  PKQSI  506



>emb|CDP01562.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   278 bits (712),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  26   DEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRS  205
            D+   KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRS
Sbjct  288  DQAAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRS  347

Query  206  QGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSE  385
            QGRCPLTPEE+GL+LAALGFDNNTRLYLASHKVYGG ARIS LR LFPLME+KKSLASSE
Sbjct  348  QGRCPLTPEEIGLVLAALGFDNNTRLYLASHKVYGGEARISTLRSLFPLMEDKKSLASSE  407

Query  386  ERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            ER +IKGKASLLAAVDYYV MHSDIF+SASP
Sbjct  408  ERVKIKGKASLLAAVDYYVSMHSDIFVSASP  438


 Score =   107 bits (266),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVGHRTY N+KTIRPNM LLG LFLNKNLTWPEF +A+IEGH NR G IRLRK
Sbjct  438  PGNMHNAMVGHRTYINMKTIRPNMALLGPLFLNKNLTWPEFQEAIIEGHKNRQGIIRLRK  497

Query  657  PR*SL  671
               SL
Sbjct  498  KEQSL  502



>gb|KDO60569.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=473

 Score =   280 bits (715),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 149/176 (85%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP+ K+ G                 P KFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  222  RLRYPSIKNRGLDDVHLEETAYTNKIQEPLKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  281

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFD +TRLYLASHKVYG
Sbjct  282  LAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDKSTRLYLASHKVYG  341

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARISALRRLFPLME+KKSLASSEER  +KGKASLLAA+DYYV MHS+IFISASP
Sbjct  342  GEARISALRRLFPLMEDKKSLASSEERAGVKGKASLLAALDYYVSMHSNIFISASP  397


 Score =   105 bits (263),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++GHRTY NLKTI+PNM LLGQLFLNK+L+W EF  AV+EGH NR G+IR+RK
Sbjct  397  PGNMHNALMGHRTYENLKTIKPNMALLGQLFLNKSLSWSEFQQAVVEGHENRQGQIRIRK  456

Query  657  PR*SL  671
            P+ S+
Sbjct  457  PKQSI  461



>ref|XP_007047791.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOX91948.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=518

 Score =   284 bits (727),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 147/176 (84%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP  + E                  PQKFV VHLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  267  RLRYPPGESEALSTNYLRETTGQNDKRRPQKFVVVHLRFDKDMAAHSACDFGGGKAEKLA  326

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ  WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYG
Sbjct  327  LAKYRQTIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYG  386

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR LFPLME+KKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  387  GEARISTLRELFPLMEDKKSLASSEERVHIKGKASLLAAVDYYVGMHSDIFVSASP  442


 Score =   101 bits (251),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++GHRT+ NLKTI+PNM LLGQLFLNK+++W EF  AV+EGH NR G+++LRK
Sbjct  442  PGNMHNALMGHRTFENLKTIKPNMALLGQLFLNKSISWSEFRQAVVEGHQNRQGQLKLRK  501

Query  657  PR*SL  671
            P+ S+
Sbjct  502  PKQSI  506



>ref|XP_009797993.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009797994.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
Length=504

 Score =   271 bits (694),  Expect(2) = 6e-98, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            +G  KF  +HLRFDKDMAAHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQ
Sbjct  279  QGAGKFAVLHLRFDKDMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQ  338

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEEVGLLLAALGFDN+TRLYLASHKVYGG  RISALR LFPLME+KKSLASSEE
Sbjct  339  GRCPLTPEEVGLLLAALGFDNSTRLYLASHKVYGGERRISALRNLFPLMEDKKSLASSEE  398

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  399  RALIKGKASLLAAVDYYVGMHSDIFVSASP  428


 Score =   113 bits (283),  Expect(2) = 6e-98, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEF ++V+EGH NR G+IRLRK
Sbjct  428  PGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVVEGHKNRQGQIRLRK  487

Query  657  PR*SL  671
            P+ SL
Sbjct  488  PKQSL  492



>ref|XP_006587571.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=516

 Score =   276 bits (707),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 144/154 (94%), Gaps = 2/154 (1%)
 Frame = +2

Query  17   ASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEE  196
            A K+ G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEE
Sbjct  289  ARKNAG--KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEE  346

Query  197  LRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLA  376
            LRSQGRCP+TPEEVGLLLAA+GFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLA
Sbjct  347  LRSQGRCPMTPEEVGLLLAAMGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLA  406

Query  377  SSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            SSEER +IKGKASLLAA+DYYVG+HSDIFISASP
Sbjct  407  SSEERSQIKGKASLLAALDYYVGLHSDIFISASP  440


 Score =   108 bits (269),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF DAV+EGH NR GE+RLRK
Sbjct  440  PGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQDAVVEGHQNRQGELRLRK  499

Query  657  PR*SL  671
            P+ S+
Sbjct  500  PKQSI  504



>ref|XP_002310868.1| hypothetical protein POPTR_0007s14280g [Populus trichocarpa]
 gb|ABK95421.1| unknown [Populus trichocarpa]
 gb|EEE91318.1| hypothetical protein POPTR_0007s14280g [Populus trichocarpa]
Length=506

 Score =   279 bits (713),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  285  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCP  344

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGFDN+TRLYLASHKVYGG ARIS LR+LFPLME+KKSLASSEER +I
Sbjct  345  LTPEEIGLLLAALGFDNSTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASSEERSQI  404

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            KGKASLLAAVDYYVG+HSDIF+SASP
Sbjct  405  KGKASLLAAVDYYVGLHSDIFVSASP  430


 Score =   106 bits (264),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY NLKTIRPNM LLGQLFLNK ++W +F  AV+EGH NR G+IRLRK
Sbjct  430  PGNMHNALVGHRTYKNLKTIRPNMALLGQLFLNKTISWTDFQQAVVEGHENRQGQIRLRK  489

Query  657  PR*SL  671
            P+ S+
Sbjct  490  PKQSI  494



>ref|XP_009797995.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana sylvestris]
Length=503

 Score =   271 bits (693),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            +G  KF  +HLRFDKDMAAHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQ
Sbjct  278  QGAGKFAVLHLRFDKDMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQ  337

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEEVGLLLAALGFDN+TRLYLASHKVYGG  RISALR LFPLME+KKSLASSEE
Sbjct  338  GRCPLTPEEVGLLLAALGFDNSTRLYLASHKVYGGERRISALRNLFPLMEDKKSLASSEE  397

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  398  RALIKGKASLLAAVDYYVGMHSDIFVSASP  427


 Score =   113 bits (283),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEF ++V+EGH NR G+IRLRK
Sbjct  427  PGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVVEGHKNRQGQIRLRK  486

Query  657  PR*SL  671
            P+ SL
Sbjct  487  PKQSL  491



>ref|XP_006426272.1| hypothetical protein CICLE_v10025329mg [Citrus clementina]
 gb|ESR39512.1| hypothetical protein CICLE_v10025329mg [Citrus clementina]
 gb|KDO60568.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=539

 Score =   280 bits (715),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 149/176 (85%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP+ K+ G                 P KFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  288  RLRYPSIKNRGLDDVHLEETAYTNKIQEPLKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  347

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFD +TRLYLASHKVYG
Sbjct  348  LAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDKSTRLYLASHKVYG  407

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARISALRRLFPLME+KKSLASSEER  +KGKASLLAA+DYYV MHS+IFISASP
Sbjct  408  GEARISALRRLFPLMEDKKSLASSEERAGVKGKASLLAALDYYVSMHSNIFISASP  463


 Score =   105 bits (262),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++GHRTY NLKTI+PNM LLGQLFLNK+L+W EF  AV+EGH NR G+IR+RK
Sbjct  463  PGNMHNALMGHRTYENLKTIKPNMALLGQLFLNKSLSWSEFQQAVVEGHENRQGQIRIRK  522

Query  657  PR*SL  671
            P+ S+
Sbjct  523  PKQSI  527



>ref|XP_006466306.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=539

 Score =   280 bits (715),  Expect(2) = 8e-98, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 149/176 (85%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP+ K+ G                 P KFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  288  RLRYPSIKNRGLDGVHLEETAYTNKIQEPLKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  347

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFD +TRLYLASHKVYG
Sbjct  348  LAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDKSTRLYLASHKVYG  407

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARISALRRLFPLME+KKSLASSEER  +KGKASLLAA+DYYV MHS+IFISASP
Sbjct  408  GEARISALRRLFPLMEDKKSLASSEERAGVKGKASLLAALDYYVSMHSNIFISASP  463


 Score =   105 bits (262),  Expect(2) = 8e-98, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++GHRTY NLKTI+PNM LLGQLFLNK+L+W EF  AV+EGH NR G+IR+RK
Sbjct  463  PGNMHNALMGHRTYENLKTIKPNMALLGQLFLNKSLSWSEFQQAVVEGHENRQGQIRIRK  522

Query  657  PR*SL  671
            P+ S+
Sbjct  523  PKQSI  527



>ref|XP_003534239.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 gb|KHN38876.1| DUF246 domain-containing protein [Glycine soja]
Length=515

 Score =   276 bits (707),  Expect(2) = 9e-98, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 144/154 (94%), Gaps = 2/154 (1%)
 Frame = +2

Query  17   ASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEE  196
            A K+ G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEE
Sbjct  288  ARKNAG--KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEE  345

Query  197  LRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLA  376
            LRSQGRCP+TPEEVGLLLAA+GFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLA
Sbjct  346  LRSQGRCPMTPEEVGLLLAAMGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLA  405

Query  377  SSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            SSEER +IKGKASLLAA+DYYVG+HSDIFISASP
Sbjct  406  SSEERSQIKGKASLLAALDYYVGLHSDIFISASP  439


 Score =   108 bits (269),  Expect(2) = 9e-98, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF DAV+EGH NR GE+RLRK
Sbjct  439  PGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQDAVVEGHQNRQGELRLRK  498

Query  657  PR*SL  671
            P+ S+
Sbjct  499  PKQSI  503



>gb|KJB44061.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=401

 Score =   280 bits (716),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 148/176 (84%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYP------ASKD-----------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP      +S D           + PQKFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  150  RLRYPPGQSQASSTDYLRETTDQNGKQNPQKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  209

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ  WQGRVLNSQFTD+ELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG
Sbjct  210  LAKYRQTIWQGRVLNSQFTDKELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  269

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR LFPLME+KKSLASS ER  IKGKASLLAAVDY+VGMHSDIF+SASP
Sbjct  270  GEARISTLRNLFPLMEDKKSLASSAERVHIKGKASLLAAVDYHVGMHSDIFVSASP  325


 Score =   104 bits (259),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ N+KTIRPNM LLGQLFLNKN++W +F  AV+EGH NR G++RLRK
Sbjct  325  PGNMHNALVGHRTFENMKTIRPNMVLLGQLFLNKNISWSQFRQAVVEGHQNRQGQLRLRK  384

Query  657  PR*SL  671
            P+ S+
Sbjct  385  PKQSI  389



>gb|KHG27420.1| hypothetical protein F383_15612 [Gossypium arboreum]
Length=498

 Score =   280 bits (717),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 149/176 (85%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYP------ASKD-----------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP      +S D           + PQKFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  247  RLRYPPGHSRASSTDYLRETTNQNGKQNPQKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  306

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ  WQGRV+NSQFTD+ELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG
Sbjct  307  LAKYRQTIWQGRVINSQFTDKELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  366

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR++FPLME+KKSLASS ER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  367  GEARISTLRKIFPLMEDKKSLASSAERVHIKGKASLLAAVDYYVGMHSDIFVSASP  422


 Score =   102 bits (254),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ N+KTIRPNM LLGQLFLNKN++W +F  A++EGH NR G++RLRK
Sbjct  422  PGNMHNALVGHRTFENMKTIRPNMVLLGQLFLNKNISWSQFRQAMVEGHQNRQGQLRLRK  481

Query  657  PR*SL  671
            P+ S+
Sbjct  482  PKQSI  486



>gb|KJB44059.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=518

 Score =   279 bits (713),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 148/176 (84%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYP------ASKD-----------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP      +S D           + PQKFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  267  RLRYPPGQSQASSTDYLRETTDQNGKQNPQKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  326

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ  WQGRVLNSQFTD+ELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG
Sbjct  327  LAKYRQTIWQGRVLNSQFTDKELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  386

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR LFPLME+KKSLASS ER  IKGKASLLAAVDY+VGMHSDIF+SASP
Sbjct  387  GEARISTLRNLFPLMEDKKSLASSAERVHIKGKASLLAAVDYHVGMHSDIFVSASP  442


 Score =   103 bits (258),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ N+KTIRPNM LLGQLFLNKN++W +F  AV+EGH NR G++RLRK
Sbjct  442  PGNMHNALVGHRTFENMKTIRPNMVLLGQLFLNKNISWSQFRQAVVEGHQNRQGQLRLRK  501

Query  657  PR*SL  671
            P+ S+
Sbjct  502  PKQSI  506



>ref|XP_008440542.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
Length=513

 Score =   276 bits (707),  Expect(2) = 7e-97, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 144/175 (82%), Gaps = 16/175 (9%)
 Frame = +2

Query  2    RLRYPASKDEG----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSL  133
            RLRYP +K E                 P KFV +HLRFDKDMAAHSACDFGGGKAEKL+L
Sbjct  263  RLRYPLNKKEPTEGNYLSMTTDANEQRPLKFVVLHLRFDKDMAAHSACDFGGGKAEKLAL  322

Query  134  AKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGG  313
            AKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLL+AALGFDNNTRLYLASHKVYGG
Sbjct  323  AKYRQVLWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLMAALGFDNNTRLYLASHKVYGG  382

Query  314  AARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
             ARIS LR LFPLME+KKSL S  E  +IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  383  EARISTLRSLFPLMEDKKSLTSGSELAQIKGKASLLAAVDYYVSMHSDIFISASP  437


 Score =   105 bits (261),  Expect(2) = 7e-97, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVGHRTY NLKTIRPNM LLGQLF+NK++ W +F  A +EGH NR G+IRLRK
Sbjct  437  PGNMHNAMVGHRTYENLKTIRPNMALLGQLFMNKSIIWSDFQQATVEGHKNRQGQIRLRK  496

Query  657  PR*SL  671
            P+ S+
Sbjct  497  PKQSI  501



>gb|KJB18178.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=401

 Score =   273 bits (697),  Expect(2) = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 145/176 (82%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP ++ +                  PQKFV VHLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  150  RLRYPPTESQPLITDDLTGTTDRNVKQMPQKFVVVHLRFDKDMAAHSACDFGGGKAEKLA  209

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYG
Sbjct  210  LAKYRQRIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYG  269

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR  FP ME+KKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  270  GEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLAAVDYYVGMHSDIFVSASP  325


 Score =   106 bits (265),  Expect(2) = 3e-96, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF  AV+EGH NR G++RLRK
Sbjct  325  PGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQAVVEGHQNRQGQLRLRK  384

Query  657  PR*SL  671
            P+ S+
Sbjct  385  PKQSI  389



>gb|EYU39303.1| hypothetical protein MIMGU_mgv1a004838mg [Erythranthe guttata]
Length=507

 Score =   276 bits (705),  Expect(2) = 3e-96, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = +2

Query  2    RLRYPASK--DEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLN  175
            RLRY  ++   +   KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLN
Sbjct  270  RLRYSPTQVNKKATGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLN  329

Query  176  SQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
            SQFTDEELRS+GRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYGG ARIS LR +FPLM
Sbjct  330  SQFTDEELRSRGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYGGEARISTLRSMFPLM  389

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            E+KKSLASSEER +I+GKASLLAA+DYYV MHSDIFISASP
Sbjct  390  EDKKSLASSEERAQIQGKASLLAALDYYVSMHSDIFISASP  430


 Score =   103 bits (258),  Expect(2) = 3e-96, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY N+KTIRPNM LLGQLFLNK+L W EF +AV++GH +R G++RLRK
Sbjct  430  PGNMHNAVVGHRTYENMKTIRPNMGLLGQLFLNKSLIWTEFEEAVMQGHKSRQGQLRLRK  489

Query  657  PR*SL  671
            PR S+
Sbjct  490  PRQSI  494



>ref|XP_004143441.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004160919.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN48703.1| hypothetical protein Csa_6G498990 [Cucumis sativus]
Length=513

 Score =   274 bits (701),  Expect(2) = 4e-96, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 144/175 (82%), Gaps = 16/175 (9%)
 Frame = +2

Query  2    RLRYPASKDEG----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSL  133
            RLRYP +K E                 P KFV +HLRFDKDMAAHSACDFGGGKAEKL+L
Sbjct  263  RLRYPLNKKESVGGNYLSLTTDANEQRPLKFVVLHLRFDKDMAAHSACDFGGGKAEKLAL  322

Query  134  AKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGG  313
            AKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLL+AALGFDNNTRLYLASHKVYGG
Sbjct  323  AKYRQVLWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLMAALGFDNNTRLYLASHKVYGG  382

Query  314  AARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
             ARIS LR LFPLME+KKSL S  E  +IKGKASLLAAVDYYV M+SDIFISASP
Sbjct  383  EARISTLRSLFPLMEDKKSLTSGSELAQIKGKASLLAAVDYYVSMYSDIFISASP  437


 Score =   104 bits (260),  Expect(2) = 4e-96, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVGHRTY NLKTIRPNM LLGQLF+NK++ W +F  A +EGH NR G+IRLRK
Sbjct  437  PGNMHNAMVGHRTYENLKTIRPNMALLGQLFMNKSIIWSDFHQATVEGHKNRQGQIRLRK  496

Query  657  PR*SL  671
            P+ S+
Sbjct  497  PKQSI  501



>gb|KJB18177.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=367

 Score =   272 bits (696),  Expect(2) = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 145/176 (82%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP ++ +                  PQKFV VHLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  116  RLRYPPTESQPLITDDLTGTTDRNVKQMPQKFVVVHLRFDKDMAAHSACDFGGGKAEKLA  175

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYG
Sbjct  176  LAKYRQRIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYG  235

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR  FP ME+KKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  236  GEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLAAVDYYVGMHSDIFVSASP  291


 Score =   106 bits (265),  Expect(2) = 5e-96, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF  AV+EGH NR G++RLRK
Sbjct  291  PGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQAVVEGHQNRQGQLRLRK  350

Query  657  PR*SL  671
            P+ S+
Sbjct  351  PKQSI  355



>gb|KJB18179.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18180.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18183.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18184.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=518

 Score =   272 bits (695),  Expect(2) = 6e-96, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 145/176 (82%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP ++ +                  PQKFV VHLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  267  RLRYPPTESQPLITDDLTGTTDRNVKQMPQKFVVVHLRFDKDMAAHSACDFGGGKAEKLA  326

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYG
Sbjct  327  LAKYRQRIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYG  386

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR  FP ME+KKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  387  GEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLAAVDYYVGMHSDIFVSASP  442


 Score =   106 bits (264),  Expect(2) = 6e-96, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF  AV+EGH NR G++RLRK
Sbjct  442  PGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQAVVEGHQNRQGQLRLRK  501

Query  657  PR*SL  671
            P+ S+
Sbjct  502  PKQSI  506



>gb|KJB18182.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=519

 Score =   272 bits (695),  Expect(2) = 7e-96, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 145/176 (82%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP ++ +                  PQKFV VHLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  268  RLRYPPTESQPLITDDLTGTTDRNVKQMPQKFVVVHLRFDKDMAAHSACDFGGGKAEKLA  327

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYG
Sbjct  328  LAKYRQRIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYG  387

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR  FP ME+KKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  388  GEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLAAVDYYVGMHSDIFVSASP  443


 Score =   106 bits (264),  Expect(2) = 7e-96, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF  AV+EGH NR G++RLRK
Sbjct  443  PGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQAVVEGHQNRQGQLRLRK  502

Query  657  PR*SL  671
            P+ S+
Sbjct  503  PKQSI  507



>ref|XP_009623753.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana tomentosiformis]
Length=504

 Score =   271 bits (694),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            +G  KF  +HLRFDKDMAAHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQ
Sbjct  279  QGAGKFAVLHLRFDKDMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQ  338

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEEVGLLLAALGFDN+TRLYLASHKVYGG  RISALR LFPLME+KKSLASSEE
Sbjct  339  GRCPLTPEEVGLLLAALGFDNSTRLYLASHKVYGGERRISALRNLFPLMEDKKSLASSEE  398

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  399  RALIKGKASLLAAVDYYVGMHSDIFVSASP  428


 Score =   106 bits (265),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVGHRTY+N+K IRPNM LLGQLFLNK L WPEF ++V+EGH NR G+IRLRK
Sbjct  428  PGNMHNAMVGHRTYNNMKIIRPNMALLGQLFLNKTLNWPEFQESVVEGHKNRQGQIRLRK  487

Query  657  PR*SL  671
             + SL
Sbjct  488  AKQSL  492



>ref|XP_009623754.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana tomentosiformis]
Length=503

 Score =   271 bits (693),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            +G  KF  +HLRFDKDMAAHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQ
Sbjct  278  QGAGKFAVLHLRFDKDMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQ  337

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEEVGLLLAALGFDN+TRLYLASHKVYGG  RISALR LFPLME+KKSLASSEE
Sbjct  338  GRCPLTPEEVGLLLAALGFDNSTRLYLASHKVYGGERRISALRNLFPLMEDKKSLASSEE  397

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  398  RALIKGKASLLAAVDYYVGMHSDIFVSASP  427


 Score =   106 bits (265),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVGHRTY+N+K IRPNM LLGQLFLNK L WPEF ++V+EGH NR G+IRLRK
Sbjct  427  PGNMHNAMVGHRTYNNMKIIRPNMALLGQLFLNKTLNWPEFQESVVEGHKNRQGQIRLRK  486

Query  657  PR*SL  671
             + SL
Sbjct  487  AKQSL  491



>ref|XP_004288516.2| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=529

 Score =   273 bits (699),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 146/176 (83%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP+ K                  +G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  278  RLRYPSGKSGPIGTNHLLELPNVKGKQGEGKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  337

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTD+ELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYG
Sbjct  338  LAKYRQVLWQGRVLNSQFTDKELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYG  397

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARI  LR LFPLME+KKSLASSEER  IKGKASLLAA+DYYV MHSDIF+SASP
Sbjct  398  GEARIENLRHLFPLMEDKKSLASSEERALIKGKASLLAALDYYVSMHSDIFVSASP  453


 Score =   104 bits (259),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY NLKTIRP+M LLGQLFLNK++TW +F  +V+EGH NR G+IR RK
Sbjct  453  PGNMHNALVGHRTYENLKTIRPSMGLLGQLFLNKSITWSDFQQSVVEGHENRQGQIRFRK  512

Query  657  PR*SL  671
            P+ S+
Sbjct  513  PKQSI  517



>ref|XP_010523310.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Tarenaya hassleriana]
Length=445

 Score =   272 bits (696),  Expect(2) = 7e-95, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            + P KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  220  QEPGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQ  279

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAALGFDNNTRLYLASHKVYGG AR+SALR++FP ME+K+SLASS E
Sbjct  280  GRCPLTPEEMGLLLAALGFDNNTRLYLASHKVYGGEARVSALRQVFPRMEDKRSLASSGE  339

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAAVDYYV MHSDIF+SASP
Sbjct  340  RARIKGKASLLAAVDYYVSMHSDIFVSASP  369


 Score =   102 bits (255),  Expect(2) = 7e-95, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ N+KTIRPNM L+GQ+FLNK+LTW EF   V EGH NR G+IRLRK
Sbjct  369  PGNMHNALVGHRTFENMKTIRPNMALIGQIFLNKSLTWIEFQQKVGEGHVNRQGQIRLRK  428

Query  657  PR*SL  671
            P+ SL
Sbjct  429  PKQSL  433



>ref|XP_009130514.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Brassica rapa]
Length=505

 Score =   272 bits (695),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +2

Query  14   PASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDE  193
            P S+ E P KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDE
Sbjct  276  PNSRHE-PGKFAVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDE  334

Query  194  ELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSL  373
            ELRSQGRCPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SL
Sbjct  335  ELRSQGRCPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSL  394

Query  374  ASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            ASSEER  IKGKASLLAA+DYYV MHSD+FISASP
Sbjct  395  ASSEERARIKGKASLLAALDYYVSMHSDVFISASP  429


 Score =   102 bits (254),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +F  A+ EGH NR G+IRLRK
Sbjct  429  PGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQAIGEGHVNRQGQIRLRK  488

Query  657  PR*SL  671
            P+ S+
Sbjct  489  PKQSI  493



>ref|XP_010523312.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=517

 Score =   272 bits (696),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            + P KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  292  QEPGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQ  351

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAALGFDNNTRLYLASHKVYGG AR+SALR++FP ME+K+SLASS E
Sbjct  352  GRCPLTPEEMGLLLAALGFDNNTRLYLASHKVYGGEARVSALRQVFPRMEDKRSLASSGE  411

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  412  RARIKGKASLLAAVDYYVSMHSDIFISASP  441


 Score =   102 bits (253),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ N+KTIRPNM L+GQ+FLNK+LTW EF   V EGH NR G+IRLRK
Sbjct  441  PGNMHNALVGHRTFENMKTIRPNMALIGQIFLNKSLTWIEFQQKVGEGHVNRQGQIRLRK  500

Query  657  PR*SL  671
            P+ SL
Sbjct  501  PKQSL  505



>ref|XP_009130513.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Brassica rapa]
Length=506

 Score =   272 bits (695),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +2

Query  14   PASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDE  193
            P S+ E P KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDE
Sbjct  277  PNSRHE-PGKFAVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDE  335

Query  194  ELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSL  373
            ELRSQGRCPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SL
Sbjct  336  ELRSQGRCPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSL  395

Query  374  ASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            ASSEER  IKGKASLLAA+DYYV MHSD+FISASP
Sbjct  396  ASSEERARIKGKASLLAALDYYVSMHSDVFISASP  430


 Score =   102 bits (254),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +F  A+ EGH NR G+IRLRK
Sbjct  430  PGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQAIGEGHVNRQGQIRLRK  489

Query  657  PR*SL  671
            P+ S+
Sbjct  490  PKQSI  494



>emb|CDY37829.1| BnaAnng04900D [Brassica napus]
Length=505

 Score =   272 bits (695),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +2

Query  14   PASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDE  193
            P S+ E P KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDE
Sbjct  276  PNSRHE-PGKFAVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDE  334

Query  194  ELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSL  373
            ELRSQGRCPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SL
Sbjct  335  ELRSQGRCPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSL  394

Query  374  ASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            ASSEER  IKGKASLLAA+DYYV MHSD+FISASP
Sbjct  395  ASSEERARIKGKASLLAALDYYVSMHSDVFISASP  429


 Score =   102 bits (254),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +F  A+ EGH NR G+IRLRK
Sbjct  429  PGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQAIGEGHVNRQGQIRLRK  488

Query  657  PR*SL  671
            P+ S+
Sbjct  489  PKQSI  493



>emb|CDY33958.1| BnaC02g43790D [Brassica napus]
Length=505

 Score =   272 bits (696),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +2

Query  14   PASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDE  193
            P S+ E P KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDE
Sbjct  276  PNSRHE-PGKFAVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDE  334

Query  194  ELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSL  373
            ELRSQGRCPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SL
Sbjct  335  ELRSQGRCPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSL  394

Query  374  ASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            ASSEER  IKGKASLLAA+DYYV MHSD+FISASP
Sbjct  395  ASSEERARIKGKASLLAALDYYVSMHSDVFISASP  429


 Score =   102 bits (253),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +F  A+ EGH NR G+IRLRK
Sbjct  429  PGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALGEGHVNRQGQIRLRK  488

Query  657  PR*SL  671
            P+ S+
Sbjct  489  PKQSI  493



>ref|XP_010547595.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=513

 Score =   274 bits (701),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = +2

Query  23   KDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELR  202
            K + P KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR
Sbjct  286  KRQEPGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELR  345

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
            SQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYGG AR+SALR++FP ME+K+SLASS
Sbjct  346  SQGRCPLTPEEMGLLLAALGFDNSTRLYLASHKVYGGEARVSALRQVFPRMEDKRSLASS  405

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            EER  IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  406  EERARIKGKASLLAAVDYYVSMHSDIFISASP  437


 Score = 99.8 bits (247),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ N+KT+RPNM L+ QLFL KN+TW EF  AV EGH NR G+IRLRK
Sbjct  437  PGNMHNALVGHRTFENMKTVRPNMALIEQLFLRKNITWMEFQQAVGEGHVNRQGQIRLRK  496

Query  657  PR*SL  671
            P+ SL
Sbjct  497  PKQSL  501



>ref|XP_010113429.1| hypothetical protein L484_026763 [Morus notabilis]
 gb|EXC35456.1| hypothetical protein L484_026763 [Morus notabilis]
Length=553

 Score =   272 bits (695),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ  WQGRVLNSQFTDEELR+QGRCP
Sbjct  332  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQTIWQGRVLNSQFTDEELRNQGRCP  391

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+G+LLAALGFDN+TRLYLASHKVYGG ARIS LR+LFP ME+KKSLASSEER +I
Sbjct  392  LTPEEIGILLAALGFDNSTRLYLASHKVYGGEARISTLRQLFPFMEDKKSLASSEERSQI  451

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
             GKASLLAAVDYYV MHSDIFISASP
Sbjct  452  TGKASLLAAVDYYVSMHSDIFISASP  477


 Score =   102 bits (254),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVGHRTY+NLKTIRPNM L+GQLFLNK+++W +F  +V+EGH +R G+IRLR 
Sbjct  477  PGNMHNAMVGHRTYNNLKTIRPNMALMGQLFLNKSISWSDFQQSVMEGHQSRQGQIRLRN  536

Query  657  PR*SL  671
            P+ S+
Sbjct  537  PKQSI  541



>ref|XP_010523308.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010523309.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Tarenaya hassleriana]
Length=517

 Score =   272 bits (695),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            + P KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  292  QEPGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQ  351

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAALGFDNNTRLYLASHKVYGG AR+SALR++FP ME+K+SLASS E
Sbjct  352  GRCPLTPEEMGLLLAALGFDNNTRLYLASHKVYGGEARVSALRQVFPRMEDKRSLASSGE  411

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAAVDYYV MHSDIF+SASP
Sbjct  412  RARIKGKASLLAAVDYYVSMHSDIFVSASP  441


 Score =   102 bits (253),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ N+KTIRPNM L+GQ+FLNK+LTW EF   V EGH NR G+IRLRK
Sbjct  441  PGNMHNALVGHRTFENMKTIRPNMALIGQIFLNKSLTWIEFQQKVGEGHVNRQGQIRLRK  500

Query  657  PR*SL  671
            P+ SL
Sbjct  501  PKQSL  505



>ref|XP_010519195.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=518

 Score =   269 bits (688),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 1/158 (1%)
 Frame = +2

Query  5    LRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQF  184
            +R   S+ E P KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQF
Sbjct  286  MRNSHSRQE-PGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQF  344

Query  185  TDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENK  364
            TDEELRSQGRCPLTPEE+GL+LAALGFDN+TRLYLASHKVYGG AR+S LR++FP ME+K
Sbjct  345  TDEELRSQGRCPLTPEEIGLVLAALGFDNSTRLYLASHKVYGGEARVSTLRQVFPRMEDK  404

Query  365  KSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            +SLASS +R  IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  405  RSLASSSDRARIKGKASLLAAVDYYVSMHSDIFISASP  442


 Score =   100 bits (250),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT+ N KTIRPNM L+GQLFLNKN+TW EF  AV EGH NR G+IRLRK
Sbjct  442  PGNMHNALVGHRTFENRKTIRPNMALIGQLFLNKNITWTEFQQAVGEGHVNRHGQIRLRK  501

Query  657  PR*SL  671
             + SL
Sbjct  502  TKQSL  506



>gb|AFK40388.1| unknown [Lotus japonicus]
Length=502

 Score =   268 bits (684),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 141/153 (92%), Gaps = 2/153 (1%)
 Frame = +2

Query  20   SKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL  199
            SK+ G  KFV +HLRFDKDMAAHSACDFGGGKAEK +LAKYRQ+ WQGR+LNSQFTDEEL
Sbjct  276  SKNAG--KFVVLHLRFDKDMAAHSACDFGGGKAEKFALAKYRQVIWQGRLLNSQFTDEEL  333

Query  200  RSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLAS  379
            RSQGRCP+TPEEVGLLLAALGFDN+ RLYLASHKVYGG ARIS LR+LFPLME+KKSLAS
Sbjct  334  RSQGRCPMTPEEVGLLLAALGFDNSARLYLASHKVYGGEARISTLRQLFPLMEDKKSLAS  393

Query  380  SEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            S ER +IKGKASLL A+DYYVG+HSDIFISASP
Sbjct  394  SYERFQIKGKASLLTALDYYVGLHSDIFISASP  426


 Score =   100 bits (250),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY NLKTIRPN+ L+GQLFLNK + W EF  AV+EGH NR G++RLRK
Sbjct  426  PGNMHNAVVGHRTYLNLKTIRPNLVLMGQLFLNKTMEWSEFEHAVVEGHQNRQGQLRLRK  485

Query  657  PR*SL  671
            P+ S+
Sbjct  486  PKQSI  490



>ref|XP_010254530.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=522

 Score =   270 bits (691),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  292  KFAVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCP  351

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGFDN+T LYLASHKVYGG ARIS+LR+LFPLME+KKSLAS EER +I
Sbjct  352  LTPEEIGLLLAALGFDNSTHLYLASHKVYGGEARISSLRKLFPLMEDKKSLASEEERVKI  411

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            +GKASLLAAVDYYV MHSDIFISASP
Sbjct  412  EGKASLLAAVDYYVSMHSDIFISASP  437


 Score = 97.4 bits (241),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHR Y NLKTIRPNM LLGQLFLNK++ W +F  AV+EGH +R G+IRL+K
Sbjct  437  PGNMHNALVGHRAYQNLKTIRPNMALLGQLFLNKSMGWSDFQRAVLEGHKDRQGQIRLKK  496

Query  657  PR*SL  671
             + S+
Sbjct  497  EKQSI  501



>gb|ABJ96379.1| expressed protein [Prunus persica]
Length=517

 Score =   271 bits (694),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 148/175 (85%), Gaps = 16/175 (9%)
 Frame = +2

Query  2    RLRYPASKDE----------------GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSL  133
            RLRYP ++++                G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+L
Sbjct  267  RLRYPPNRNQDAASDSQDGTNQIEKQGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLAL  326

Query  134  AKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGG  313
            AKYRQ+ WQGRVL SQFTDEELR+QGRCPLTPEE+GLLLAALGF+N+TRLYLASHKVYGG
Sbjct  327  AKYRQVIWQGRVLKSQFTDEELRNQGRCPLTPEEIGLLLAALGFNNSTRLYLASHKVYGG  386

Query  314  AARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
             ARIS LRRLFPLME+KKSLAS+EER +++GKASLLAAVDYYV M SDIFISASP
Sbjct  387  EARISTLRRLFPLMEDKKSLASAEERAKVEGKASLLAAVDYYVSMQSDIFISASP  441


 Score = 91.3 bits (225),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+V HR Y NLKTIRP+M LLG+LF+NK++ W EF  AV++GH +R G+IRLRK
Sbjct  441  PGNMHNALVSHRAYMNLKTIRPSMSLLGKLFVNKSMEWSEFQHAVLDGHKSRQGQIRLRK  500

Query  657  PR*SL  671
             + S+
Sbjct  501  EKQSI  505



>ref|XP_007222858.1| hypothetical protein PRUPE_ppa004255mg [Prunus persica]
 gb|EMJ24057.1| hypothetical protein PRUPE_ppa004255mg [Prunus persica]
Length=520

 Score =   271 bits (693),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 148/175 (85%), Gaps = 16/175 (9%)
 Frame = +2

Query  2    RLRYPASKDE----------------GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSL  133
            RLRYP ++++                G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+L
Sbjct  270  RLRYPPNRNQDAASDSQDGTNQIEKQGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLAL  329

Query  134  AKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGG  313
            AKYRQ+ WQGRVL SQFTDEELR+QGRCPLTPEE+GLLLAALGF+N+TRLYLASHKVYGG
Sbjct  330  AKYRQVIWQGRVLKSQFTDEELRNQGRCPLTPEEIGLLLAALGFNNSTRLYLASHKVYGG  389

Query  314  AARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
             ARIS LRRLFPLME+KKSLAS+EER +++GKASLLAAVDYYV M SDIFISASP
Sbjct  390  EARISTLRRLFPLMEDKKSLASAEERAKVEGKASLLAAVDYYVSMQSDIFISASP  444


 Score = 91.3 bits (225),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+V HR Y NLKTIRP+M LLG+LF+NK++ W EF  AV++GH +R G+IRLRK
Sbjct  444  PGNMHNALVSHRAYMNLKTIRPSMSLLGKLFVNKSMEWSEFQHAVLDGHKSRQGQIRLRK  503

Query  657  PR*SL  671
             + S+
Sbjct  504  EKQSI  508



>ref|XP_010937178.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=560

 Score =   268 bits (685),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 144/173 (83%), Gaps = 14/173 (8%)
 Frame = +2

Query  2    RLRYPASK--------------DEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAK  139
            RLRYP  K              D    KFV +HLRFDKDMAAHSACDFGGGKAE+L+LAK
Sbjct  312  RLRYPVGKHSDEYIQEVVDENVDAASGKFVVLHLRFDKDMAAHSACDFGGGKAERLALAK  371

Query  140  YRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAA  319
            YRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFD+ TRLYLASHKVYGG A
Sbjct  372  YRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDSRTRLYLASHKVYGGEA  431

Query  320  RISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            RIS+LR+LFPLME+KKSLAS EE  +++GKASLLAAVDYYV M SD+FISASP
Sbjct  432  RISSLRKLFPLMEDKKSLASEEELAKVEGKASLLAAVDYYVSMQSDVFISASP  484


 Score = 94.4 bits (233),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VG RTY NLKTIRPNM LLGQLFLNK++ W EF   V  GH NR G+IR RK
Sbjct  484  PGNMHNAVVGRRTYLNLKTIRPNMSLLGQLFLNKSMEWSEFQQVVQAGHKNRQGQIRPRK  543

Query  657  PR*SL  671
            P+ S+
Sbjct  544  PKQSI  548



>emb|CAN78778.1| hypothetical protein VITISV_029752 [Vitis vinifera]
Length=507

 Score =   266 bits (680),  Expect(2) = 7e-91, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            +G  KFV +HLRFDKDMAAHSACDFGGGKAEK++LAKYRQ+ WQGRVL SQFTDEELR+Q
Sbjct  282  QGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKMALAKYRQVIWQGRVLKSQFTDEELRNQ  341

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAALGF N TRLYLASHKVYGG ARIS LR+LFPLME+KKSLAS+EE
Sbjct  342  GRCPLTPEEIGLLLAALGFSNTTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASAEE  401

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
              +++GKASLLAAVDYYV MHSDIFISASP
Sbjct  402  LAKVEGKASLLAAVDYYVSMHSDIFISASP  431


 Score = 95.5 bits (236),  Expect(2) = 7e-91, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHR Y NLKTIRPNM LLGQLFLNK++ W EF  AV+ GH +R G+IR RK
Sbjct  431  PGNMHNALVGHRAYKNLKTIRPNMALLGQLFLNKSIEWSEFQQAVLNGHKSRQGQIRFRK  490



>ref|XP_010107675.1| hypothetical protein L484_007693 [Morus notabilis]
 gb|EXC16648.1| hypothetical protein L484_007693 [Morus notabilis]
Length=529

 Score =   264 bits (674),  Expect(2) = 8e-91, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 147/176 (84%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDE-----------------GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLR+P +K++                 G  K+V +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  278  RLRHPPTKNQVSGTEYLQEGNNEIKKQGDGKYVVLHLRFDKDMAAHSACDFGGGKAEKLA  337

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLLAALGF N TRLYLASHKVYG
Sbjct  338  LAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLAALGFSNRTRLYLASHKVYG  397

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS L +LFPLME+KKSL+S++ER +++GKASLLAAVDYYV MHSDIFISASP
Sbjct  398  GEARISTLCKLFPLMEDKKSLSSADERSKVEGKASLLAAVDYYVSMHSDIFISASP  453


 Score = 97.4 bits (241),  Expect(2) = 8e-91, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHR   N+KTIRPNM LLGQLFLNK + WPEF  AV++GH NR G+IRLRK
Sbjct  453  PGNMHNALVGHRALLNMKTIRPNMGLLGQLFLNKTMEWPEFQQAVVDGHKNRQGQIRLRK  512

Query  657  PR*SL  671
             + S+
Sbjct  513  EKQSI  517



>ref|XP_002283844.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Vitis 
vinifera]
 emb|CBI19265.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   266 bits (680),  Expect(2) = 8e-91, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            +G  KFV +HLRFDKDMAAHSACDFGGGKAEK++LAKYRQ+ WQGRVL SQFTDEELR+Q
Sbjct  290  QGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKMALAKYRQVIWQGRVLKSQFTDEELRNQ  349

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAALGF N TRLYLASHKVYGG ARIS LR+LFPLME+KKSLAS+EE
Sbjct  350  GRCPLTPEEIGLLLAALGFSNTTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASAEE  409

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
              +++GKASLLAAVDYYV MHSDIFISASP
Sbjct  410  LAKVEGKASLLAAVDYYVSMHSDIFISASP  439


 Score = 95.1 bits (235),  Expect(2) = 8e-91, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHR Y NLKTIRPNM LLGQLFLNK++ W EF  AV+ GH +R G+IR RK
Sbjct  439  PGNMHNALVGHRAYKNLKTIRPNMALLGQLFLNKSIEWSEFQQAVLNGHKSRQGQIRFRK  498



>ref|XP_008219267.1| PREDICTED: uncharacterized protein At1g04910-like [Prunus mume]
Length=520

 Score =   270 bits (689),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 147/175 (84%), Gaps = 16/175 (9%)
 Frame = +2

Query  2    RLRYPASKDEGPQ----------------KFVAVHLRFDKDMAAHSACDFGGGKAEKLSL  133
            RLRYP ++++G                  KFV +HLRFDKDMAAHSACDFGGGKAEKL+L
Sbjct  270  RLRYPPNRNQGAASDSQDGTNQIEKQGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLAL  329

Query  134  AKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGG  313
            AKYRQ+ WQGRVL SQFTDEELR+QGRCPLTPEE+GLLLAALGF+N+TRLYLASH VYGG
Sbjct  330  AKYRQVIWQGRVLKSQFTDEELRNQGRCPLTPEEIGLLLAALGFNNSTRLYLASHMVYGG  389

Query  314  AARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
             ARIS LRRLFPLME+KKSLAS+EER +++GKASLLAAVDYYV M SDIFISASP
Sbjct  390  EARISTLRRLFPLMEDKKSLASAEERAKVEGKASLLAAVDYYVSMQSDIFISASP  444


 Score = 91.7 bits (226),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+V HR Y NLKTIRP+M LLG+LF+NK++ W EF  AV++GH +R G+IRLRK
Sbjct  444  PGNMHNALVSHRAYMNLKTIRPSMSLLGKLFVNKSMEWSEFQHAVLDGHKSRQGQIRLRK  503

Query  657  PR*SL  671
             + S+
Sbjct  504  EKQSI  508



>ref|XP_010692399.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=503

 Score =   263 bits (672),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = +2

Query  2    RLRYPAS-KDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS  178
            RLRYP +   +  +K+V +HLRFDKDMAAHSACDFGGG+AEKL+LA+YRQ+ WQGRVL +
Sbjct  268  RLRYPNNFSGQSSEKYVVLHLRFDKDMAAHSACDFGGGRAEKLALARYRQVIWQGRVLKT  327

Query  179  QFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLME  358
            QFT+EELR+QGRCPLTPEE+GLLLAALGF NNTRLYLASHKVYGG ARIS LR+LFP +E
Sbjct  328  QFTNEELRNQGRCPLTPEEIGLLLAALGFSNNTRLYLASHKVYGGEARISTLRKLFPRIE  387

Query  359  NKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            +K+SLA+++ER +++GKASLLAAVDYYV MHSDIFISASP
Sbjct  388  DKRSLATADERKKVEGKASLLAAVDYYVSMHSDIFISASP  427


 Score = 97.4 bits (241),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAM+GHR Y NLKTIRPNM LLGQLFLN+++ WP F +AV+ GH NR G+IR+RK
Sbjct  427  PGNMHNAMLGHRAYQNLKTIRPNMALLGQLFLNQSIDWPGFQNAVVVGHKNRQGQIRVRK  486

Query  657  PR*SL  671
             + S+
Sbjct  487  EKQSI  491



>ref|XP_007047792.1| O-fucosyltransferase family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOX91949.1| O-fucosyltransferase family protein isoform 2, partial [Theobroma 
cacao]
Length=403

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 147/176 (84%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP  + E                  PQKFV VHLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  221  RLRYPPGESEALSTNYLRETTGQNDKRRPQKFVVVHLRFDKDMAAHSACDFGGGKAEKLA  280

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ  WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYG
Sbjct  281  LAKYRQTIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYG  340

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR LFPLME+KKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  341  GEARISTLRELFPLMEDKKSLASSEERVHIKGKASLLAAVDYYVGMHSDIFVSASP  396



>ref|XP_009401410.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009401411.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=518

 Score =   265 bits (676),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            EGP KF  +HLRFDKDMAAHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQFTDEELR Q
Sbjct  293  EGPGKFAVLHLRFDKDMAAHSACDFGGGRAERLALAKYRQVIWQGRVLNSQFTDEELRGQ  352

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAALGFD++TRLYLASHKVYGG ARIS+LR LFPLM++KKSLAS EE
Sbjct  353  GRCPLTPEEIGLLLAALGFDSSTRLYLASHKVYGGEARISSLRMLFPLMDDKKSLASEEE  412

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
              +++GKASLLAAVDY+V MHSDIFISASP
Sbjct  413  LAKVEGKASLLAAVDYHVSMHSDIFISASP  442


 Score = 95.5 bits (236),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++G+RTY NLKTIRPNM LLGQLFLNK + W EF  AV  GH  R G+IRLRK
Sbjct  442  PGNMHNAVLGYRTYENLKTIRPNMGLLGQLFLNKTMDWSEFQRAVQAGHKARQGQIRLRK  501

Query  657  PR*SL  671
            P+ S+
Sbjct  502  PKQSI  506



>ref|XP_006852943.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda]
 gb|ERN14410.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda]
Length=446

 Score =   266 bits (679),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 143/171 (84%), Gaps = 12/171 (7%)
 Frame = +2

Query  2    RLRYP------------ASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYR  145
            RLRYP            A  +    KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYR
Sbjct  199  RLRYPLGDGGLLREKVDAEINPISGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYR  258

Query  146  QIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARI  325
            Q+ WQGRVLNSQFTDEELR+QGRCPLTPEE+GLLLAALGFDNNTRLYLASHKVYGG ARI
Sbjct  259  QVIWQGRVLNSQFTDEELRNQGRCPLTPEEIGLLLAALGFDNNTRLYLASHKVYGGEARI  318

Query  326  SALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            S LR LFPLME+KKSLAS EE   ++GKAS+LAA+DYYV +HSD+FISASP
Sbjct  319  STLRELFPLMEDKKSLASKEELAMVEGKASMLAALDYYVSLHSDVFISASP  369


 Score = 93.2 bits (230),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNAMVGHRTY NLKTIRPNM LLGQL+LNK++ W +F  AV +GH  R G++RLRK
Sbjct  369  PGNMHNAMVGHRTYLNLKTIRPNMGLLGQLYLNKSMGWSDFQAAVRKGHEQRQGKMRLRK  428

Query  657  PR*SL  671
             + S+
Sbjct  429  AKQSI  433



>ref|XP_009350347.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=513

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 150/176 (85%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP++K                  +G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  262  RLRYPSTKSGGVGTNYLQEMPDVKEKQGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  321

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDNNTRLYLASHKVYG
Sbjct  322  LAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNNTRLYLASHKVYG  381

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARI+ LR+LFPLME+KKSLASSEER +IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  382  GEARIATLRKLFPLMEDKKSLASSEERAQIKGKASLLAAVDYYVSMHSDIFISASP  437


 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLH-HPANMHNAMVGHRTYHNLKTIRPN  545
            AS  +R ++K K  L   L  +   V      F+   P NMHNA+VGHRTY NLKTIRP+
Sbjct  403  ASSEERAQIKGKASL---LAAVDYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPS  459

Query  546  MQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            M LLGQLFLNK L+W EF  +V++GH +R G+IR+RKP+ S+
Sbjct  460  MSLLGQLFLNKTLSWSEFQQSVVKGHESRQGQIRIRKPKKSI  501



>ref|XP_009364252.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Pyrus 
x bretschneideri]
Length=513

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 150/176 (85%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP+SK                  +G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  262  RLRYPSSKSGGASSNYLQEMPNVNDKQGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  321

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDNNTRLYLASHKVYG
Sbjct  322  LAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNNTRLYLASHKVYG  381

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARI+ LR++FPLME+KKSLASSEER +IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  382  GEARIATLRKVFPLMEDKKSLASSEERAQIKGKASLLAAVDYYVSMHSDIFISASP  437


 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLH-HPANMHNAMVGHRTYHNLKTIRPN  545
            AS  +R ++K K  L   L  +   V      F+   P NMHNA+VGHRTY NLKTIRP+
Sbjct  403  ASSEERAQIKGKASL---LAAVDYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPS  459

Query  546  MQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            M LLGQLFLNK L+W EF  +V++GH NR G+IR+RKP+ S+
Sbjct  460  MPLLGQLFLNKTLSWSEFQQSVVKGHENRQGQIRIRKPKQSI  501



>ref|XP_009350346.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=524

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 150/176 (85%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP++K                  +G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  273  RLRYPSTKSGGVGTNYLQEMPDVKEKQGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  332

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDNNTRLYLASHKVYG
Sbjct  333  LAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNNTRLYLASHKVYG  392

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARI+ LR+LFPLME+KKSLASSEER +IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  393  GEARIATLRKLFPLMEDKKSLASSEERAQIKGKASLLAAVDYYVSMHSDIFISASP  448


 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLH-HPANMHNAMVGHRTYHNLKTIRPN  545
            AS  +R ++K K  L   L  +   V      F+   P NMHNA+VGHRTY NLKTIRP+
Sbjct  414  ASSEERAQIKGKASL---LAAVDYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPS  470

Query  546  MQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            M LLGQLFLNK L+W EF  +V++GH +R G+IR+RKP+ S+
Sbjct  471  MSLLGQLFLNKTLSWSEFQQSVVKGHESRQGQIRIRKPKKSI  512



>ref|XP_009364251.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Pyrus 
x bretschneideri]
Length=524

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 150/176 (85%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP+SK                  +G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  273  RLRYPSSKSGGASSNYLQEMPNVNDKQGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  332

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDNNTRLYLASHKVYG
Sbjct  333  LAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNNTRLYLASHKVYG  392

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARI+ LR++FPLME+KKSLASSEER +IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  393  GEARIATLRKVFPLMEDKKSLASSEERAQIKGKASLLAAVDYYVSMHSDIFISASP  448


 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLH-HPANMHNAMVGHRTYHNLKTIRPN  545
            AS  +R ++K K  L   L  +   V      F+   P NMHNA+VGHRTY NLKTIRP+
Sbjct  414  ASSEERAQIKGKASL---LAAVDYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPS  470

Query  546  MQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            M LLGQLFLNK L+W EF  +V++GH NR G+IR+RKP+ S+
Sbjct  471  MPLLGQLFLNKTLSWSEFQQSVVKGHENRQGQIRIRKPKQSI  512



>ref|XP_010939815.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=558

 Score =   263 bits (672),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAE+L+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  337  KFVVLHLRFDKDMAAHSACDFGGGKAERLALAKYRQVIWQGRVLNSQFTDEELRSQGRCP  396

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGFD+ TRLYLASHKVYGG ARI++LR+LFPLME+KKSLAS EE  ++
Sbjct  397  LTPEEIGLLLAALGFDSKTRLYLASHKVYGGEARIASLRKLFPLMEDKKSLASEEELAKV  456

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            +GKASLLAAVDYYV M SD+FISASP
Sbjct  457  EGKASLLAAVDYYVSMRSDVFISASP  482


 Score = 94.4 bits (233),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VG RTY NLKTIRPNM LLGQLFLNK++ W EF   +  GH NR G+IR RK
Sbjct  482  PGNMHNAVVGRRTYLNLKTIRPNMALLGQLFLNKSMEWSEFQQVIQSGHKNRQGQIRQRK  541

Query  657  PR*SL  671
            P+ S+
Sbjct  542  PKQSI  546



>ref|XP_006338062.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=516

 Score =   263 bits (673),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQG  211
            G  K+V +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR QG
Sbjct  292  GAGKYVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRGQG  351

Query  212  RCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEER  391
            RCPLTPEE+GLLL+ALGF+N+TRLYLASHKVYGG ARIS+LR+LFP ME+KKSLASS E 
Sbjct  352  RCPLTPEEIGLLLSALGFNNSTRLYLASHKVYGGEARISSLRQLFPFMEDKKSLASSHEL  411

Query  392  GEIKGKASLLAAVDYYVGMHSDIFISASP  478
             E++GKASLLAAVDYYV M SDIFISASP
Sbjct  412  SEVEGKASLLAAVDYYVSMQSDIFISASP  440


 Score = 93.6 bits (231),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++GHR Y NLKTIRPNM LLG+LFLNK + W EF  AV +GH NR G++R+RK
Sbjct  440  PGNMHNALLGHRAYKNLKTIRPNMTLLGKLFLNKTMQWSEFQQAVQQGHKNRQGQMRIRK  499

Query  657  PR*SL  671
             + S+
Sbjct  500  EKQSI  504



>gb|EPS73888.1| hypothetical protein M569_00867, partial [Genlisea aurea]
Length=498

 Score =   266 bits (680),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  17   ASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEE  196
            A  + G   FV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEE
Sbjct  270  AEYERGIGNFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVVWQGRVLNSQFTDEE  329

Query  197  LRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLA  376
            LRSQGRCPLTPEE+GLLLAALGFDN TRLYLASHKVYGG ARISALR LFPLME+KKSL+
Sbjct  330  LRSQGRCPLTPEEIGLLLAALGFDNTTRLYLASHKVYGGEARISALRSLFPLMEDKKSLS  389

Query  377  SSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            S+EER  I GKASL+AAVDY+VG+ SDIF+SASP
Sbjct  390  SAEERRRINGKASLMAAVDYHVGLRSDIFVSASP  423


 Score = 90.5 bits (223),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 52/66 (79%), Gaps = 1/66 (2%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFL-NKNLTWPEFXDAVIEGHANRPGEIRLR  653
            P NMHN MVGHR+Y N KTIRPNM LLGQLFL  KNL+W EF + VI+GH +R G ++LR
Sbjct  423  PGNMHNLMVGHRSYENKKTIRPNMALLGQLFLTTKNLSWTEFENGVIDGHKDRRGILKLR  482

Query  654  KPR*SL  671
            +P+ S+
Sbjct  483  RPKQSI  488



>ref|XP_004237994.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=516

 Score =   264 bits (674),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQG  211
            G  K+V +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR QG
Sbjct  292  GAGKYVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRGQG  351

Query  212  RCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEER  391
            RCPLTPEE+GLLL+ALGF+N+TRLYLASHKVYGG ARISALR+LFP ME+KKSLASS E 
Sbjct  352  RCPLTPEEIGLLLSALGFNNSTRLYLASHKVYGGEARISALRQLFPFMEDKKSLASSHEL  411

Query  392  GEIKGKASLLAAVDYYVGMHSDIFISASP  478
             E++GKASLLAAVDYYV M SDIFISASP
Sbjct  412  SEVEGKASLLAAVDYYVSMQSDIFISASP  440


 Score = 92.4 bits (228),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++GHR Y NLKT+RPNM LLG+LFLNK + W EF  AV +GH NR G++R+RK
Sbjct  440  PGNMHNALLGHRAYKNLKTVRPNMTLLGKLFLNKTIEWSEFQQAVQQGHKNRQGQMRIRK  499

Query  657  PR*SL  671
             + S+
Sbjct  500  EKQSI  504



>ref|XP_010523344.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
 ref|XP_010523345.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=519

 Score =   263 bits (671),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 145/176 (82%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPAS--KDEG--PQK-------------FVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLR+PAS  K  G  PQK             F  +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  266  RLRHPASISKTSGTQPQKDRVDIIAKARAETFAVLHLRFDKDMAAHSACDFGGGKAEKLA  325

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELR +GRCPLTPEEVGLLLAALGF+NNTRLYLASH+VYG
Sbjct  326  LAKYRQVIWQGRVLNSQFTDEELRGKGRCPLTPEEVGLLLAALGFNNNTRLYLASHQVYG  385

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G  RISALR+LFP MENKKSLAS EE  +++GKASLLAAVDYYV M SDIFISASP
Sbjct  386  GEQRISALRKLFPEMENKKSLASMEELADVEGKASLLAAVDYYVSMKSDIFISASP  441


 Score = 93.6 bits (231),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HR Y NLKTIRPNM LLGQLFLNK++ WPEF  AV+  H NR G+IR+RK
Sbjct  441  PGNMHNALLAHRAYLNLKTIRPNMVLLGQLFLNKSIGWPEFERAVVNSHKNRQGQIRIRK  500

Query  657  PR*SL  671
             + S+
Sbjct  501  EKQSI  505



>ref|XP_007018221.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY15446.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=540

 Score =   265 bits (677),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ  181
            R R   ++ EG  K+V +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQ
Sbjct  306  RGRIDDTEKEGAGKYVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQ  365

Query  182  FTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMEN  361
            FTD+ELR+QGRCPLTPEE+GLLLAALGF+N+TRLYLASHKVYGG ARIS LR+LFPLME+
Sbjct  366  FTDKELRNQGRCPLTPEEIGLLLAALGFNNSTRLYLASHKVYGGEARISTLRKLFPLMED  425

Query  362  KKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            KKSLAS +E  EI+GKASLLAAVDYYV + SDIFISASP
Sbjct  426  KKSLASVKELAEIEGKASLLAAVDYYVSLQSDIFISASP  464


 Score = 90.9 bits (224),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHR Y NLKTIRPNM LLG LFLNK++ W EF  AVI  H NR G+IRLRK
Sbjct  464  PGNMHNALVGHRAYLNLKTIRPNMLLLGPLFLNKSMEWSEFQHAVINRHKNRQGQIRLRK  523

Query  657  PR*SL  671
               S+
Sbjct  524  EEQSI  528



>gb|KCW68511.1| hypothetical protein EUGRSUZ_F02148 [Eucalyptus grandis]
Length=491

 Score =   263 bits (671),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +2

Query  23   KDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELR  202
            +++G  KFV +HLRFDKDMAAHSACDFGGGKAE+++LAKYRQ+ WQGRV+NSQFT+EELR
Sbjct  264  RNQGSGKFVVLHLRFDKDMAAHSACDFGGGKAERMALAKYRQVIWQGRVVNSQFTNEELR  323

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
             QGRCPLTPE++GLLLAALGF N+TRLYLASHKVYGG +RIS LR+LFPLME+KKSL S+
Sbjct  324  GQGRCPLTPEQIGLLLAALGFSNSTRLYLASHKVYGGESRISTLRKLFPLMEDKKSLTSA  383

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            EER ++KGKASLLAAVDYYV M SD+FISASP
Sbjct  384  EERAKVKGKASLLAAVDYYVSMQSDVFISASP  415


 Score = 93.2 bits (230),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++GHR + NLKTIRPNM LLGQLFLNK++ W +F  AVIEGH  R G IRLRK
Sbjct  415  PGNMHNAVLGHRAFLNLKTIRPNMALLGQLFLNKSMEWSDFQHAVIEGHIKRQGHIRLRK  474

Query  657  PR*SL  671
             + S+
Sbjct  475  EKQSI  479



>ref|XP_010061545.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Eucalyptus grandis]
Length=517

 Score =   263 bits (671),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +2

Query  23   KDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELR  202
            +++G  KFV +HLRFDKDMAAHSACDFGGGKAE+++LAKYRQ+ WQGRV+NSQFT+EELR
Sbjct  290  RNQGSGKFVVLHLRFDKDMAAHSACDFGGGKAERMALAKYRQVIWQGRVVNSQFTNEELR  349

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
             QGRCPLTPE++GLLLAALGF N+TRLYLASHKVYGG +RIS LR+LFPLME+KKSL S+
Sbjct  350  GQGRCPLTPEQIGLLLAALGFSNSTRLYLASHKVYGGESRISTLRKLFPLMEDKKSLTSA  409

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            EER ++KGKASLLAAVDYYV M SD+FISASP
Sbjct  410  EERAKVKGKASLLAAVDYYVSMQSDVFISASP  441


 Score = 93.2 bits (230),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++GHR + NLKTIRPNM LLGQLFLNK++ W +F  AVIEGH  R G IRLRK
Sbjct  441  PGNMHNAVLGHRAFLNLKTIRPNMALLGQLFLNKSMEWSDFQHAVIEGHIKRQGHIRLRK  500

Query  657  PR*SL  671
             + S+
Sbjct  501  EKQSI  505



>ref|XP_009624657.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=516

 Score =   263 bits (671),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQG  211
            G  K+V +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR QG
Sbjct  292  GAGKYVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRGQG  351

Query  212  RCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEER  391
            RCPLTPEE+GLLL ALGF+N+TRLYLASHKVYGG ARISALR+LFP ME+KKSLASS E 
Sbjct  352  RCPLTPEEIGLLLTALGFNNSTRLYLASHKVYGGEARISALRQLFPFMEDKKSLASSHEL  411

Query  392  GEIKGKASLLAAVDYYVGMHSDIFISASP  478
             E++GKASLLAA+DYYV M SDIFISASP
Sbjct  412  SEVEGKASLLAALDYYVSMQSDIFISASP  440


 Score = 92.4 bits (228),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++GHR Y NLKTIRPNM LLG+LFLNK + W EF  A+ +GH NR G++RLRK
Sbjct  440  PGNMHNALLGHRAYKNLKTIRPNMTLLGKLFLNKTMEWSEFQRAIQQGHKNRQGQMRLRK  499

Query  657  PR*SL  671
             + S+
Sbjct  500  EKQSI  504



>gb|KDP41479.1| hypothetical protein JCGZ_15886 [Jatropha curcas]
Length=513

 Score =   266 bits (681),  Expect(2) = 9e-89, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ  181
            R R   +++ G +KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQ
Sbjct  279  RERIDDTENLGSRKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQ  338

Query  182  FTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMEN  361
            FTDEELRSQGRCPLTPEE+GLLLAALGF N+TRLYLASHKVYGG ARIS L++LFP ME+
Sbjct  339  FTDEELRSQGRCPLTPEEIGLLLAALGFSNSTRLYLASHKVYGGEARISTLKQLFPFMED  398

Query  362  KKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            KKSLAS EE  E++GKASLLAAVDYYV + SDIFISASP
Sbjct  399  KKSLASEEELAEVEGKASLLAAVDYYVSLQSDIFISASP  437


 Score = 88.2 bits (217),  Expect(2) = 9e-89, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++GHR Y NLKTIRPNM LLG LFLNK+L W  F  AV+ GH NR G++R RK
Sbjct  437  PGNMHNALLGHRAYLNLKTIRPNMLLLGPLFLNKSLEWSAFQVAVVNGHKNRQGQVRSRK  496

Query  657  PR*SL  671
             + S+
Sbjct  497  EKQSI  501



>ref|XP_004301363.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=513

 Score =   262 bits (670),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            +G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVL SQFTDEELR Q
Sbjct  288  QGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLKSQFTDEELRIQ  347

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAALGF+N+TRLYLASHKVYGG ARIS LRRLFPLME+KKSL S++E
Sbjct  348  GRCPLTPEEIGLLLAALGFNNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLTSAKE  407

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R +++GKASL AAVDYYV M SDIFISASP
Sbjct  408  RAKVEGKASLSAAVDYYVSMQSDIFISASP  437


 Score = 91.7 bits (226),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+V HR Y NLKTIRP+M LL +LFLNK++ W EF  AV++GH NR G+IRLRK
Sbjct  437  PGNMHNALVCHRAYMNLKTIRPSMTLLSKLFLNKSMQWSEFQQAVLDGHKNRQGQIRLRK  496

Query  657  PR*SL  671
             + S+
Sbjct  497  EKQSI  501



>emb|CDP11502.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   258 bits (660),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            K+V +HLRFDKDMAAHSACDFGGGKAEKL+L KYRQ+ WQGRVLNSQFTDEELR QGRCP
Sbjct  294  KYVVLHLRFDKDMAAHSACDFGGGKAEKLALGKYRQVLWQGRVLNSQFTDEELRIQGRCP  353

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGF+N+T LYLASHKVYGG ARIS L++LFP ME+KKSL+S+EER ++
Sbjct  354  LTPEEIGLLLAALGFNNSTTLYLASHKVYGGEARISTLKKLFPYMEDKKSLSSAEERAKV  413

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
             GK+SLLAAVDYYVGM SDIF+SASP
Sbjct  414  DGKSSLLAAVDYYVGMQSDIFVSASP  439


 Score = 95.5 bits (236),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY+NLKTIRPNM LLG+LFLNK L W +F  AV  GH NR G++RLRK
Sbjct  439  PGNMHNALVGHRTYNNLKTIRPNMVLLGKLFLNKTLEWSDFQQAVKNGHKNRQGQLRLRK  498

Query  657  PR*SL  671
             + S+
Sbjct  499  EKQSI  503



>ref|XP_008236140.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Prunus 
mume]
Length=518

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            +G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  293  QGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQ  352

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLASSEE
Sbjct  353  GRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASSEE  412

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R +IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  413  RAQIKGKASLLAAVDYYVSMHSDIFISASP  442


 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLH-HPANMHNAMVGHRTYHNLKTIRPN  545
            AS  +R ++K K  L   L  +   V      F+   P NMHNA+VGHRTY NLKTIRP+
Sbjct  408  ASSEERAQIKGKASL---LAAVDYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPS  464

Query  546  MQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            M LLGQLFLNK+++W +F  +V+EGH NR G+IRLRKP+ S+
Sbjct  465  MSLLGQLFLNKSISWSDFQQSVVEGHQNRHGQIRLRKPKQSI  506



>ref|XP_008236135.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Prunus 
mume]
Length=529

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            +G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  304  QGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQ  363

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLASSEE
Sbjct  364  GRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASSEE  423

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R +IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  424  RAQIKGKASLLAAVDYYVSMHSDIFISASP  453


 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLH-HPANMHNAMVGHRTYHNLKTIRPN  545
            AS  +R ++K K  L   L  +   V      F+   P NMHNA+VGHRTY NLKTIRP+
Sbjct  419  ASSEERAQIKGKASL---LAAVDYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPS  475

Query  546  MQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            M LLGQLFLNK+++W +F  +V+EGH NR G+IRLRKP+ S+
Sbjct  476  MSLLGQLFLNKSISWSDFQQSVVEGHQNRHGQIRLRKPKQSI  517



>ref|XP_009785662.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=516

 Score =   259 bits (663),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQG  211
            G  K+V +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR QG
Sbjct  292  GAGKYVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRGQG  351

Query  212  RCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEER  391
            RCPLTPEE+GLLL ALGF+N+TRLYLASHKVYGG ARISAL +LFP ME+KKSLA+S E 
Sbjct  352  RCPLTPEEIGLLLTALGFNNSTRLYLASHKVYGGEARISALHQLFPFMEDKKSLAASHEL  411

Query  392  GEIKGKASLLAAVDYYVGMHSDIFISASP  478
             E++GKASLLAA+DYYV M SDIFISASP
Sbjct  412  SEVEGKASLLAALDYYVSMQSDIFISASP  440


 Score = 93.2 bits (230),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++GHR Y NLKTIRPNM LLG+LFLNK + W EF  AV +GH NR G++RLRK
Sbjct  440  PGNMHNALLGHRAYKNLKTIRPNMTLLGKLFLNKTMEWSEFQRAVQQGHKNRQGQMRLRK  499

Query  657  PR*SL  671
             + S+
Sbjct  500  EKQSI  504



>ref|XP_011016933.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Populus 
euphratica]
Length=513

 Score =   257 bits (657),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +2

Query  20   SKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL  199
            ++ EG  KFV +HLRFDKDMAAHS+CDFGGGKAE+L+LAKYRQ+ WQGRVLNSQFTDE L
Sbjct  285  TESEGSGKFVVLHLRFDKDMAAHSSCDFGGGKAERLALAKYRQVLWQGRVLNSQFTDEAL  344

Query  200  RSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLAS  379
            R QGRCPLTPEE+GLLLAALGF N+TRLYLASHKVYGG ARISAL++LFPL+++KKSLAS
Sbjct  345  RKQGRCPLTPEEIGLLLAALGFSNSTRLYLASHKVYGGEARISALKKLFPLVDHKKSLAS  404

Query  380  SEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            +EE  ++ GKASLLAAVDYYV + SDIFISASP
Sbjct  405  AEELAKVDGKASLLAAVDYYVSLQSDIFISASP  437


 Score = 95.5 bits (236),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHR Y NLKTIRPNM +LG LFLNK++ WPEF  AV+ GH +R G+IRLRK
Sbjct  437  PGNMHNALVGHRAYLNLKTIRPNMVMLGPLFLNKSMEWPEFQHAVLSGHKSRQGQIRLRK  496

Query  657  PR*SL  671
             R S+
Sbjct  497  ERQSI  501



>ref|XP_002514041.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48624.1| conserved hypothetical protein [Ricinus communis]
Length=519

 Score =   257 bits (657),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 143/173 (83%), Gaps = 14/173 (8%)
 Frame = +2

Query  2    RLRYPA--------------SKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAK  139
            RLRYP+              +  EG  K+V +HLRFDKDMAAHS+CDFGGGKAE+L+LAK
Sbjct  264  RLRYPSGASGTEFVKERRGDTGKEGSGKYVVLHLRFDKDMAAHSSCDFGGGKAERLALAK  323

Query  140  YRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAA  319
            YRQ+ WQGRVLNSQFTDEELR QGRCPLTPEE+GLLLAALGF N+TRLYLASHKVYGG A
Sbjct  324  YRQVLWQGRVLNSQFTDEELRGQGRCPLTPEEIGLLLAALGFSNSTRLYLASHKVYGGEA  383

Query  320  RISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R+S L++LFP ME+KKSLAS+EE   ++GKASLLAAVDYYV + SDIFISASP
Sbjct  384  RVSTLKQLFPSMEDKKSLASAEELALVEGKASLLAAVDYYVSLQSDIFISASP  436


 Score = 95.5 bits (236),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHR Y NLKTIRPNM LLG LFLNK++ W EF  AV++GH NR G+IRLRK
Sbjct  436  PGNMHNALVGHRAYLNLKTIRPNMVLLGPLFLNKSVEWSEFQTAVVKGHKNRQGQIRLRK  495

Query  657  PR*SL  671
             + S+
Sbjct  496  EKQSI  500



>ref|XP_011016934.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Populus 
euphratica]
Length=495

 Score =   257 bits (657),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +2

Query  20   SKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL  199
            ++ EG  KFV +HLRFDKDMAAHS+CDFGGGKAE+L+LAKYRQ+ WQGRVLNSQFTDE L
Sbjct  267  TESEGSGKFVVLHLRFDKDMAAHSSCDFGGGKAERLALAKYRQVLWQGRVLNSQFTDEAL  326

Query  200  RSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLAS  379
            R QGRCPLTPEE+GLLLAALGF N+TRLYLASHKVYGG ARISAL++LFPL+++KKSLAS
Sbjct  327  RKQGRCPLTPEEIGLLLAALGFSNSTRLYLASHKVYGGEARISALKKLFPLVDHKKSLAS  386

Query  380  SEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            +EE  ++ GKASLLAAVDYYV + SDIFISASP
Sbjct  387  AEELAKVDGKASLLAAVDYYVSLQSDIFISASP  419


 Score = 95.5 bits (236),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHR Y NLKTIRPNM +LG LFLNK++ WPEF  AV+ GH +R G+IRLRK
Sbjct  419  PGNMHNALVGHRAYLNLKTIRPNMVMLGPLFLNKSMEWPEFQHAVLSGHKSRQGQIRLRK  478

Query  657  PR*SL  671
             R S+
Sbjct  479  ERQSI  483



>emb|CDY34289.1| BnaA01g13920D [Brassica napus]
Length=792

 Score =   264 bits (674),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQG  211
            G  KFV +HLRFDKDMAAHS CDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++G
Sbjct  567  GAGKFVVLHLRFDKDMAAHSGCDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKG  626

Query  212  RCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEER  391
            RCPLTPEE+GLLL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP++ENKKSLAS+EE 
Sbjct  627  RCPLTPEEIGLLLSALGFTNNTRLYLASHQVYGGEARISTLRKLFPVLENKKSLASAEEL  686

Query  392  GEIKGKASLLAAVDYYVGMHSDIFISASP  478
             E++GKASL+AAVDYYV M SDIFISASP
Sbjct  687  AEVEGKASLMAAVDYYVSMKSDIFISASP  715


 Score = 88.6 bits (218),  Expect(2) = 4e-88, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF  AV+ GH NR G++RLRK
Sbjct  715  PGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLGWSEFEGAVVNGHKNRQGQLRLRK  774

Query  657  PR*SL  671
             + S+
Sbjct  775  QKQSI  779



>ref|XP_002301095.2| hypothetical protein POPTR_0002s10600g [Populus trichocarpa]
 gb|EEE80368.2| hypothetical protein POPTR_0002s10600g [Populus trichocarpa]
Length=513

 Score =   257 bits (656),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = +2

Query  20   SKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL  199
            ++ EG  KFV +HLRFDKDMAAHS+CDFGGGKAE+L+LAKYRQ+ WQGRVLNSQFTDE L
Sbjct  285  TESEGSGKFVVLHLRFDKDMAAHSSCDFGGGKAERLALAKYRQLLWQGRVLNSQFTDEAL  344

Query  200  RSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLAS  379
            R QGRCPLTPEE+GLLLAALGF N+TRLYLASHKVYGG ARISAL++LFPL+++KKSLAS
Sbjct  345  RKQGRCPLTPEEIGLLLAALGFSNSTRLYLASHKVYGGEARISALKKLFPLVDHKKSLAS  404

Query  380  SEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            +EE  ++ GKASLLAAVDYYV + SDIFISASP
Sbjct  405  AEELAKVDGKASLLAAVDYYVSLQSDIFISASP  437


 Score = 95.5 bits (236),  Expect(2) = 4e-88, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHR Y NLKTIRPNM +LG LFLNK++ WPEF  AV+ GH +R G+IRLRK
Sbjct  437  PGNMHNALVGHRAYLNLKTIRPNMVMLGPLFLNKSMEWPEFQYAVLSGHKSRQGQIRLRK  496

Query  657  PR*SL  671
             R S+
Sbjct  497  ERQSI  501



>ref|XP_006472461.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 ref|XP_006472462.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
Length=517

 Score =   260 bits (665),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  20   SKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL  199
            S+  G  KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEEL
Sbjct  289  SEVTGAGKFTVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEEL  348

Query  200  RSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLAS  379
            R+QGRCPLTPEE+GLLLAALGF+N TRLYLASHKVYGG ARIS L++LFPLME+KKS+AS
Sbjct  349  RNQGRCPLTPEEIGLLLAALGFNNGTRLYLASHKVYGGEARISTLQKLFPLMEDKKSIAS  408

Query  380  SEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            +EE  +I+GKASL AAVDYYV M SDIFISASP
Sbjct  409  AEELAKIEGKASLSAAVDYYVSMQSDIFISASP  441


 Score = 91.7 bits (226),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHR Y NLKTIRPNM LLG+LFLNK++ W EF  AV  GH NR G IRLRK
Sbjct  441  PGNMHNALVGHRAYLNLKTIRPNMTLLGKLFLNKSMGWTEFQHAVRNGHKNRLGHIRLRK  500

Query  657  PR*SL  671
             + S+
Sbjct  501  SKQSI  505



>ref|XP_006472463.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Citrus sinensis]
Length=514

 Score =   260 bits (665),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  20   SKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL  199
            S+  G  KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEEL
Sbjct  286  SEVTGAGKFTVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEEL  345

Query  200  RSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLAS  379
            R+QGRCPLTPEE+GLLLAALGF+N TRLYLASHKVYGG ARIS L++LFPLME+KKS+AS
Sbjct  346  RNQGRCPLTPEEIGLLLAALGFNNGTRLYLASHKVYGGEARISTLQKLFPLMEDKKSIAS  405

Query  380  SEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            +EE  +I+GKASL AAVDYYV M SDIFISASP
Sbjct  406  AEELAKIEGKASLSAAVDYYVSMQSDIFISASP  438


 Score = 91.7 bits (226),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHR Y NLKTIRPNM LLG+LFLNK++ W EF  AV  GH NR G IRLRK
Sbjct  438  PGNMHNALVGHRAYLNLKTIRPNMTLLGKLFLNKSMGWTEFQHAVRNGHKNRLGHIRLRK  497

Query  657  PR*SL  671
             + S+
Sbjct  498  SKQSI  502



>ref|XP_004501643.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=513

 Score =   259 bits (661),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  292  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRSQGRCP  351

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGF+N+TRLYLASHKVYGG AR+  L +LFP ME+KKSL S+E+  +I
Sbjct  352  LTPEEIGLLLAALGFNNSTRLYLASHKVYGGKARLETLSKLFPFMEDKKSLVSAEKLTKI  411

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            KGKASLLAAVDY+V +HSDIFISASP
Sbjct  412  KGKASLLAAVDYHVSLHSDIFISASP  437


 Score = 92.8 bits (229),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+V HR Y NLKTIRPNM LLGQLF NK++ W EF   V++GH NR G+IRLRK
Sbjct  437  PGNMHNALVAHRAYRNLKTIRPNMALLGQLFQNKSIGWSEFQRTVLDGHKNRQGQIRLRK  496

Query  657  PR*SL  671
             + S+
Sbjct  497  EKQSI  501



>gb|AGV54860.1| O-fucosyltransferase family protein [Phaseolus vulgaris]
Length=516

 Score =   265 bits (677),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  295  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRSQGRCP  354

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++
Sbjct  355  LTPEEIGLLLAALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEELAKV  414

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            KGKASLLA+VDYYV MHSDIFISASP
Sbjct  415  KGKASLLASVDYYVSMHSDIFISASP  440


 Score = 87.0 bits (214),  Expect(2) = 6e-88, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+V HR Y NLKTIRP+M  LG LF NK+++W EF   V++GH NR G+IRLRK
Sbjct  440  PGNMHNALVAHRAYMNLKTIRPSMGSLGHLFQNKSVSWSEFQRVVLDGHKNRQGQIRLRK  499

Query  657  PR*SL  671
             + S+
Sbjct  500  EKQSI  504



>ref|XP_011099984.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Sesamum indicum]
Length=517

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 147/177 (83%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    RLRYPASKDE------------------GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKL  127
            RLRYP S  E                  G  KFV +HLRFDKDMAAHSACDFGGGKAEKL
Sbjct  265  RLRYPHSTSEVDSASYLKNVGGGSKDKQGTGKFVVLHLRFDKDMAAHSACDFGGGKAEKL  324

Query  128  SLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVY  307
            +LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVY
Sbjct  325  ALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVY  384

Query  308  GGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            GGAARIS LR +FP ME+KKSLAS+EER +IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  385  GGAARISTLRSIFPFMEDKKSLASTEERAQIKGKASLLAAVDYYVSMHSDIFISASP  441


 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLH-HPANMHNAMVGHRTYHNLKTIRPN  545
            AS  +R ++K K  L   L  +   V      F+   P NMHNA+VGHRTY NLKTIRPN
Sbjct  407  ASTEERAQIKGKASL---LAAVDYYVSMHSDIFISASPGNMHNAVVGHRTYENLKTIRPN  463

Query  546  MQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            M LLGQLFLNK+LTW EF +AV++GH +R G +RLRKP  S+
Sbjct  464  MALLGQLFLNKSLTWLEFQEAVVKGHKSRQGLLRLRKPEQSI  505



>ref|XP_008368388.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=519

 Score =   262 bits (670),  Expect(2) = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 145/174 (83%), Gaps = 15/174 (9%)
 Frame = +2

Query  2    RLRYP--------ASKD-------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLA  136
            RLRYP         S+D       +G  K+V +HLRFDKDMAAHSACDFGGGKAEKL+LA
Sbjct  270  RLRYPNRNQKAGTGSQDKANEIEKQGAGKYVVLHLRFDKDMAAHSACDFGGGKAEKLALA  329

Query  137  KYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGA  316
            KYRQ+ WQGRVL SQFTDEELR+QGRCPLTPEE+GLLLAALGF+N TRLYLASHKVYGG 
Sbjct  330  KYRQVIWQGRVLKSQFTDEELRNQGRCPLTPEEIGLLLAALGFNNTTRLYLASHKVYGGE  389

Query  317  ARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            ARIS LRRLFP M++KK LAS+EER +++GKASLLAAVDYYV M SDIFISASP
Sbjct  390  ARISTLRRLFPDMDDKKGLASAEERAKVEGKASLLAAVDYYVSMQSDIFISASP  443


 Score = 89.4 bits (220),  Expect(2) = 8e-88, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHR Y NLKTIRPNM LLG+LF+NK+  W +F  AV +GH  R G++RLRK
Sbjct  443  PGNMHNALVGHRAYMNLKTIRPNMALLGKLFVNKSXEWSDFQRAVSDGHKTRQGQMRLRK  502

Query  657  PR*SL  671
             + S+
Sbjct  503  EKQSI  507



>ref|XP_011099981.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
 ref|XP_011099982.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
 ref|XP_011099983.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
Length=518

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 147/177 (83%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    RLRYPASKDE------------------GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKL  127
            RLRYP S  E                  G  KFV +HLRFDKDMAAHSACDFGGGKAEKL
Sbjct  266  RLRYPHSTSEVDSASYLKNVGGGSKDKQGTGKFVVLHLRFDKDMAAHSACDFGGGKAEKL  325

Query  128  SLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVY  307
            +LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVY
Sbjct  326  ALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVY  385

Query  308  GGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            GGAARIS LR +FP ME+KKSLAS+EER +IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  386  GGAARISTLRSIFPFMEDKKSLASTEERAQIKGKASLLAAVDYYVSMHSDIFISASP  442


 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLH-HPANMHNAMVGHRTYHNLKTIRPN  545
            AS  +R ++K K  L   L  +   V      F+   P NMHNA+VGHRTY NLKTIRPN
Sbjct  408  ASTEERAQIKGKASL---LAAVDYYVSMHSDIFISASPGNMHNAVVGHRTYENLKTIRPN  464

Query  546  MQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            M LLGQLFLNK+LTW EF +AV++GH +R G +RLRKP  S+
Sbjct  465  MALLGQLFLNKSLTWLEFQEAVVKGHKSRQGLLRLRKPEQSI  506



>gb|EYU30936.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
 gb|EYU30937.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
Length=511

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 149/174 (86%), Gaps = 15/174 (9%)
 Frame = +2

Query  2    RLRYPASKDE---------------GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLA  136
            RLRYP+S+ +               G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+LA
Sbjct  261  RLRYPSSRVDSTNYLKKVGDSNEKRGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALA  320

Query  137  KYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGA  316
            KYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN TRLYLASHKVYGG 
Sbjct  321  KYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNTTRLYLASHKVYGGE  380

Query  317  ARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            ARISALR LFPLME+KKSLASSEER +IKGKASLLAAVD+YV +HSDIF+SASP
Sbjct  381  ARISALRSLFPLMEDKKSLASSEERAQIKGKASLLAAVDHYVSIHSDIFVSASP  434


 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 68/103 (66%), Gaps = 6/103 (6%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLIT--MSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRP  542
            AS  +R ++K K  L   L  +   +S+ + IF     P NMHNA+VGHRTY N KTIRP
Sbjct  400  ASSEERAQIKGKASL---LAAVDHYVSIHSDIF-VSASPGNMHNAVVGHRTYRNTKTIRP  455

Query  543  NMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            NM LLGQLFLNK+L W EF  AV+EGH +R G +RLRK   S+
Sbjct  456  NMALLGQLFLNKSLDWAEFEKAVVEGHKSRQGMLRLRKSEQSI  498



>ref|XP_010277497.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=514

 Score =   253 bits (646),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  23   KDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELR  202
            K  G  KFV +HLRFDKDMAAHSACDFGGGKAEK++LAKYRQ+ WQGRV+NSQFTDEELR
Sbjct  287  KKWGDGKFVVLHLRFDKDMAAHSACDFGGGKAEKMALAKYRQVIWQGRVMNSQFTDEELR  346

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
            SQGRCPLTPEE+GLLLAALG DN+TRLYLASHKVYGG ARI ALR LFPLME+KKSLAS 
Sbjct  347  SQGRCPLTPEEIGLLLAALGLDNSTRLYLASHKVYGGEARIQALRNLFPLMEDKKSLASE  406

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            EER +I+GKASLLAAVDYYV MHSDIFISASP
Sbjct  407  EERAKIEGKASLLAAVDYYVSMHSDIFISASP  438


 Score = 98.2 bits (243),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRTY NLKTIRP+M LLGQL LNK++ W +F  AV+EGH NR G+IRLRK
Sbjct  438  PGNMHNALVGHRTYENLKTIRPSMALLGQLLLNKSIEWSKFQQAVLEGHKNRQGQIRLRK  497

Query  657  PR*SL  671
             + S+
Sbjct  498  EKQSI  502



>emb|CDY03446.1| BnaC01g16360D [Brassica napus]
Length=613

 Score =   263 bits (673),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQG  211
            G  KFV +HLRFDKDMAAHS CDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++G
Sbjct  388  GAGKFVVLHLRFDKDMAAHSGCDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKG  447

Query  212  RCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEER  391
            RCPLTPEE+GLLL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP++ENKKSLAS+EE 
Sbjct  448  RCPLTPEEIGLLLSALGFTNNTRLYLASHQVYGGEARISTLRKLFPVLENKKSLASAEEL  507

Query  392  GEIKGKASLLAAVDYYVGMHSDIFISASP  478
             E++GKASL+AAVDYYV M SDIFISASP
Sbjct  508  AEVEGKASLMAAVDYYVSMKSDIFISASP  536


 Score = 86.3 bits (212),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF  AV+ GH NR G++RLRK
Sbjct  536  PGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLGWSEFEGAVVNGHKNRQGQLRLRK  595

Query  657  PR*SL  671
             + S+
Sbjct  596  QKQSI  600



>ref|XP_006433826.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
 gb|ESR47066.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
Length=514

 Score =   260 bits (665),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  20   SKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL  199
            S+  G  KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEEL
Sbjct  286  SEVTGAGKFTVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEEL  345

Query  200  RSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLAS  379
            R+QGRCPLTPEE+GLLLAALGF+N TRLYLASHKVYGG ARIS L++LFPLME+KKS+AS
Sbjct  346  RNQGRCPLTPEEIGLLLAALGFNNGTRLYLASHKVYGGEARISTLQKLFPLMEDKKSIAS  405

Query  380  SEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            +EE  +I+GKASL AAVDYYV M SDIFISASP
Sbjct  406  AEELTKIEGKASLSAAVDYYVSMQSDIFISASP  438


 Score = 89.4 bits (220),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHR Y  LKTIRPNM LLG+LFLNK++ W EF  AV  GH NR G IRLRK
Sbjct  438  PGNMHNALVGHRAYLKLKTIRPNMTLLGKLFLNKSMGWTEFQHAVRNGHKNRLGHIRLRK  497

Query  657  PR*SL  671
             + S+
Sbjct  498  TKQSI  502



>gb|KHG22139.1| hypothetical protein F383_05782 [Gossypium arboreum]
Length=467

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 146/176 (83%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP ++ +                  PQKFV VHLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  267  RLRYPPTESQPLITDDLTGTTDRNVKQMPQKFVVVHLRFDKDMAAHSACDFGGGKAEKLA  326

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYG
Sbjct  327  LAKYRQRIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYG  386

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR LFP MENKKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  387  GEARISTLRELFPKMENKKSLASSEERVLIKGKASLLAAVDYYVGMHSDIFVSASP  442



>ref|XP_006433827.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
 gb|ESR47067.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
Length=517

 Score =   260 bits (664),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +2

Query  20   SKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL  199
            S+  G  KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEEL
Sbjct  289  SEVTGAGKFTVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEEL  348

Query  200  RSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLAS  379
            R+QGRCPLTPEE+GLLLAALGF+N TRLYLASHKVYGG ARIS L++LFPLME+KKS+AS
Sbjct  349  RNQGRCPLTPEEIGLLLAALGFNNGTRLYLASHKVYGGEARISTLQKLFPLMEDKKSIAS  408

Query  380  SEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            +EE  +I+GKASL AAVDYYV M SDIFISASP
Sbjct  409  AEELTKIEGKASLSAAVDYYVSMQSDIFISASP  441


 Score = 89.4 bits (220),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHR Y  LKTIRPNM LLG+LFLNK++ W EF  AV  GH NR G IRLRK
Sbjct  441  PGNMHNALVGHRAYLKLKTIRPNMTLLGKLFLNKSMGWTEFQHAVRNGHKNRLGHIRLRK  500

Query  657  PR*SL  671
             + S+
Sbjct  501  TKQSI  505



>ref|XP_009138156.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=515

 Score =   263 bits (672),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQG  211
            G  KFV +HLRFDKDMAAHS CDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++G
Sbjct  290  GAGKFVVLHLRFDKDMAAHSGCDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKG  349

Query  212  RCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEER  391
            RCPLTPEE+GLLL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP++ENKKSLAS+EE 
Sbjct  350  RCPLTPEEIGLLLSALGFTNNTRLYLASHQVYGGEARISTLRKLFPVLENKKSLASAEEL  409

Query  392  GEIKGKASLLAAVDYYVGMHSDIFISASP  478
             E++GKASL+AAVDYYV M SDIFISASP
Sbjct  410  AEVEGKASLMAAVDYYVSMKSDIFISASP  438


 Score = 86.3 bits (212),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF  AV+ GH NR G++RLRK
Sbjct  438  PGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLGWSEFEGAVVNGHKNRQGQLRLRK  497

Query  657  PR*SL  671
             + S+
Sbjct  498  QKQSI  502



>gb|KJB58883.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=489

 Score =   258 bits (658),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ  181
            R R   ++ E   KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQ
Sbjct  255  RERTDDTEKERAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQ  314

Query  182  FTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMEN  361
            FTD ELR+QGRCPLTPEE+GLLL ALGF+NNT LYLASHKVYGG ARIS LR +FPLME+
Sbjct  315  FTDHELRNQGRCPLTPEEIGLLLTALGFNNNTHLYLASHKVYGGEARISTLRTMFPLMED  374

Query  362  KKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            KKSLAS+ E  E++GKASL+AAVDYYV + SDIFISASP
Sbjct  375  KKSLASAIELAEVEGKASLMAAVDYYVSLKSDIFISASP  413


 Score = 91.7 bits (226),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++GHR Y NLKTIRPNM LLG LFLNK + W EF  AVI GH NR G++RLRK
Sbjct  413  PGNMHNALLGHRAYLNLKTIRPNMLLLGPLFLNKTIEWSEFQHAVINGHKNRQGQMRLRK  472

Query  657  PR*SL  671
             + S+
Sbjct  473  EKQSI  477



>ref|XP_003602912.1| PsRT17-1 like protein [Medicago truncatula]
 gb|AES73163.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=517

 Score =   256 bits (653),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQF DEELR+QGRCP
Sbjct  296  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFNDEELRNQGRCP  355

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGF+N TRLYLASHKVYGG AR+  L  LFP ME+KKSL S+E   ++
Sbjct  356  LTPEEIGLLLAALGFNNRTRLYLASHKVYGGKARLETLSTLFPFMEDKKSLVSAETMAKV  415

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
             GKASLLAAVDYYV MHSDIFISASP
Sbjct  416  NGKASLLAAVDYYVSMHSDIFISASP  441


 Score = 93.6 bits (231),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+V HR Y NLKTIRPNM LLGQLF NK++ W +F  AV++GH NR G+IRLRK
Sbjct  441  PGNMHNALVAHRAYKNLKTIRPNMALLGQLFQNKSIGWSDFQRAVLDGHKNRQGQIRLRK  500

Query  657  PR*SL  671
             + S+
Sbjct  501  EKQSI  505



>gb|KJB58881.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
 gb|KJB58882.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=518

 Score =   257 bits (657),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ  181
            R R   ++ E   KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQ
Sbjct  284  RERTDDTEKERAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQ  343

Query  182  FTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMEN  361
            FTD ELR+QGRCPLTPEE+GLLL ALGF+NNT LYLASHKVYGG ARIS LR +FPLME+
Sbjct  344  FTDHELRNQGRCPLTPEEIGLLLTALGFNNNTHLYLASHKVYGGEARISTLRTMFPLMED  403

Query  362  KKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            KKSLAS+ E  E++GKASL+AAVDYYV + SDIFISASP
Sbjct  404  KKSLASAIELAEVEGKASLMAAVDYYVSLKSDIFISASP  442


 Score = 91.7 bits (226),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++GHR Y NLKTIRPNM LLG LFLNK + W EF  AVI GH NR G++RLRK
Sbjct  442  PGNMHNALLGHRAYLNLKTIRPNMLLLGPLFLNKTIEWSEFQHAVINGHKNRQGQMRLRK  501

Query  657  PR*SL  671
             + S+
Sbjct  502  EKQSI  506



>ref|XP_010439017.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
 ref|XP_010439018.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
 ref|XP_010439019.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=518

 Score =   258 bits (660),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 141/176 (80%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDE-----------------GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP S  +                 G  KF  +HLRFDKDMAAHS CDF GGKAEKL+
Sbjct  266  RLRYPPSSSQTSGNMDPTDRINTIVKAGAGKFAVLHLRFDKDMAAHSGCDFEGGKAEKLA  325

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+ALGF NNTRLYLASH+VYG
Sbjct  326  LAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLSALGFSNNTRLYLASHQVYG  385

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR+LFP MENKKSLAS+EE  +I+GKASL+AAVDYYV M SDIFISASP
Sbjct  386  GEARISTLRKLFPGMENKKSLASAEELADIEGKASLMAAVDYYVSMKSDIFISASP  441


 Score = 90.9 bits (224),  Expect(2) = 4e-87, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF  AV+ GH NR G++RLRK
Sbjct  441  PGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVVNGHKNRHGQLRLRK  500

Query  657  PR*SL  671
             + S+
Sbjct  501  QKQSI  505



>ref|XP_010448552.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=518

 Score =   258 bits (658),  Expect(2) = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 141/176 (80%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDE-----------------GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP S  +                 G  KF  +HLRFDKDMAAHS CDF GGKAEKL+
Sbjct  266  RLRYPPSSSQTSGNMDPTDRINTIVKAGAGKFAVLHLRFDKDMAAHSGCDFEGGKAEKLA  325

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+ALGF NNTRLYLASH+VYG
Sbjct  326  LAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLSALGFSNNTRLYLASHQVYG  385

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR+LFP MENKKSLAS+EE  +++GKASL+AAVDYYV M SDIFISASP
Sbjct  386  GEARISTLRKLFPGMENKKSLASAEELADVEGKASLMAAVDYYVSMKSDIFISASP  441


 Score = 90.9 bits (224),  Expect(2) = 6e-87, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF  AV+ GH NR G++RLRK
Sbjct  441  PGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVVNGHKNRHGQLRLRK  500

Query  657  PR*SL  671
             + S+
Sbjct  501  QKQSI  505



>ref|XP_003523785.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score =   261 bits (666),  Expect(2) = 7e-87, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+L KYRQ+ WQGRVLNSQFTDEELR+QGRCP
Sbjct  290  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALVKYRQVLWQGRVLNSQFTDEELRNQGRCP  349

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++
Sbjct  350  LTPEEIGLLLAALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEEMAKV  409

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            KGKASLLAAVDYYV M SDIFISASP
Sbjct  410  KGKASLLAAVDYYVSMQSDIFISASP  435


 Score = 87.8 bits (216),  Expect(2) = 7e-87, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+  +R Y NLKTIRP+M LLGQLF NK++ W EF  A+++GH NR G+IRLRK
Sbjct  435  PGNMHNALAANRAYMNLKTIRPSMGLLGQLFQNKSIGWSEFQRAILDGHKNRQGQIRLRK  494

Query  657  PR*SL  671
             + S+
Sbjct  495  EKQSI  499



>gb|KHN08263.1| DUF246 domain-containing protein [Glycine soja]
Length=511

 Score =   261 bits (666),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+L KYRQ+ WQGRVLNSQFTDEELR+QGRCP
Sbjct  290  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALVKYRQVLWQGRVLNSQFTDEELRNQGRCP  349

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++
Sbjct  350  LTPEEIGLLLAALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEEMAKV  409

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            KGKASLLAAVDYYV M SDIFISASP
Sbjct  410  KGKASLLAAVDYYVSMQSDIFISASP  435


 Score = 87.4 bits (215),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+  +R Y NLKTIRP+M LLGQLF NK++ W EF  A+++GH NR G+IRLRK
Sbjct  435  PGNMHNALAANRAYMNLKTIRPSMGLLGQLFQNKSIGWSEFQRAILDGHKNRQGQIRLRK  494

Query  657  PR*SL  671
             + S+
Sbjct  495  EKQSI  499



>ref|XP_011097478.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=516

 Score =   278 bits (710),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 146/176 (83%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDE-----------------GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP S  E                 G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  265  RLRYPPSTSEVDGSNYLRQVSDSKDKQGTGKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  324

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELRS+GRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYG
Sbjct  325  LAKYRQVIWQGRVLNSQFTDEELRSRGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYG  384

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR LFP ME+KKSLASSEER +IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  385  GEARISTLRSLFPHMEDKKSLASSEERAQIKGKASLLAAVDYYVSMHSDIFISASP  440


 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 71/102 (70%), Gaps = 4/102 (4%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLH-HPANMHNAMVGHRTYHNLKTIRPN  545
            AS  +R ++K K  L   L  +   V      F+   P NMHNA+VGHRTY N KTIRP+
Sbjct  406  ASSEERAQIKGKASL---LAAVDYYVSMHSDIFISASPGNMHNAVVGHRTYENKKTIRPS  462

Query  546  MQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            M LLGQLFLNKNLTWPEF DAV+EGH NR G++RLRKP+ S+
Sbjct  463  MTLLGQLFLNKNLTWPEFQDAVVEGHKNRQGQLRLRKPQQSI  504



>ref|XP_002867661.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43920.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   256 bits (655),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 141/176 (80%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDE-----------------GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP S  +                 G  KF  +HLRFDKDMAAHS CDF GGKAEKL+
Sbjct  267  RLRYPPSSSQTSGTMDQTDRINTIVKAGAGKFAVLHLRFDKDMAAHSGCDFEGGKAEKLA  326

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+ALGF NNTRLYLASH+VYG
Sbjct  327  LAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLSALGFSNNTRLYLASHQVYG  386

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR+LFP +ENKKSLAS+EE  +++GKASL+AAVDYYV M SDIFISASP
Sbjct  387  GEARISTLRKLFPGIENKKSLASAEELADVQGKASLMAAVDYYVSMKSDIFISASP  442


 Score = 91.3 bits (225),  Expect(2) = 1e-86, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF  AV+ GH NR G++RLRK
Sbjct  442  PGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLEWSEFEGAVVNGHRNRQGQLRLRK  501

Query  657  PR*SL  671
             + S+
Sbjct  502  QKQSI  506



>ref|XP_002533683.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28699.1| conserved hypothetical protein [Ricinus communis]
Length=509

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 148/175 (85%), Gaps = 17/175 (10%)
 Frame = +2

Query  2    RLRYPASK----------------DEG-PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP+ K                DE   +KF+AVHLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  258  RLRYPSKKTVVGNTDYLRETLDVNDENEARKFIAVHLRFDKDMAAHSACDFGGGKAEKLA  317

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP+TPEE+G+ LAALGFDN+TRLYLASHKVYG
Sbjct  318  LAKYRQVIWQGRVLNSQFTDEELRSQGRCPMTPEEIGIFLAALGFDNSTRLYLASHKVYG  377

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISAS  475
            G ARIS LR LFPLME+KKSLASSEER +IKGKASLLAAVDYYV MHSDIF+SAS
Sbjct  378  GEARISVLRELFPLMEDKKSLASSEERAQIKGKASLLAAVDYYVAMHSDIFLSAS  432


 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 71/104 (68%), Gaps = 8/104 (8%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPA---NMHNAMVGHRTYHNLKTIR  539
            AS  +R ++K K  L     L  +    A+ S +   A   NMHNA+VGHRTY NLKTIR
Sbjct  399  ASSEERAQIKGKASL-----LAAVDYYVAMHSDIFLSASRGNMHNALVGHRTYENLKTIR  453

Query  540  PNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            PNM LLGQLFLNKN++W EF  +V+EGH +R GEIR+R+P+ SL
Sbjct  454  PNMPLLGQLFLNKNISWSEFQQSVLEGHEDRQGEIRVRRPKQSL  497



>ref|XP_010433755.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=529

 Score =   258 bits (658),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 141/176 (80%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDE-----------------GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP S  +                 G  KF  +HLRFDKDMAAHS CDF GGKAEKL+
Sbjct  277  RLRYPPSSSQTSGNIDPTDRINTIVKAGSGKFAVLHLRFDKDMAAHSGCDFEGGKAEKLA  336

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+ALGF NNTRLYLASH+VYG
Sbjct  337  LAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLSALGFSNNTRLYLASHQVYG  396

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR+LFP MENKKSLAS+EE  +++GKASL+AAVDYYV M SDIFISASP
Sbjct  397  GEARISTLRKLFPGMENKKSLASAEELADVEGKASLMAAVDYYVSMKSDIFISASP  452


 Score = 89.0 bits (219),  Expect(2) = 2e-86, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF  AV+ GH NR G++R+RK
Sbjct  452  PGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVVNGHKNRHGQLRIRK  511



>ref|XP_010680342.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=506

 Score =   275 bits (704),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 150/175 (86%), Gaps = 16/175 (9%)
 Frame = +2

Query  2    RLRYPASKDEG----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSL  133
            RL+YP+S+ E                 PQKFV +HLRFDKDMAAHSACDFGGGKAEKL+L
Sbjct  256  RLQYPSSRSEPEHGLLQQFNYRKGYREPQKFVVLHLRFDKDMAAHSACDFGGGKAEKLAL  315

Query  134  AKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGG  313
            A+YRQ+ WQGRVLNSQFTDEELRSQGRCP+TPEEVGLLLAALGFDN+TRLYLASHKVYGG
Sbjct  316  ARYRQVMWQGRVLNSQFTDEELRSQGRCPMTPEEVGLLLAALGFDNSTRLYLASHKVYGG  375

Query  314  AARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
             AR++ L++LFPLME+KKSLAS++ER  IKGKASLLAA+DYYV MHSDIFISASP
Sbjct  376  RARLATLKKLFPLMEDKKSLASADERARIKGKASLLAALDYYVSMHSDIFISASP  430


 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRT+ +LKTIRPNM
Sbjct  396  ASADERARIKGKASLLAALDYY-VSMHSDIF-ISASPGNMHNALVGHRTFESLKTIRPNM  453

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             LLGQLFL+KN++W +F  AV+EGH  R G++RLRKP+ S+
Sbjct  454  GLLGQLFLDKNMSWVDFRQAVVEGHHYRHGQLRLRKPKQSI  494



>emb|CAA23010.1| PsRT17-1 like protein [Arabidopsis thaliana]
 emb|CAB79363.1| PsRT17-1 like protein [Arabidopsis thaliana]
Length=431

 Score =   254 bits (650),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQG  211
            G  KF  +HLRFDKDMAAHS CDF GGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++G
Sbjct  206  GAGKFAVLHLRFDKDMAAHSGCDFEGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKG  265

Query  212  RCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEER  391
            RCPLTPEE+GLLL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP +ENKKSLAS+EE 
Sbjct  266  RCPLTPEEIGLLLSALGFSNNTRLYLASHQVYGGEARISTLRKLFPGIENKKSLASAEEL  325

Query  392  GEIKGKASLLAAVDYYVGMHSDIFISASP  478
             +++GKASL+AAVDYYV M SDIFISASP
Sbjct  326  ADVQGKASLMAAVDYYVSMKSDIFISASP  354


 Score = 90.5 bits (223),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+  HR Y NLKTIRPNM LLGQ+F+NK+L W EF  AV+ GH NR G++RLRK
Sbjct  354  PGNMHNALQAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVMNGHKNRQGQLRLRK  413

Query  657  PR*SL  671
             + S+
Sbjct  414  QKQSI  418



>gb|EEE69695.1| hypothetical protein OsJ_29339 [Oryza sativa Japonica Group]
Length=722

 Score =   252 bits (643),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            K+  +HLRFDKDMAAHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TDEELR+ GRCP
Sbjct  291  KYAVLHLRFDKDMAAHSACDFGGGRAERLALAKYRQVIWQGRVLNSQLTDEELRNLGRCP  350

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGFD+ TR+YLASHKVYGG ARIS+LR+LFPLME+K+SLAS EE   +
Sbjct  351  LTPEEIGLLLAALGFDSRTRIYLASHKVYGGEARISSLRKLFPLMEDKRSLASEEELTNV  410

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            +GKAS+LAA+DYY+ MHSDIFISASP
Sbjct  411  EGKASVLAALDYYISMHSDIFISASP  436


 Score = 92.8 bits (229),  Expect(2) = 8e-86, Method: Composition-based stats.
 Identities = 39/65 (60%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HRT+ N+KTIRPNM LLG++F+NK++ W EF +AV  GH  R G+IRLRK
Sbjct  436  PGNMHNALMAHRTFENMKTIRPNMALLGRIFVNKSMEWLEFQEAVQAGHKGRYGQIRLRK  495

Query  657  PR*SL  671
            P+ S+
Sbjct  496  PKQSI  500



>gb|KFK28724.1| hypothetical protein AALP_AA7G039000 [Arabis alpina]
Length=513

 Score =   257 bits (656),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQG  211
            G  KFV +HLRFDKDMAAHS CDFGGGKAEKL+LAKYRQ+ WQGRVLNS  TDEELR++G
Sbjct  287  GAGKFVVLHLRFDKDMAAHSGCDFGGGKAEKLALAKYRQVIWQGRVLNSLLTDEELRNKG  346

Query  212  RCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEER  391
            RCPLTPEE+GLLL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP+MENKKSLAS EE 
Sbjct  347  RCPLTPEEIGLLLSALGFSNNTRLYLASHQVYGGEARISTLRKLFPVMENKKSLASVEEL  406

Query  392  GEIKGKASLLAAVDYYVGMHSDIFISASP  478
             +++GKASL+AAVDYYV M SDIFISASP
Sbjct  407  ADVEGKASLMAAVDYYVSMKSDIFISASP  435


 Score = 87.8 bits (216),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HR Y NLKTIRPNM LLGQ+ +NK+L W EF  +V+ GH NR G++RLRK
Sbjct  435  PGNMHNALLAHRAYLNLKTIRPNMILLGQVLVNKSLDWSEFEGSVLNGHKNRQGQLRLRK  494

Query  657  PR*SL  671
             + S+
Sbjct  495  EKQSI  499



>ref|XP_003517397.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=516

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 143/154 (93%), Gaps = 2/154 (1%)
 Frame = +2

Query  17   ASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEE  196
            A K+ G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEE
Sbjct  289  ARKNAG--KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEE  346

Query  197  LRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLA  376
            LRSQGRCP+TPEEVGLLLAA+GFDN+TRLYLASHKVYGG ARIS LR LFP ME+KKSLA
Sbjct  347  LRSQGRCPMTPEEVGLLLAAMGFDNSTRLYLASHKVYGGEARISTLRELFPRMEDKKSLA  406

Query  377  SSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            SSEER EIKGKASLLAA+DYYVG+HSDIFISASP
Sbjct  407  SSEERSEIKGKASLLAALDYYVGLHSDIFISASP  440


 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 69/101 (68%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R E+K K  L   L    + + + IF     P NMHNA+VGHRTY NLKTIRPNM
Sbjct  406  ASSEERSEIKGKASLLAALDYY-VGLHSDIF-ISASPGNMHNALVGHRTYLNLKTIRPNM  463

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK + W EF DAV+EGH NR GE RLRKP+ S+
Sbjct  464  ALMGQLFLNKTIEWSEFQDAVVEGHQNRQGEPRLRKPKQSI  504



>ref|XP_006573005.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=515

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 143/154 (93%), Gaps = 2/154 (1%)
 Frame = +2

Query  17   ASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEE  196
            A K+ G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEE
Sbjct  288  ARKNAG--KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEE  345

Query  197  LRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLA  376
            LRSQGRCP+TPEEVGLLLAA+GFDN+TRLYLASHKVYGG ARIS LR LFP ME+KKSLA
Sbjct  346  LRSQGRCPMTPEEVGLLLAAMGFDNSTRLYLASHKVYGGEARISTLRELFPRMEDKKSLA  405

Query  377  SSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            SSEER EIKGKASLLAA+DYYVG+HSDIFISASP
Sbjct  406  SSEERSEIKGKASLLAALDYYVGLHSDIFISASP  439


 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 69/101 (68%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R E+K K  L   L    + + + IF     P NMHNA+VGHRTY NLKTIRPNM
Sbjct  405  ASSEERSEIKGKASLLAALDYY-VGLHSDIF-ISASPGNMHNALVGHRTYLNLKTIRPNM  462

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK + W EF DAV+EGH NR GE RLRKP+ S+
Sbjct  463  ALMGQLFLNKTIEWSEFQDAVVEGHQNRQGEPRLRKPKQSI  503



>ref|NP_194184.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAP68214.1| At4g24530 [Arabidopsis thaliana]
 dbj|BAE99793.1| PsRT17-1 like protein [Arabidopsis thaliana]
 gb|AEE84921.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=519

 Score =   254 bits (650),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQG  211
            G  KF  +HLRFDKDMAAHS CDF GGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++G
Sbjct  294  GAGKFAVLHLRFDKDMAAHSGCDFEGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKG  353

Query  212  RCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEER  391
            RCPLTPEE+GLLL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP +ENKKSLAS+EE 
Sbjct  354  RCPLTPEEIGLLLSALGFSNNTRLYLASHQVYGGEARISTLRKLFPGIENKKSLASAEEL  413

Query  392  GEIKGKASLLAAVDYYVGMHSDIFISASP  478
             +++GKASL+AAVDYYV M SDIFISASP
Sbjct  414  ADVQGKASLMAAVDYYVSMKSDIFISASP  442


 Score = 89.7 bits (221),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+  HR Y NLKTIRPNM LLGQ+F+NK+L W EF  AV+ GH NR G++RLRK
Sbjct  442  PGNMHNALQAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVMNGHKNRQGQLRLRK  501

Query  657  PR*SL  671
             + S+
Sbjct  502  QKQSI  506



>ref|XP_007158370.1| hypothetical protein PHAVU_002G147300g [Phaseolus vulgaris]
 gb|ESW30364.1| hypothetical protein PHAVU_002G147300g [Phaseolus vulgaris]
Length=514

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 144/154 (94%), Gaps = 2/154 (1%)
 Frame = +2

Query  17   ASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEE  196
            ASK+ G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEE
Sbjct  287  ASKNAG--KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEE  344

Query  197  LRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLA  376
            LR QGRCP+TPEEVGLLLAALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLA
Sbjct  345  LRGQGRCPMTPEEVGLLLAALGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLA  404

Query  377  SSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            SS++R +IKGKASLLAA+DYYVG+HSDIFISASP
Sbjct  405  SSDQRAQIKGKASLLAALDYYVGLHSDIFISASP  438


 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  QR ++K K  L   L    + + + IF     P NMHNA+VGHRTY NLKTIRPNM
Sbjct  404  ASSDQRAQIKGKASLLAALDYY-VGLHSDIF-ISASPGNMHNALVGHRTYLNLKTIRPNM  461

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK + W EF DAV+EGH NR G++RLRKP+ S+
Sbjct  462  ALMGQLFLNKTIEWSEFHDAVVEGHQNRQGQVRLRKPKQSI  502



>gb|KHN14510.1| DUF246 domain-containing protein [Glycine soja]
Length=516

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  295  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCP  354

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            +TPEEVGLLLAA+GFDN+TRLYLASHKVYGG ARIS LR LFP ME+KKSLASSEER EI
Sbjct  355  MTPEEVGLLLAAMGFDNSTRLYLASHKVYGGEARISTLRELFPRMEDKKSLASSEERSEI  414

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            KGKASLLAA+DYYVG+HSDIFISASP
Sbjct  415  KGKASLLAALDYYVGLHSDIFISASP  440


 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 69/101 (68%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R E+K K  L   L    + + + IF     P NMHNA+VGHRTY NLKTIRPNM
Sbjct  406  ASSEERSEIKGKASLLAALDYY-VGLHSDIF-ISASPGNMHNALVGHRTYLNLKTIRPNM  463

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK + W EF DAV+EGH NR GE RLRKP+ S+
Sbjct  464  ALMGQLFLNKTIEWSEFQDAVVEGHQNRQGEPRLRKPKQSI  504



>gb|KJB18181.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=451

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 145/176 (82%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP ++ +                  PQKFV VHLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  267  RLRYPPTESQPLITDDLTGTTDRNVKQMPQKFVVVHLRFDKDMAAHSACDFGGGKAEKLA  326

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYG
Sbjct  327  LAKYRQRIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYG  386

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR  FP ME+KKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  387  GEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLAAVDYYVGMHSDIFVSASP  442



>gb|KCW54611.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=484

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  263  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCP  322

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGFDN TRLYLASHKVYGG ARIS LR++FPLME+KKSLAS++ER +I
Sbjct  323  LTPEEIGLLLAALGFDNTTRLYLASHKVYGGEARISMLRKMFPLMEDKKSLASADERAQI  382

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            KGKASLLAA+DYY+ MHSDIFISASP
Sbjct  383  KGKASLLAALDYYISMHSDIFISASP  408


 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 73/101 (72%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R ++K K  L   L    +S+ + IF     P NMHNA+VGHRTY N+KTIRP+M
Sbjct  374  ASADERAQIKGKASLLAALDYY-ISMHSDIF-ISASPGNMHNALVGHRTYENMKTIRPSM  431

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             LLGQLFLNKN++W EF +A+IEGH NR G+IRLRKP+ SL
Sbjct  432  ALLGQLFLNKNISWSEFQEAIIEGHKNRQGQIRLRKPKQSL  472



>ref|XP_002268599.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI38269.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 146/175 (83%), Gaps = 16/175 (9%)
 Frame = +2

Query  2    RLRYP-------------ASKDEGPQ---KFVAVHLRFDKDMAAHSACDFGGGKAEKLSL  133
            RLRYP              +  +G Q   KF  +HLRFDKDMAAHSACDFGGGKAEKL+L
Sbjct  260  RLRYPKKNGAFGTEYLQEVTDVKGEQEAGKFAVLHLRFDKDMAAHSACDFGGGKAEKLAL  319

Query  134  AKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGG  313
            AKYRQ  WQGRVLNSQFTDEELR+QGRCPLTPEE+GLLLAALGFDN TRLYLASHKVYGG
Sbjct  320  AKYRQTIWQGRVLNSQFTDEELRNQGRCPLTPEEIGLLLAALGFDNTTRLYLASHKVYGG  379

Query  314  AARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            AARIS LR LFPLME+KKSLASS+ER +IKGKASLLAAVDYYV MHSDIFISASP
Sbjct  380  AARISTLRELFPLMEDKKSLASSDERAQIKGKASLLAAVDYYVSMHSDIFISASP  434


 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLH-HPANMHNAMVGHRTYHNLKTIRPN  545
            AS  +R ++K K  L   L  +   V      F+   P NMHNA+VGHRTY NLKTIRPN
Sbjct  400  ASSDERAQIKGKASL---LAAVDYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPN  456

Query  546  MQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            M LLGQLFLNK++ W EF  AV+EGH NR G+IRLRK   SL
Sbjct  457  MALLGQLFLNKSIGWSEFQQAVVEGHENRQGQIRLRKSEQSL  498



>ref|XP_010027954.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW54610.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=505

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  284  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCP  343

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGFDN TRLYLASHKVYGG ARIS LR++FPLME+KKSLAS++ER +I
Sbjct  344  LTPEEIGLLLAALGFDNTTRLYLASHKVYGGEARISMLRKMFPLMEDKKSLASADERAQI  403

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            KGKASLLAA+DYY+ MHSDIFISASP
Sbjct  404  KGKASLLAALDYYISMHSDIFISASP  429


 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 73/101 (72%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R ++K K  L   L    +S+ + IF     P NMHNA+VGHRTY N+KTIRP+M
Sbjct  395  ASADERAQIKGKASLLAALDYY-ISMHSDIF-ISASPGNMHNALVGHRTYENMKTIRPSM  452

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             LLGQLFLNKN++W EF +A+IEGH NR G+IRLRKP+ SL
Sbjct  453  ALLGQLFLNKNISWSEFQEAIIEGHKNRQGQIRLRKPKQSL  493



>ref|XP_006285210.1| hypothetical protein CARUB_v10006569mg [Capsella rubella]
 gb|EOA18108.1| hypothetical protein CARUB_v10006569mg [Capsella rubella]
Length=521

 Score =   254 bits (649),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 140/176 (80%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    RLRYPASKDE-----------------GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP S                    G  KF  +HLRFDKDMAAHS CDF GGKAEKL+
Sbjct  269  RLRYPPSISRASGTMDPTDRINTIVKAGAGKFAVLHLRFDKDMAAHSGCDFEGGKAEKLA  328

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+ALGF NNTRLYLASH+VYG
Sbjct  329  LAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLSALGFSNNTRLYLASHQVYG  388

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR+LFP +ENKKSLAS+EE  +++GKASL+AAVDYYV M SDIFISASP
Sbjct  389  GEARISTLRKLFPGVENKKSLASAEELADVEGKASLMAAVDYYVSMKSDIFISASP  444


 Score = 88.2 bits (217),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HR Y NLKTIRPNM LLGQ+ +NK+L W EF  AV+ GH NR G++RLRK
Sbjct  444  PGNMHNALLAHRAYLNLKTIRPNMILLGQVLVNKSLDWSEFEGAVVNGHKNRHGQLRLRK  503

Query  657  PR*SL  671
             + S+
Sbjct  504  QKQSI  508



>gb|KGN62755.1| hypothetical protein Csa_2G370540 [Cucumis sativus]
Length=1445

 Score =   246 bits (627),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  41    KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
             KFV +HLRFDKDMAAHSAC+FGGGKAE+L+LAKYRQ+ WQGRV NSQFTDEELR QGRCP
Sbjct  1223  KFVVLHLRFDKDMAAHSACEFGGGKAERLALAKYRQVIWQGRVPNSQFTDEELRYQGRCP  1282

Query  221   LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
             LTPEE+GLLLAALGF N TR+YLA H+VYGG ARIS LR++FPL+E+KKSL S  ER  +
Sbjct  1283  LTPEEIGLLLAALGFSNTTRVYLAIHEVYGGEARISTLRKVFPLLEDKKSLTSPMERAGV  1342

Query  401   KGKASLLAAVDYYVGMHSDIFISASP  478
              GKASL AAVDYYV +HSD+FISASP
Sbjct  1343  AGKASLSAAVDYYVSLHSDVFISASP  1368


 Score = 96.3 bits (238),  Expect(2) = 5e-85, Method: Composition-based stats.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  477   PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
             P NMHNA++GHR Y N+KTIRPNM LLG LFLNK++ W EF  AV+ GH NR G+IRLRK
Sbjct  1368  PGNMHNALLGHRAYLNMKTIRPNMVLLGPLFLNKSMEWSEFKKAVLTGHRNRQGQIRLRK  1427



>gb|EEC84568.1| hypothetical protein OsI_31345 [Oryza sativa Indica Group]
Length=519

 Score =   251 bits (641),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            K+  +HLRFDKDMAAHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TDEELR+ GRCP
Sbjct  263  KYAVLHLRFDKDMAAHSACDFGGGRAERLALAKYRQVIWQGRVLNSQLTDEELRNLGRCP  322

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGFD+ TR+YLASHKVYGG ARIS+LR+LFPLME+K+SLAS EE   +
Sbjct  323  LTPEEIGLLLAALGFDSRTRIYLASHKVYGGEARISSLRKLFPLMEDKRSLASEEELTNV  382

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            +GKAS+LAA+DYY+ MHSDIFISASP
Sbjct  383  EGKASVLAALDYYISMHSDIFISASP  408


 Score = 90.1 bits (222),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HRT+ N+KTIRPNM LLG++F+NK++ W EF +AV  GH  R G+IRLRK
Sbjct  408  PGNMHNALMAHRTFENMKTIRPNMALLGRIFVNKSMEWLEFQEAVQAGHKGRYGQIRLRK  467

Query  657  PR*SL  671
            P+ S+
Sbjct  468  PKQSI  472



>ref|XP_008651492.1| PREDICTED: LOC100283829 isoform X1 [Zea mays]
 gb|ACF82519.1| unknown [Zea mays]
 tpg|DAA61414.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=447

 Score =   253 bits (647),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  38   QKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRC  217
            +K+  +HLRFDKDMAAHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TDEELR+ GRC
Sbjct  225  EKYAVLHLRFDKDMAAHSACDFGGGRAEQLALAKYRQVIWQGRVLNSQLTDEELRNTGRC  284

Query  218  PLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGE  397
            PLTPEE+GLLL ALGFDN TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS +E   
Sbjct  285  PLTPEEIGLLLVALGFDNRTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEDELAN  344

Query  398  IKGKASLLAAVDYYVGMHSDIFISASP  478
            ++GKAS+LAA+DYY+ MHSDIFISASP
Sbjct  345  VEGKASVLAALDYYISMHSDIFISASP  371


 Score = 88.2 bits (217),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+V HR+Y NLKTIRPNM LLG+ F NK++ WPEF   V  GH  R G+IRLRK
Sbjct  371  PGNMHNALVAHRSYENLKTIRPNMALLGRTFANKSMEWPEFQQVVQAGHKGRYGQIRLRK  430



>ref|NP_001063155.1| Os09g0412200 [Oryza sativa Japonica Group]
 dbj|BAD28369.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
 dbj|BAF25069.1| Os09g0412200 [Oryza sativa Japonica Group]
 dbj|BAG90088.1| unnamed protein product [Oryza sativa Japonica Group]
Length=512

 Score =   251 bits (642),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            K+  +HLRFDKDMAAHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TDEELR+ GRCP
Sbjct  291  KYAVLHLRFDKDMAAHSACDFGGGRAERLALAKYRQVIWQGRVLNSQLTDEELRNLGRCP  350

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGFD+ TR+YLASHKVYGG ARIS+LR+LFPLME+K+SLAS EE   +
Sbjct  351  LTPEEIGLLLAALGFDSRTRIYLASHKVYGGEARISSLRKLFPLMEDKRSLASEEELTNV  410

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            +GKAS+LAA+DYY+ MHSDIFISASP
Sbjct  411  EGKASVLAALDYYISMHSDIFISASP  436


 Score = 90.1 bits (222),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HRT+ N+KTIRPNM LLG++F+NK++ W EF +AV  GH  R G+IRLRK
Sbjct  436  PGNMHNALMAHRTFENMKTIRPNMALLGRIFVNKSMEWLEFQEAVQAGHKGRYGQIRLRK  495

Query  657  PR*SL  671
            P+ S+
Sbjct  496  PKQSI  500



>tpg|DAA61415.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=486

 Score =   253 bits (647),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  38   QKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRC  217
            +K+  +HLRFDKDMAAHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TDEELR+ GRC
Sbjct  254  EKYAVLHLRFDKDMAAHSACDFGGGRAEQLALAKYRQVIWQGRVLNSQLTDEELRNTGRC  313

Query  218  PLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGE  397
            PLTPEE+GLLL ALGFDN TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS +E   
Sbjct  314  PLTPEEIGLLLVALGFDNRTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEDELAN  373

Query  398  IKGKASLLAAVDYYVGMHSDIFISASP  478
            ++GKAS+LAA+DYY+ MHSDIFISASP
Sbjct  374  VEGKASVLAALDYYISMHSDIFISASP  400


 Score = 87.8 bits (216),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+V HR+Y NLKTIRPNM LLG+ F NK++ WPEF   V  GH  R G+IRLRK
Sbjct  400  PGNMHNALVAHRSYENLKTIRPNMALLGRTFANKSMEWPEFQQVVQAGHKGRYGQIRLRK  459



>ref|NP_001150199.1| LOC100283829 [Zea mays]
 gb|ACG38224.1| psRT17-1 like protein [Zea mays]
 tpg|DAA61416.1| TPA: psRT17-1 like protein [Zea mays]
Length=511

 Score =   253 bits (646),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  38   QKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRC  217
            +K+  +HLRFDKDMAAHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TDEELR+ GRC
Sbjct  289  EKYAVLHLRFDKDMAAHSACDFGGGRAEQLALAKYRQVIWQGRVLNSQLTDEELRNTGRC  348

Query  218  PLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGE  397
            PLTPEE+GLLL ALGFDN TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS +E   
Sbjct  349  PLTPEEIGLLLVALGFDNRTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEDELAN  408

Query  398  IKGKASLLAAVDYYVGMHSDIFISASP  478
            ++GKAS+LAA+DYY+ MHSDIFISASP
Sbjct  409  VEGKASVLAALDYYISMHSDIFISASP  435


 Score = 87.4 bits (215),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+V HR+Y NLKTIRPNM LLG+ F NK++ WPEF   V  GH  R G+IRLRK
Sbjct  435  PGNMHNALVAHRSYENLKTIRPNMALLGRTFANKSMEWPEFQQVVQAGHKGRYGQIRLRK  494



>ref|XP_003613050.1| DUF246 domain-containing protein [Medicago truncatula]
Length=282

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  61   KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCP  120

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            +TPEEVGLLLAALGFDN+TRLYLASHKVYGGAARIS L++LFPLME+KKSL    ER  I
Sbjct  121  MTPEEVGLLLAALGFDNSTRLYLASHKVYGGAARISTLKQLFPLMEDKKSLTLPFERALI  180

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            KGKASLLAA+DYY+ +HSDIFISASP
Sbjct  181  KGKASLLAALDYYISIHSDIFISASP  206


 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +3

Query  375  PLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNMQL  554
            P +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRTY NLKTIRPNM L
Sbjct  174  PFERALIKGKASLLAALDYY-ISIHSDIF-ISASPGNMHNALVGHRTYLNLKTIRPNMAL  231

Query  555  LGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            +GQLFLNK + W EF  AV+EGH +R G++RLRKP+ S+
Sbjct  232  MGQLFLNKTMEWSEFEHAVVEGHESRQGQLRLRKPKQSI  270



>ref|XP_006661225.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Oryza 
brachyantha]
Length=492

 Score =   248 bits (634),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            K+  +HLRFDKDMAAHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TD ELR+ GRCP
Sbjct  271  KYAVLHLRFDKDMAAHSACDFGGGRAERLALAKYRQVIWQGRVLNSQLTDVELRNTGRCP  330

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGFD+ TR+YLASHKVYGG ARI +LR+LFPLME+K+SLAS EE   +
Sbjct  331  LTPEEIGLLLAALGFDSRTRIYLASHKVYGGEARILSLRKLFPLMEDKRSLASEEELANV  390

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            +GKASLLAA+DYY+ MHSDIFISASP
Sbjct  391  EGKASLLAALDYYISMHSDIFISASP  416


 Score = 92.0 bits (227),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HRT+ NLKTIRPNM LLG++F+NK++ W EF +AV  GH  R G+IRLRK
Sbjct  416  PGNMHNALMAHRTFENLKTIRPNMALLGRIFVNKSMEWSEFQEAVQAGHKGRYGQIRLRK  475

Query  657  PR*SL  671
            P+ S+
Sbjct  476  PKQSI  480



>ref|XP_006394028.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
 gb|ESQ31314.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
Length=507

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  35   PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGR  214
            P KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGR
Sbjct  284  PGKFAVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGR  343

Query  215  CPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERG  394
            CPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASSEER 
Sbjct  344  CPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSEERA  403

Query  395  EIKGKASLLAAVDYYVGMHSDIFISASP  478
             IKGKASLLAA+DYYV MHSDIFISASP
Sbjct  404  RIKGKASLLAALDYYVSMHSDIFISASP  431


 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRT+ NLKTIRPNM
Sbjct  397  ASSEERARIKGKASLLAALDYY-VSMHSDIF-ISASPGNMHNALVGHRTFENLKTIRPNM  454

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK++TW +F  A+ EGH NR G+IRLRKP+ S+
Sbjct  455  ALIGQLFLNKSITWVDFQQALGEGHVNRQGQIRLRKPKQSI  495



>ref|XP_006394027.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
 gb|ESQ31313.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
Length=506

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  35   PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGR  214
            P KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGR
Sbjct  283  PGKFAVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGR  342

Query  215  CPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERG  394
            CPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASSEER 
Sbjct  343  CPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSEERA  402

Query  395  EIKGKASLLAAVDYYVGMHSDIFISASP  478
             IKGKASLLAA+DYYV MHSDIFISASP
Sbjct  403  RIKGKASLLAALDYYVSMHSDIFISASP  430


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRT+ NLKTIRPNM
Sbjct  396  ASSEERARIKGKASLLAALDYY-VSMHSDIF-ISASPGNMHNALVGHRTFENLKTIRPNM  453

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK++TW +F  A+ EGH NR G+IRLRKP+ S+
Sbjct  454  ALIGQLFLNKSITWVDFQQALGEGHVNRQGQIRLRKPKQSI  494



>ref|XP_002864958.1| hypothetical protein ARALYDRAFT_496780 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41217.1| hypothetical protein ARALYDRAFT_496780 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  23   KDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELR  202
            K + P KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR
Sbjct  277  KRQEPGKFAVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELR  336

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
            SQGRCPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASS
Sbjct  337  SQGRCPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASS  396

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            EER  IKGKASLLAA+DYYV MHSDIFISASP
Sbjct  397  EERARIKGKASLLAALDYYVSMHSDIFISASP  428


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRT+ NLKTIRPNM
Sbjct  394  ASSEERARIKGKASLLAALDYY-VSMHSDIF-ISASPGNMHNALVGHRTFENLKTIRPNM  451

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK++TW +F  A+ EGH NR G+IRLRKP+ S+
Sbjct  452  ALIGQLFLNKSITWVDFQQALGEGHVNRQGQIRLRKPKQSI  492



>ref|NP_201350.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAE99053.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED98060.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=504

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            + P KF  +HLRFDKDMAAHSACDFGGGKAEKLSLAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  279  QEPGKFAVLHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQMIWQGRVLNSQFTDEELRSQ  338

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEE
Sbjct  339  GRCPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEE  398

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAA+DYYV MHSDIFISASP
Sbjct  399  RARIKGKASLLAALDYYVSMHSDIFISASP  428


 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRT+ NLKTIRPNM
Sbjct  394  ASSEERARIKGKASLLAALDYY-VSMHSDIF-ISASPGNMHNALVGHRTFENLKTIRPNM  451

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK++TW +F  A+ EGH NR G+IRLRKP+ S+
Sbjct  452  ALIGQLFLNKSITWVDFQQALGEGHVNRQGQIRLRKPKQSI  492



>gb|AAM13166.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91219.1| unknown protein [Arabidopsis thaliana]
Length=504

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            + P KF  +HLRFDKDMAAHSACDFGGGKAEKLSLAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  279  QEPGKFAVLHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQMIWQGRVLNSQFTDEELRSQ  338

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEE
Sbjct  339  GRCPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPKMEDKRSLASSEE  398

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAA+DYYV MHSDIFISASP
Sbjct  399  RARIKGKASLLAALDYYVSMHSDIFISASP  428


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRT+ NLKTIRPNM
Sbjct  394  ASSEERARIKGKASLLAALDYY-VSMHSDIF-ISASPGNMHNALVGHRTFENLKTIRPNM  451

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK++TW +F  A+ EGH NR G+IRLRKP+ S+
Sbjct  452  ALIGQLFLNKSITWVDFQQALGEGHVNRQGQIRLRKPKQSI  492



>gb|EYU30935.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
Length=522

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 149/185 (81%), Gaps = 26/185 (14%)
 Frame = +2

Query  2    RLRYPASKDE---------------GPQKFVAVHLRFDK-----------DMAAHSACDF  103
            RLRYP+S+ +               G  KFV +HLRFDK           DMAAHSACDF
Sbjct  261  RLRYPSSRVDSTNYLKKVGDSNEKRGAGKFVVLHLRFDKVLSFLDNILTQDMAAHSACDF  320

Query  104  GGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRL  283
            GGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN TRL
Sbjct  321  GGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNTTRL  380

Query  284  YLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIF  463
            YLASHKVYGG ARISALR LFPLME+KKSLASSEER +IKGKASLLAAVD+YV +HSDIF
Sbjct  381  YLASHKVYGGEARISALRSLFPLMEDKKSLASSEERAQIKGKASLLAAVDHYVSIHSDIF  440

Query  464  ISASP  478
            +SASP
Sbjct  441  VSASP  445


 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 68/103 (66%), Gaps = 6/103 (6%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLIT--MSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRP  542
            AS  +R ++K K  L   L  +   +S+ + IF     P NMHNA+VGHRTY N KTIRP
Sbjct  411  ASSEERAQIKGKASL---LAAVDHYVSIHSDIF-VSASPGNMHNAVVGHRTYRNTKTIRP  466

Query  543  NMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            NM LLGQLFLNK+L W EF  AV+EGH +R G +RLRK   S+
Sbjct  467  NMALLGQLFLNKSLDWAEFEKAVVEGHKSRQGMLRLRKSEQSI  509



>dbj|BAB11569.1| unnamed protein product [Arabidopsis thaliana]
Length=523

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            + P KF  +HLRFDKDMAAHSACDFGGGKAEKLSLAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  298  QEPGKFAVLHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQMIWQGRVLNSQFTDEELRSQ  357

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEE
Sbjct  358  GRCPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEE  417

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAA+DYYV MHSDIFISASP
Sbjct  418  RARIKGKASLLAALDYYVSMHSDIFISASP  447


 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRT+ NLKTIRPNM
Sbjct  413  ASSEERARIKGKASLLAALDYY-VSMHSDIF-ISASPGNMHNALVGHRTFENLKTIRPNM  470

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK++TW +F  A+ EGH NR G+IRLRKP+ S+
Sbjct  471  ALIGQLFLNKSITWVDFQQALGEGHVNRQGQIRLRKPKQSI  511



>gb|AAB72114.1| PsRT17-1 [Pisum sativum]
Length=406

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 141/153 (92%), Gaps = 2/153 (1%)
 Frame = +2

Query  20   SKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL  199
            SK+ G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEEL
Sbjct  216  SKNAG--KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEEL  273

Query  200  RSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLAS  379
            RSQGRCP+TPEEVGLLLAALGFDN+TRLYLASHKVYGG ARI+ L++LFPLME+KKSL S
Sbjct  274  RSQGRCPMTPEEVGLLLAALGFDNSTRLYLASHKVYGGGARIATLKQLFPLMEDKKSLTS  333

Query  380  SEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
              ER +IKGKASLLAA+DYY+ +HSDIFISASP
Sbjct  334  PFERAQIKGKASLLAALDYYISIHSDIFISASP  366


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = +3

Query  372  SPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNMQ  551
            SP +R ++K K  L   L    +S+ + IF     P NMHNA+VGHRTY NLKTIRPNM 
Sbjct  333  SPFERAQIKGKASLLAALDYY-ISIHSDIF-ISASPGNMHNALVGHRTYLNLKTIRPNMA  390

Query  552  LLGQLFLNKNL  584
            L+GQLFLNK +
Sbjct  391  LMGQLFLNKTM  401



>ref|XP_010444520.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=507

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            + P KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  282  QEPGKFAVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQ  341

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEE
Sbjct  342  GRCPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEE  401

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAA+DYYV MHSDIFISASP
Sbjct  402  RARIKGKASLLAALDYYVSMHSDIFISASP  431


 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRT+ NLKTIRPNM
Sbjct  397  ASSEERARIKGKASLLAALDYY-VSMHSDIF-ISASPGNMHNALVGHRTFENLKTIRPNM  454

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK++TW +F  A+ EGH NR G+IRLRKP+ S+
Sbjct  455  ALIGQLFLNKSITWVDFQQALGEGHVNRQGQIRLRKPKQSI  495



>ref|XP_010463027.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=508

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            + P KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  283  QEPGKFAVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQ  342

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEE
Sbjct  343  GRCPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEE  402

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAA+DYYV MHSDIFISASP
Sbjct  403  RARIKGKASLLAALDYYVSMHSDIFISASP  432


 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRT+ NLKTIRPNM
Sbjct  398  ASSEERARIKGKASLLAALDYY-VSMHSDIF-ISASPGNMHNALVGHRTFENLKTIRPNM  455

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK++TW +F  A+ EGH NR G+IRLRKP+ S+
Sbjct  456  ALIGQLFLNKSITWVDFQQALGEGHVNRQGQIRLRKPKQSI  496



>ref|XP_006280335.1| hypothetical protein CARUB_v10026260mg [Capsella rubella]
 gb|EOA13233.1| hypothetical protein CARUB_v10026260mg [Capsella rubella]
Length=508

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            + P KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  283  QEPGKFAVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQ  342

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEE
Sbjct  343  GRCPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEE  402

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAA+DYYV MHSDIFISASP
Sbjct  403  RARIKGKASLLAALDYYVSMHSDIFISASP  432


 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRT+ NLKTIRPNM
Sbjct  398  ASSEERARIKGKASLLAALDYY-VSMHSDIF-ISASPGNMHNALVGHRTFENLKTIRPNM  455

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK++TW +F  A+ EGH NR G+IRLRKP+ S+
Sbjct  456  ALIGQLFLNKSITWADFQQALGEGHVNRQGQIRLRKPKQSI  496



>ref|XP_004956798.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=512

 Score =   249 bits (636),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            K+  +HLRFDKDMAAHS+CDFGGG+AEKL+LAKYR++ WQGRVLNSQ TDEELR+ GRCP
Sbjct  291  KYAVLHLRFDKDMAAHSSCDFGGGRAEKLALAKYRKVIWQGRVLNSQLTDEELRNTGRCP  350

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GL+L ALGFD+ TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS EE  ++
Sbjct  351  LTPEEIGLVLVALGFDSRTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEEELADV  410

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            +GKAS+LAA+DYY+ MHSDIFISASP
Sbjct  411  EGKASVLAALDYYISMHSDIFISASP  436


 Score = 90.1 bits (222),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HRTY NLKTIRPNM LLG++F+NK++ W +F  AV  GH  R G+IRLRK
Sbjct  436  PGNMHNALLAHRTYENLKTIRPNMALLGRIFVNKSMEWLDFQQAVQAGHKGRYGQIRLRK  495

Query  657  PR*SL  671
            P+ S+
Sbjct  496  PKQSI  500



>ref|XP_010484355.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=508

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            + P KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  283  QEPGKFAVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQ  342

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEE
Sbjct  343  GRCPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEE  402

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAA+DYYV MHSDIFISASP
Sbjct  403  RARIKGKASLLAALDYYVSMHSDIFISASP  432


 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRT+ NLKTIRPNM
Sbjct  398  ASSEERARIKGKASLLAALDYY-VSMHSDIF-ISASPGNMHNALVGHRTFENLKTIRPNM  455

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK++TW +F  A+ EGH NR G+IRLRKP+ S+
Sbjct  456  ALIGQLFLNKSITWVDFQQALGEGHVNRQGQIRLRKPKQSI  496



>ref|XP_006413418.1| hypothetical protein EUTSA_v10024936mg [Eutrema salsugineum]
 gb|ESQ54871.1| hypothetical protein EUTSA_v10024936mg [Eutrema salsugineum]
Length=518

 Score =   256 bits (653),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQG  211
            G  KF  +HLRFDKDMAAHS CDFGGGKAEKL+LAKYR++ WQGRVLNSQFTDEELR++G
Sbjct  293  GAGKFAVLHLRFDKDMAAHSGCDFGGGKAEKLALAKYREVIWQGRVLNSQFTDEELRNKG  352

Query  212  RCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEER  391
            RCPLTPEE+GLLL+ALGF NNTR+YLASH+VYGG ARIS LR+LFP+MENKKSLAS+EE 
Sbjct  353  RCPLTPEEIGLLLSALGFSNNTRIYLASHQVYGGEARISTLRKLFPVMENKKSLASAEEL  412

Query  392  GEIKGKASLLAAVDYYVGMHSDIFISASP  478
              ++G+ASL+AAVDYYV M SDIFISASP
Sbjct  413  AGVEGRASLMAAVDYYVSMKSDIFISASP  441


 Score = 83.2 bits (204),  Expect(2) = 4e-84, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF   V+ GH NR G++RLRK
Sbjct  441  PGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLEWSEFEGRVLNGHKNRQGQLRLRK  500

Query  657  PR*SL  671
             + S+
Sbjct  501  QKQSI  505



>ref|XP_008802622.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Phoenix 
dactylifera]
Length=495

 Score =   270 bits (689),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 146/173 (84%), Gaps = 14/173 (8%)
 Frame = +2

Query  2    RLRYPAS--KDEGPQ------------KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAK  139
            RLRYP S   DE  Q            KFV +HLRFDKDMAAHSACDFGGGKAE+L+LAK
Sbjct  307  RLRYPVSVHSDEYIQEVVDENVPVASGKFVVLHLRFDKDMAAHSACDFGGGKAERLALAK  366

Query  140  YRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAA  319
            YRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFD+ TRLYLASHKVYGG A
Sbjct  367  YRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDSKTRLYLASHKVYGGEA  426

Query  320  RISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            RIS+LR+LFPLME+KKSL S EE  +++GKASLLAAVDYYV MHSD+FISASP
Sbjct  427  RISSLRKLFPLMEDKKSLTSEEELAKVEGKASLLAAVDYYVSMHSDVFISASP  479



>ref|XP_009150636.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
 emb|CDY08790.1| BnaA06g24340D [Brassica napus]
Length=503

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            + P KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  278  QEPGKFAVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQ  337

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASS E
Sbjct  338  GRCPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSAE  397

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAA+DYYV MHSDIFISASP
Sbjct  398  RARIKGKASLLAALDYYVSMHSDIFISASP  427


 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRT+ NLKTIRPNM
Sbjct  393  ASSAERARIKGKASLLAALDYY-VSMHSDIF-ISASPGNMHNALVGHRTFENLKTIRPNM  450

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK++TW +F  A+ EGH NR G+IRLRKP+ S+
Sbjct  451  ALIGQLFLNKSITWVDFQQALGEGHVNRQGQIRLRKPKQSI  491



>emb|CDY14569.1| BnaC03g48900D [Brassica napus]
Length=503

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            + P KF  +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQ
Sbjct  278  QEPGKFAVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQ  337

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASS E
Sbjct  338  GRCPLTPEEMGLLLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSAE  397

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            R  IKGKASLLAA+DYYV MHSDIFISASP
Sbjct  398  RARIKGKASLLAALDYYVSMHSDIFISASP  427


 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRT+ NLKTIRPNM
Sbjct  393  ASSAERARIKGKASLLAALDYY-VSMHSDIF-ISASPGNMHNALVGHRTFENLKTIRPNM  450

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK++TW +F  A+ EGH NR G+IRLRKP+ S+
Sbjct  451  ALIGQLFLNKSITWVDFQQALGEGHVNRQGQIRLRKPKQSI  491



>dbj|BAK06980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   245 bits (626),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  38   QKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRC  217
            +K+  VHLRFDKDMAAHSACDFGGG+AEKL+LAKYRQ+ WQGRVLNSQ +DEELR+ GRC
Sbjct  290  EKYAVVHLRFDKDMAAHSACDFGGGRAEKLALAKYRQVIWQGRVLNSQLSDEELRNTGRC  349

Query  218  PLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGE  397
            PLTPEE+GL+L ALGFD+ TR YLASHKVYGG ARIS+LR+LFPLM +K+SLAS++E   
Sbjct  350  PLTPEEIGLILVALGFDSKTRFYLASHKVYGGEARISSLRKLFPLMVDKRSLASADELAS  409

Query  398  IKGKASLLAAVDYYVGMHSDIFISASP  478
            I+GKAS+LAA+DY++ MHSD+FISASP
Sbjct  410  IEGKASVLAALDYHISMHSDVFISASP  436


 Score = 91.7 bits (226),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HRTY NLKTIRPNM LLG +F+NK++ W EF  AV  GH  R G+IRLRK
Sbjct  436  PGNMHNALLAHRTYRNLKTIRPNMTLLGHIFVNKSMEWSEFQQAVQAGHKGRYGQIRLRK  495

Query  657  PR*SL  671
            P+ S+
Sbjct  496  PKQSI  500



>gb|KCW54609.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=506

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 139/147 (95%), Gaps = 1/147 (1%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  284  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCP  343

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHK-VYGGAARISALRRLFPLMENKKSLASSEERGE  397
            LTPEE+GLLLAALGFDN TRLYLASHK VYGG ARIS LR++FPLME+KKSLAS++ER +
Sbjct  344  LTPEEIGLLLAALGFDNTTRLYLASHKVVYGGEARISMLRKMFPLMEDKKSLASADERAQ  403

Query  398  IKGKASLLAAVDYYVGMHSDIFISASP  478
            IKGKASLLAA+DYY+ MHSDIFISASP
Sbjct  404  IKGKASLLAALDYYISMHSDIFISASP  430


 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 73/101 (72%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R ++K K  L   L    +S+ + IF     P NMHNA+VGHRTY N+KTIRP+M
Sbjct  396  ASADERAQIKGKASLLAALDYY-ISMHSDIF-ISASPGNMHNALVGHRTYENMKTIRPSM  453

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             LLGQLFLNKN++W EF +A+IEGH NR G+IRLRKP+ SL
Sbjct  454  ALLGQLFLNKNISWSEFQEAIIEGHKNRQGQIRLRKPKQSL  494



>ref|XP_004509777.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=501

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  280  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCP  339

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            +TPEEVGLLLAA+GFDN+T LYLASHKVYGG ARIS LR+LFPLME+KK+LASS ER +I
Sbjct  340  MTPEEVGLLLAAMGFDNSTHLYLASHKVYGGGARISTLRQLFPLMEDKKTLASSFERAQI  399

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            KGKASLLAA+DYY+ +HSDIFISASP
Sbjct  400  KGKASLLAALDYYISVHSDIFISASP  425


 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  +R ++K K  L   L    +SV + IF     P NMHNA+VGHRTY NLKTIRPNM
Sbjct  391  ASSFERAQIKGKASLLAALDYY-ISVHSDIF-ISASPGNMHNALVGHRTYLNLKTIRPNM  448

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK + W EF  AV+EGH NR G++RLRKP+ S+
Sbjct  449  ALMGQLFLNKTMEWSEFEHAVVEGHENRQGQLRLRKPKQSI  489



>ref|XP_002462371.1| hypothetical protein SORBIDRAFT_02g024540 [Sorghum bicolor]
 gb|EER98892.1| hypothetical protein SORBIDRAFT_02g024540 [Sorghum bicolor]
Length=511

 Score =   250 bits (639),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  38   QKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRC  217
            QK+  +HLRFDKDMAAHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TD ELR+ GRC
Sbjct  289  QKYAVLHLRFDKDMAAHSACDFGGGRAEQLALAKYRQVIWQGRVLNSQLTDRELRNTGRC  348

Query  218  PLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGE  397
            PLTPEE+GLLL ALGFD+ TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS +E   
Sbjct  349  PLTPEEIGLLLVALGFDSKTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEDELAN  408

Query  398  IKGKASLLAAVDYYVGMHSDIFISASP  478
            ++GKAS+LAA+DYY+ MHSDIFISASP
Sbjct  409  VEGKASVLAALDYYISMHSDIFISASP  435


 Score = 86.3 bits (212),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HRTY NLKTIRPNM LLG++F+NK++ W EF   V  GH  R G+IRLRK
Sbjct  435  PGNMHNALMAHRTYENLKTIRPNMALLGRIFVNKSMEWQEFQQVVQAGHKGRYGQIRLRK  494



>gb|EPS72903.1| hypothetical protein M569_01846, partial [Genlisea aurea]
Length=497

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 146/184 (79%), Gaps = 7/184 (4%)
 Frame = +2

Query  20   SKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL  199
            +++ G  KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ  WQGRVLNSQFTDEEL
Sbjct  270  NENAGSGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQTIWQGRVLNSQFTDEEL  329

Query  200  RSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLAS  379
            RSQGRCPLTPEE+GLLLAALGFDN TRLYLASHKVYGG ARIS LR LFPLME+KKSL +
Sbjct  330  RSQGRCPLTPEEIGLLLAALGFDNTTRLYLASHKVYGGEARISTLRSLFPLMEDKKSLTT  389

Query  380  SEERGEIKGKASLLAAVDYYVGMHSDIFISASPRKYAQRNGGTSNVP*LEDHKAQHATPR  559
             EE   IKGKASLLAAVDYYV M SDIFISASP        G      LE+ K    T R
Sbjct  390  EEELSRIKGKASLLAAVDYYVSMQSDIFISASPGNMHNALVGHRT---LENKK----TIR  442

Query  560  PTLP  571
            P +P
Sbjct  443  PNMP  446


 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+VGHRT  N KTIRPNM LLGQLFLNK+LTW EF D+V  GH +R G++R RK
Sbjct  422  PGNMHNALVGHRTLENKKTIRPNMPLLGQLFLNKSLTWSEFRDSVFVGHKSRQGQLRFRK  481

Query  657  PR*SL  671
            P+ SL
Sbjct  482  PQQSL  486



>dbj|BAE71212.1| hypothetical protein [Trifolium pratense]
Length=404

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  17   ASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEE  196
            A  ++   KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEE
Sbjct  175  ADDNKNAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEE  234

Query  197  LRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLA  376
            LRSQGRCP+TPEEVGLLLAALGFDN+TRLYLASHKVYGG ARI+ L+ LFPLME+KKSL 
Sbjct  235  LRSQGRCPMTPEEVGLLLAALGFDNSTRLYLASHKVYGGGARIATLKELFPLMEDKKSLT  294

Query  377  SSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            S  ER  IKGKASLLAA+DYY+ MHSDIFISASP
Sbjct  295  SPFERTLIKGKASLLAALDYYISMHSDIFISASP  328


 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 69/100 (69%), Gaps = 2/100 (2%)
 Frame = +3

Query  372  SPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNMQ  551
            SP +R  +K K  L   L    +S+ + IF     P NMHNA+VGHR+Y NLKTIRPNMQ
Sbjct  295  SPFERTLIKGKASLLAALDYY-ISMHSDIF-ISASPGNMHNALVGHRSYLNLKTIRPNMQ  352

Query  552  LLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            L+GQLFLNK + W EF  AV+EGH  R G++RLRKP+ S+
Sbjct  353  LMGQLFLNKTMEWSEFEHAVVEGHETRQGQLRLRKPKQSI  392



>ref|XP_010664406.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Vitis 
vinifera]
Length=446

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQ  208
            +G  KFV +HLRFDKDMAAHSACDFGGGKAEK++LAKYRQ+ WQGRVL SQFTDEELR+Q
Sbjct  290  QGAGKFVVLHLRFDKDMAAHSACDFGGGKAEKMALAKYRQVIWQGRVLKSQFTDEELRNQ  349

Query  209  GRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEE  388
            GRCPLTPEE+GLLLAALGF N TRLYLASHKVYGG ARIS LR+LFPLME+KKSLAS+EE
Sbjct  350  GRCPLTPEEIGLLLAALGFSNTTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASAEE  409

Query  389  RGEIKGKASLLAAVDYYVGMHSDIFISASP  478
              +++GKASLLAAVDYYV MHSDIFISASP
Sbjct  410  LAKVEGKASLLAAVDYYVSMHSDIFISASP  439



>ref|XP_007136338.1| hypothetical protein PHAVU_009G0371000g, partial [Phaseolus vulgaris]
 gb|ESW08332.1| hypothetical protein PHAVU_009G0371000g, partial [Phaseolus vulgaris]
Length=449

 Score =   266 bits (679),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  297  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRSQGRCP  356

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++
Sbjct  357  LTPEEIGLLLAALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEELAKV  416

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            KGKASLLA+VDYYV MHSDIFISASP
Sbjct  417  KGKASLLASVDYYVSMHSDIFISASP  442



>gb|EMT16885.1| hypothetical protein F775_06176 [Aegilops tauschii]
Length=511

 Score =   244 bits (623),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
             +  +HLRFDKDMAAHSACDFGGG+AEKL+LAKYRQ+ WQGRVLNSQ +DEELR+ GRCP
Sbjct  290  NYAVLHLRFDKDMAAHSACDFGGGRAEKLALAKYRQVIWQGRVLNSQLSDEELRNTGRCP  349

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GL+L ALGFD+ TR YLASHKVYGG ARIS+LR+LFPLME+K+SLAS++E   +
Sbjct  350  LTPEEIGLILVALGFDSTTRFYLASHKVYGGEARISSLRKLFPLMEDKRSLASADELANV  409

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            +GKAS+LAA+DY++ MHSD+FISASP
Sbjct  410  EGKASVLAALDYHISMHSDVFISASP  435


 Score = 90.1 bits (222),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HR Y NLKTIRPNM LLG +F+NK++ W EF  AV  GH  R G+IRLRK
Sbjct  435  PGNMHNALLAHRAYRNLKTIRPNMTLLGHIFVNKSMEWSEFQQAVQAGHKGRYGQIRLRK  494

Query  657  PR*SL  671
            P+ S+
Sbjct  495  PKQSI  499



>ref|XP_003613049.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES96007.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=503

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  282  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCP  341

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            +TPEEVGLLLAALGFDN+TRLYLASHKVYGGAARIS L++LFPLME+KKSL    ER  I
Sbjct  342  MTPEEVGLLLAALGFDNSTRLYLASHKVYGGAARISTLKQLFPLMEDKKSLTLPFERALI  401

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            KGKASLLAA+DYY+ +HSDIFISASP
Sbjct  402  KGKASLLAALDYYISIHSDIFISASP  427


 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 68/99 (69%), Gaps = 2/99 (2%)
 Frame = +3

Query  375  PLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNMQL  554
            P +R  +K K  L   L    +S+ + IF     P NMHNA+VGHRTY NLKTIRPNM L
Sbjct  395  PFERALIKGKASLLAALDYY-ISIHSDIF-ISASPGNMHNALVGHRTYLNLKTIRPNMAL  452

Query  555  LGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            +GQLFLNK + W EF  AV+EGH +R G++RLRKP+ S+
Sbjct  453  MGQLFLNKTMEWSEFEHAVVEGHESRQGQLRLRKPKQSI  491



>ref|XP_003578106.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=512

 Score =   247 bits (631),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            K+  +HLRFDKDMAAHSAC+FGGG+AEKL+LAKYRQ+ WQGRVLNSQ +DEELR+ GRCP
Sbjct  291  KYAVLHLRFDKDMAAHSACEFGGGRAEKLALAKYRQVIWQGRVLNSQLSDEELRNTGRCP  350

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE GLL+AALGFDN+TRLYLASHKVYGG ARIS+LR+LFPLM +K+SLAS EE   +
Sbjct  351  LTPEETGLLMAALGFDNSTRLYLASHKVYGGEARISSLRKLFPLMVDKRSLASEEELANV  410

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
            +GKAS+LAA+DYY+ +HSDIFISASP
Sbjct  411  QGKASVLAALDYYISIHSDIFISASP  436


 Score = 82.8 bits (203),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++  R Y+N+KTI+PNM LLG +F+NK+  W EF  AV  GH  R G+IRLRK
Sbjct  436  PGNMHNAVMAQRAYNNMKTIKPNMALLGHIFVNKSNEWSEFQQAVQAGHKGRYGQIRLRK  495

Query  657  PR*SL  671
            P+ S+
Sbjct  496  PKQSI  500



>ref|XP_009376221.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Pyrus x bretschneideri]
Length=520

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 146/175 (83%), Gaps = 16/175 (9%)
 Frame = +2

Query  2    RLRYPASKD----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSL  133
            RLRYP +++                +G  K+V +HLRFDKDMAAHSACDFGGGKAEKL+L
Sbjct  270  RLRYPPNRNPKAGSDSQDKANEIEKQGAGKYVVLHLRFDKDMAAHSACDFGGGKAEKLAL  329

Query  134  AKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGG  313
            AKYRQ+ WQGRVL SQFTDE+LR+QGRCPLTPEE+GLLLAALGF+N TRLYLAS+KVYGG
Sbjct  330  AKYRQVIWQGRVLKSQFTDEDLRNQGRCPLTPEEIGLLLAALGFNNTTRLYLASYKVYGG  389

Query  314  AARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
             ARIS LRRLFP ME+KKSLAS+EER +++GKASLLAAVDYYV M SDIFISASP
Sbjct  390  EARISTLRRLFPDMEDKKSLASAEERAKVEGKASLLAAVDYYVSMQSDIFISASP  444


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLH-HPANMHNAMVGHRTYHNLKTIRPN  545
            AS  +R +V+ K  L   L  +   V      F+   P NMHNA+VGHR Y NLKTIRPN
Sbjct  410  ASAEERAKVEGKASL---LAAVDYYVSMQSDIFISASPGNMHNALVGHRAYMNLKTIRPN  466

Query  546  MQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            M LLG+LF+NK++ W +F  AV +GH  R G++RLRK + S+
Sbjct  467  MALLGKLFVNKSMEWSDFQRAVSDGHKTRXGQMRLRKEKQSI  508



>gb|KHN09000.1| DUF246 domain-containing protein [Glycine soja]
Length=510

 Score =   262 bits (670),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 146/178 (82%), Gaps = 11/178 (6%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR+QGRCP
Sbjct  289  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRNQGRCP  348

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++
Sbjct  349  LTPEEIGLLLAALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEEMAKV  408

Query  401  KGKASLLAAVDYYVGMHSDIFISASPRKYAQRNGGTSNVP*LEDHKA--QHATPRPTL  568
            KGKASLLAAVDYYV M SDIFISASP       G   N   LE H+A     T RP +
Sbjct  409  KGKASLLAAVDYYVSMQSDIFISASP-------GNMHNA--LEAHRAYMNLKTIRPNM  457


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+  HR Y NLKTIRPNM+LLGQLF NK++ W EF  AV++GH NR G+IRLRK
Sbjct  434  PGNMHNALEAHRAYMNLKTIRPNMRLLGQLFQNKSIGWSEFQLAVLDGHKNRQGQIRLRK  493



>ref|XP_003526543.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score =   262 bits (670),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 153/203 (75%), Gaps = 23/203 (11%)
 Frame = +2

Query  2    RLRYPASKDEGPQ------------KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYR  145
            RLR+P   ++ P             KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYR
Sbjct  265  RLRHPTEGNDYPLEETDKFGKQQTGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYR  324

Query  146  QIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARI  325
            Q+ WQGRVLNSQFTDEELR+QGRCPLTPEE+GLLLAAL F+N TRLYLASHKVYGG AR+
Sbjct  325  QVLWQGRVLNSQFTDEELRNQGRCPLTPEEIGLLLAALSFNNRTRLYLASHKVYGGEARL  384

Query  326  SALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASPRKYAQRNGG  505
            + L +LFPLME+KKSL S+EE  ++KGKASLLAAVDYYV M SDIFISASP       G 
Sbjct  385  ATLSKLFPLMEDKKSLVSTEEMAKVKGKASLLAAVDYYVSMQSDIFISASP-------GN  437

Query  506  TSNVP*LEDHKA--QHATPRPTL  568
              N   LE H+A     T RP +
Sbjct  438  MHNA--LEAHRAYMNLKTIRPNM  458


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA+  HR Y NLKTIRPNM+LLGQLF NK++ W EF  AV++GH NR G+IRLRK
Sbjct  435  PGNMHNALEAHRAYMNLKTIRPNMRLLGQLFQNKSIGWSEFQLAVLDGHKNRQGQIRLRK  494



>gb|EMS64135.1| hypothetical protein TRIUR3_23110 [Triticum urartu]
Length=493

 Score =   236 bits (603),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 133/161 (83%), Gaps = 15/161 (9%)
 Frame = +2

Query  41   KFVAVHLRFDK---------------DMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLN  175
            K+  +HLRFDK               DMAAHSACDFGGG+AEKL+LAKYRQ+ WQGRVLN
Sbjct  257  KYAVLHLRFDKGIATLKHLKLTYIFQDMAAHSACDFGGGRAEKLALAKYRQVIWQGRVLN  316

Query  176  SQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
            SQ +DEELR+ GRCPLTPEE+GL+L ALGFD+ TR YLASHKVYGG ARIS+LR+LFPLM
Sbjct  317  SQLSDEELRNTGRCPLTPEEIGLILVALGFDSTTRFYLASHKVYGGEARISSLRKLFPLM  376

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            E+K+SLAS++E   ++GKAS+LAA+DY++ MHSD+FISASP
Sbjct  377  EDKRSLASADELANVEGKASVLAALDYHISMHSDVFISASP  417


 Score = 88.2 bits (217),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  477  PANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            P NMHNA++ HR Y N KTIRPNM LLG +F NK++ W EF  AV  GH  R G+IRLRK
Sbjct  417  PGNMHNALLAHRAYRNFKTIRPNMTLLGHIFANKSMEWSEFQQAVQAGHKGRYGQIRLRK  476

Query  657  PR*SL  671
            P+ S+
Sbjct  477  PKQSI  481



>gb|KJB48896.1| hypothetical protein B456_008G092600, partial [Gossypium raimondii]
Length=495

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 135/176 (77%), Gaps = 27/176 (15%)
 Frame = +2

Query  2    RLRYPASKDEG-----------------PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP  + E                  PQKFV +HLRFDKD AAHSACDFGG       
Sbjct  220  RLRYPPGETEALSSDYLRVTTDQNDKQRPQKFVVLHLRFDKDTAAHSACDFGG-------  272

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
               YRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLAALGFDN+TRLYLASHKVYG
Sbjct  273  ---YRQTIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLAALGFDNSTRLYLASHKVYG  329

Query  311  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            G ARIS LR LFPLMENKKSLASSEER  IKGKASLLAAVDYYVGMHSDIF+SASP
Sbjct  330  GEARISTLRELFPLMENKKSLASSEERARIKGKASLLAAVDYYVGMHSDIFVSASP  385


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 49/99 (49%), Gaps = 34/99 (34%)
 Frame = +3

Query  477  PANMHNAMVG----HRTYHNLKTI------------------------------RPNMQL  554
            P NMHNA+ G    +R +H   T+                                +M L
Sbjct  385  PGNMHNALPGITYRYRAFHFAATVPKVYMWKISNNYVQLQCFYNFFLFPSASVNEHDMAL  444

Query  555  LGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
            LGQLFLNKN+TW EF  AV EGH NR G+++LRKP+ S+
Sbjct  445  LGQLFLNKNITWLEFRQAVAEGHQNRQGQLKLRKPKQSI  483



>ref|XP_008444924.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=515

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 139/174 (80%), Gaps = 15/174 (9%)
 Frame = +2

Query  2    RLRYPASKDEGPQ---------------KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLA  136
            RLRYP+++ E  +               KFV +HLRFDKDMAAHSAC+FGGGKAE+L+LA
Sbjct  265  RLRYPSNQKETERVESLLEDEKRKLEGGKFVVLHLRFDKDMAAHSACEFGGGKAERLALA  324

Query  137  KYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGA  316
            KYRQ+ WQGRV NSQFTDEELR QGRCPLTPEE+GL+LAALGF N TR+YLA H+VYGG 
Sbjct  325  KYRQVIWQGRVPNSQFTDEELRYQGRCPLTPEEIGLVLAALGFSNTTRVYLAIHEVYGGE  384

Query  317  ARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            ARIS LR++FPL+E+KKSL S  ER  + GKASL AAVDYYV +HSD+FISASP
Sbjct  385  ARISTLRKVFPLLEDKKSLTSPMERAGVAGKASLSAAVDYYVSLHSDVFISASP  438


 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 67/101 (66%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
             SP++R  V  K  L   +    +S+ + +F     P NMHNA+VGHR Y N+KTIRPNM
Sbjct  404  TSPMERAGVAGKASLSAAVDYY-VSLHSDVF-ISASPGNMHNALVGHRAYLNMKTIRPNM  461

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             LLGQLFLNK++ W EF  AV+ GH NR G+IRLRK + S+
Sbjct  462  VLLGQLFLNKSMEWSEFKKAVLTGHRNRQGQIRLRKEKQSI  502



>ref|XP_004152738.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004163454.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=515

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSAC+FGGGKAE+L+LAKYRQ+ WQGRV NSQFTDEELR QGRCP
Sbjct  293  KFVVLHLRFDKDMAAHSACEFGGGKAERLALAKYRQVIWQGRVPNSQFTDEELRYQGRCP  352

Query  221  LTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEI  400
            LTPEE+GLLLAALGF N TR+YLA H+VYGG ARIS LR++FPL+E+KKSL S  ER  +
Sbjct  353  LTPEEIGLLLAALGFSNTTRVYLAIHEVYGGEARISTLRKVFPLLEDKKSLTSPMERAGV  412

Query  401  KGKASLLAAVDYYVGMHSDIFISASP  478
             GKASL AAVDYYV +HSD+FISASP
Sbjct  413  AGKASLSAAVDYYVSLHSDVFISASP  438


 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = +3

Query  372  SPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNMQ  551
            SP++R  V  K  L   +    +S+ + +F     P NMHNA++GHR Y N+KTIRPNM 
Sbjct  405  SPMERAGVAGKASLSAAVDYY-VSLHSDVF-ISASPGNMHNALLGHRAYLNMKTIRPNMV  462

Query  552  LLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRK  656
            LLG LFLNK++ W EF  AV+ GH NR G+IRLRK
Sbjct  463  LLGPLFLNKSMEWSEFKKAVLTGHRNRQGQIRLRK  497



>gb|AGV54211.1| O-fucosyltransferase family protein [Phaseolus vulgaris]
Length=511

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 129/140 (92%), Gaps = 1/140 (1%)
 Frame = +2

Query  59   LRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEV  238
            LR DK +  H +CDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR QGRCP+TPEEV
Sbjct  297  LRLDK-IWQHISCDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRGQGRCPMTPEEV  355

Query  239  GLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASL  418
            GLLLAALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASS++R +IKGKASL
Sbjct  356  GLLLAALGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASSDQRAQIKGKASL  415

Query  419  LAAVDYYVGMHSDIFISASP  478
            LAA+DYYVG+HSDIFISASP
Sbjct  416  LAALDYYVGLHSDIFISASP  435


 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 70/101 (69%), Gaps = 2/101 (2%)
 Frame = +3

Query  369  ASPLQRKEVKLKERLPY*LQLITMSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNM  548
            AS  QR ++K K  L   L    + + + IF     P NMHNA+VGHRTY NLKTIRPNM
Sbjct  401  ASSDQRAQIKGKASLLAALDYY-VGLHSDIF-ISASPGNMHNALVGHRTYLNLKTIRPNM  458

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             L+GQLFLNK + W EF DAV+EGH NR G++RLRKP+ S+
Sbjct  459  ALMGQLFLNKTIEWSEFHDAVVEGHQNRQGQVRLRKPKQSI  499



>ref|XP_001777077.1| predicted protein [Physcomitrella patens]
 gb|EDQ58070.1| predicted protein, partial [Physcomitrella patens]
Length=437

 Score =   206 bits (525),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +2

Query  26   DEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRS  205
            D G  K++A+HLRFDKDMAAHSACDFGGGKAE+L+LAKYR + WQGRV N+Q +D+ELR 
Sbjct  192  DVGSSKYLALHLRFDKDMAAHSACDFGGGKAERLALAKYRGVVWQGRVSNAQLSDKELRD  251

Query  206  QGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSE  385
            +G+CP++PEEVG++L ALGF   T +YLAS+ VYGG+AR+  L  LFP M  K +LA++E
Sbjct  252  KGKCPMSPEEVGIMLVALGFSPKTHVYLASYTVYGGSARMDFLHNLFPNMVTKYTLATAE  311

Query  386  ERGEIKGKASLLAAVDYYVGMHSDIFISAS  475
            E     GKAS LAA+DY V +HSDIF+SAS
Sbjct  312  ELAPFAGKASQLAAIDYLVSLHSDIFLSAS  341


 Score = 80.9 bits (198),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 50/64 (78%), Gaps = 1/64 (2%)
 Frame = +3

Query  483  NMHNAMVGHRTYHNL-KTIRPNMQLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKP  659
            NMHN++  HRTY N+ KTI+P+M L+ +LF +KNLTWPEF  +V+EGH NR G++ LR+P
Sbjct  344  NMHNSLAAHRTYLNVRKTIKPDMNLMARLFAHKNLTWPEFRRSVVEGHKNRMGQVALRQP  403

Query  660  R*SL  671
              S+
Sbjct  404  TQSI  407



>ref|XP_010312650.1| PREDICTED: uncharacterized protein At1g04910 isoform X4 [Solanum 
lycopersicum]
Length=468

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 117/145 (81%), Gaps = 17/145 (12%)
 Frame = +2

Query  2    RLRYPASKD-----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLR+P S+D                 +G  KF  +HLRFDKDMAAHSACDFGGGKAE L+
Sbjct  255  RLRFPPSEDNMVSNNYLREVTDLKPKQGVGKFAVLHLRFDKDMAAHSACDFGGGKAENLA  314

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG
Sbjct  315  LAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  374

Query  311  GAARISALRRLFPLMENKKSLASSE  385
            G  R+SALR LFPLME+KKSLASSE
Sbjct  375  GERRVSALRSLFPLMEDKKSLASSE  399


 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  438  MSVCTAIFSFLHHPANMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFXDAVIE  617
            +S   ++F  +    ++ ++ VG RTY+N+KTIRPNM LLGQLFLNK LTWPEF ++VIE
Sbjct  379  VSALRSLFPLMEDKKSLASSEVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVIE  438

Query  618  GHANRPGEIRLRKPR*SL  671
            GH NR G+IRLRKP+ SL
Sbjct  439  GHQNRQGQIRLRKPKQSL  456



>ref|XP_002967262.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
 gb|EFJ31861.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
Length=476

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ  181
            RLR  A  D  P KFVA+HLRFDKDMAAHSACDFGGG+ E+L+LA YR   WQGRV NS+
Sbjct  235  RLRQ-AQNDSPPSKFVALHLRFDKDMAAHSACDFGGGRVEQLALAYYRHKVWQGRVPNSR  293

Query  182  FTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMEN  361
             T ++LR  G+CPLTPEE GL LAALGF  +TR+YLASH++YGG AR+S L+ +FPLM++
Sbjct  294  LTVQQLRLLGKCPLTPEEAGLTLAALGFGPHTRVYLASHQIYGGEARLSFLKNIFPLMQD  353

Query  362  KKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            K SLA   E    + KASL AA+DYYV + SD F+SASP
Sbjct  354  KASLAIDAELRPFERKASLSAALDYYVCLKSDFFLSASP  392


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 62/101 (61%), Gaps = 10/101 (10%)
 Frame = +3

Query  375  PLQRKEVKLKERLPY*LQLITMSVCTAIFSFLH-HPANMHNAMVGHRTYHNL-KTIRPNM  548
            P +RK   L   L Y        VC     FL   P NMHNA++GHRTY N+ KT+RP+M
Sbjct  365  PFERK-ASLSAALDY-------YVCLKSDFFLSASPGNMHNAVIGHRTYQNVQKTLRPDM  416

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             LL +LF N ++ WPEF + V  GH NR G++RLR+P+ S+
Sbjct  417  VLLSRLFSNSSMEWPEFQNRVYNGHRNRLGQVRLRQPKQSI  457



>ref|XP_002960458.1| hypothetical protein SELMODRAFT_75338 [Selaginella moellendorffii]
 gb|EFJ37997.1| hypothetical protein SELMODRAFT_75338 [Selaginella moellendorffii]
Length=464

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ  181
            RLR  A  D  P KFVA+HLRFDKDMAAHSACDFGGG+ E+L+LA YR   WQGRV NS+
Sbjct  223  RLRQ-AQNDSPPSKFVALHLRFDKDMAAHSACDFGGGRVEQLALAYYRHKVWQGRVPNSR  281

Query  182  FTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMEN  361
             T ++LR  G+CPLTPEE GL LAALGF  +TR+YLASH++YGG AR+S L+ +FPLM++
Sbjct  282  LTVQQLRLLGKCPLTPEEAGLTLAALGFGPHTRVYLASHQIYGGEARLSFLKNIFPLMQD  341

Query  362  KKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASP  478
            K S+A  +E    + KASL AA+DYYV + SD F+SASP
Sbjct  342  KASVAIDDELRPFERKASLSAALDYYVCLKSDFFLSASP  380


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 62/101 (61%), Gaps = 10/101 (10%)
 Frame = +3

Query  375  PLQRKEVKLKERLPY*LQLITMSVCTAIFSFLH-HPANMHNAMVGHRTYHNL-KTIRPNM  548
            P +RK   L   L Y        VC     FL   P NMHNA++GHRTY N+ KT+RP+M
Sbjct  353  PFERK-ASLSAALDY-------YVCLKSDFFLSASPGNMHNAVIGHRTYQNVQKTLRPDM  404

Query  549  QLLGQLFLNKNLTWPEFXDAVIEGHANRPGEIRLRKPR*SL  671
             LL +LF N ++ WPEF + V  GH NR G++RLR+P+ S+
Sbjct  405  VLLSRLFSNSSMEWPEFQNRVYNGHRNRLGQVRLRQPKQSI  445



>gb|KJB44060.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=428

 Score =   184 bits (467),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 108/152 (71%), Gaps = 19/152 (13%)
 Frame = +2

Query  2    RLRYP------ASKD-----------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLS  130
            RLRYP      +S D           + PQKFV +HLRFDKDMAAHSACDFGGGKAEKL+
Sbjct  267  RLRYPPGQSQASSTDYLRETTDQNGKQNPQKFVVLHLRFDKDMAAHSACDFGGGKAEKLA  326

Query  131  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  310
            LAKYRQ  WQGRVLNSQFTD+ELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKV+ 
Sbjct  327  LAKYRQTIWQGRVLNSQFTDKELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVHC  386

Query  311  GAARISALRRLFPLME--NKKSLASSEERGEI  400
                  A   LFP +      SL S    G++
Sbjct  387  LTNFGFAALLLFPTLSLTTSNSLYSRYMEGKL  418



>gb|KJB58885.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=399

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ  181
            R R   ++ E   KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQ
Sbjct  284  RERTDDTEKERAGKFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQ  343

Query  182  FTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKV  304
            FTD ELR+QGRCPLTPEE+GLLL ALGF+NNT LYLASHKV
Sbjct  344  FTDHELRNQGRCPLTPEEIGLLLTALGFNNNTHLYLASHKV  384



>ref|XP_008378640.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=441

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 93/116 (80%), Gaps = 16/116 (14%)
 Frame = +2

Query  2    RLRYPASKD----------------EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSL  133
            RLRYP + +                +G  K+V +HLRF+KD+AAHSACDFGGGKAEKL+L
Sbjct  325  RLRYPPNGNPKGGSDSQDKANEIEKQGAGKYVVLHLRFNKDIAAHSACDFGGGKAEKLAL  384

Query  134  AKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHK  301
            AKYRQ+ WQGRVLNSQFTDEELR+QGRCPLTPEE+GLLLAALGF+N TRLYLAS+K
Sbjct  385  AKYRQVIWQGRVLNSQFTDEELRNQGRCPLTPEEIGLLLAALGFNNTTRLYLASYK  440



>ref|XP_010277498.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nelumbo nucifera]
Length=396

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  23   KDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELR  202
            K  G  KFV +HLRFDKDMAAHSACDFGGGKAEK++LAKYRQ+ WQGRV+NSQFTDEELR
Sbjct  287  KKWGDGKFVVLHLRFDKDMAAHSACDFGGGKAEKMALAKYRQVIWQGRVMNSQFTDEELR  346

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVY  307
            SQGRCPLTPEE+GLLLAALG DN+TRLYLASHKVY
Sbjct  347  SQGRCPLTPEEIGLLLAALGLDNSTRLYLASHKVY  381



>ref|XP_002990403.1| hypothetical protein SELMODRAFT_131659, partial [Selaginella 
moellendorffii]
 gb|EFJ08496.1| hypothetical protein SELMODRAFT_131659, partial [Selaginella 
moellendorffii]
Length=399

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 102/150 (68%), Gaps = 0/150 (0%)
 Frame = +2

Query  20   SKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL  199
            +++   +K++ +H+RF++DM A+S+CDFGGG+AE+ +LA +R   W  RV+ +     +L
Sbjct  163  NQENSTKKYIGLHVRFERDMLAYSSCDFGGGQAEQKALASFRYQVWSNRVIKALKRPSDL  222

Query  200  RSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLAS  379
            R  G CPLTPEEVGLLLAA GF   T LY+A   VYGG  R+  L+ LFPL+ENK SLA+
Sbjct  223  RRNGSCPLTPEEVGLLLAAFGFTATTPLYIAGKAVYGGPRRMEPLKSLFPLVENKHSLAT  282

Query  380  SEERGEIKGKASLLAAVDYYVGMHSDIFIS  469
             +E    +  A  L A+D+ V  +SD+++S
Sbjct  283  RQELAPFRNFAHKLTALDFRVLFNSDVYMS  312



>ref|XP_002987806.1| hypothetical protein SELMODRAFT_126689, partial [Selaginella 
moellendorffii]
 gb|EFJ11109.1| hypothetical protein SELMODRAFT_126689, partial [Selaginella 
moellendorffii]
Length=399

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 102/150 (68%), Gaps = 0/150 (0%)
 Frame = +2

Query  20   SKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL  199
            +++   +K++ +H+RF++DM A+S+CDFGGG+AE+ +LA +R   W  RV+ +     +L
Sbjct  163  NQENSTKKYIGLHVRFERDMLAYSSCDFGGGQAEQKALASFRYQVWSNRVIKALKRPSDL  222

Query  200  RSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLAS  379
            R  G CPLTPEE+GLLLAA GF   T LY+A   VYGG  R+  L+ LFPL+ENK SLA+
Sbjct  223  RRNGSCPLTPEEIGLLLAAFGFTATTPLYIAGKAVYGGPRRMEPLKSLFPLVENKHSLAT  282

Query  380  SEERGEIKGKASLLAAVDYYVGMHSDIFIS  469
             +E    +  A  L A+D+ V  +SD+++S
Sbjct  283  RQELAPFRNFAHKLTALDFRVLFNSDVYMS  312



>ref|XP_001765982.1| predicted protein [Physcomitrella patens]
 gb|EDQ69303.1| predicted protein, partial [Physcomitrella patens]
Length=451

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = +2

Query  38   QKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRC  217
             +++ +H+RF+KDM AHSAC +GGG+AEK +LA +R   W+G V  +++  E LR  G C
Sbjct  222  HRYLGLHVRFEKDMIAHSACYYGGGRAEKRALAAFRAKIWRGGVSKTRYKPEALRMNGSC  281

Query  218  PLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGE  397
            PLTP+E+GLLL+ LGF  +T +Y+AS  +YGG ARI  L+ +FP++E+K +LAS++E   
Sbjct  282  PLTPDEMGLLLSGLGFPISTPVYMASKNLYGGVARIKPLKEIFPILESKYTLASTKELRP  341

Query  398  IKGKASLLAAVDYYVGMHSDIFIS  469
                +  LAA+D+ V ++SD+F+S
Sbjct  342  FLPYSHKLAALDFLVLLNSDVFMS  365



>gb|AGE09594.1| UP7-like protein, partial [Eucalyptus cladocalyx]
Length=297

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCP  220
            KFV +HLRFDKDMAAHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP
Sbjct  228  KFVVLHLRFDKDMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCP  287

Query  221  LTPEEVGLLL  250
            LTPEE+GLLL
Sbjct  288  LTPEEIGLLL  297



>dbj|BAJ93371.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97392.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=616

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 118/188 (63%), Gaps = 13/188 (7%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYW---QGRVLNSQFTDEELR  202
            GP +++A+H+RF++DM A+S C+FGGG+ E+  L  +R+ ++     R+ N+  + EELR
Sbjct  376  GPTRYLALHMRFEEDMVAYSLCEFGGGEEERRELQAFRETHFPALAARLRNTTVSPEELR  435

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
            SQGRCPLTPEE GL+L ALG++  T +Y+A  ++YGGAAR+  L RL+P +  K+ + SS
Sbjct  436  SQGRCPLTPEEAGLILGALGYERGTFIYVAGSQIYGGAARLRPLTRLYPNLVTKEDILSS  495

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISASPRKYAQRNGGTSNVP*LEDHKAQHATPR-  559
            +E   +K  +S LAA+D+     SD+F        A  + G+     +  H+  H   R 
Sbjct  496  DELAPLKNFSSRLAALDFIACASSDVF--------AVTDSGSQLSSLVSGHRVYHGRGRA  547

Query  560  PTL-PEQK  580
            PTL P +K
Sbjct  548  PTLHPNRK  555



>gb|EMT12043.1| hypothetical protein F775_07612 [Aegilops tauschii]
Length=612

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 116/188 (62%), Gaps = 13/188 (7%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYW---QGRVLNSQFTDEELR  202
            GP +++A+HLRF++DM A+S C+FGGG  E+  L  +R+ ++     R+ N+  + EELR
Sbjct  372  GPSRYLALHLRFEEDMVAYSLCEFGGGDEERRELQAFRETHFPALVARLRNTTVSPEELR  431

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
            SQGRCPLTPEE GL+LAALG+   T +Y+A  ++YGGA R+  L RL+P +  K+ + SS
Sbjct  432  SQGRCPLTPEEAGLILAALGYVRGTFIYVAGSQIYGGATRLRPLTRLYPNLVTKEDILSS  491

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISASPRKYAQRNGGTSNVP*LEDHKAQHATPR-  559
            +E   +K  +S LAA+D+     SD+F        A  + G+     +  H+  H   R 
Sbjct  492  DELAPLKNFSSRLAALDFIACASSDVF--------AVTDSGSQLSSLVSGHRVYHGRGRA  543

Query  560  PTL-PEQK  580
            PTL P +K
Sbjct  544  PTLHPNRK  551



>ref|XP_006847061.1| hypothetical protein AMTR_s00017p00201590 [Amborella trichopoda]
 gb|ERN08642.1| hypothetical protein AMTR_s00017p00201590 [Amborella trichopoda]
Length=539

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 109/160 (68%), Gaps = 6/160 (4%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ  181
            R++  +SK  G  K+V+VHLRF++DM A S C + GG+AEKL +   R+I W+G+  N +
Sbjct  300  RMKEKSSKSHG--KYVSVHLRFEEDMVAFSCCQYDGGEAEKLEMEFAREIGWKGK-FNRE  356

Query  182  ---FTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPL  352
                  E  R  G+CPLTP EVG++L  +GFDNNT +Y+AS K+Y     ++ L ++FPL
Sbjct  357  GRMIQPEMNRVNGKCPLTPLEVGMMLRGMGFDNNTSIYMASGKIYQAERNLAPLLQMFPL  416

Query  353  MENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            ++ K++LA+ EE    +G +S +AA+DY V ++S++F+++
Sbjct  417  LQTKETLATPEELAPFEGYSSRMAALDYTVCLYSEVFVTS  456



>ref|XP_008669806.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Zea mays]
Length=497

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 96/148 (65%), Gaps = 10/148 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C++ GG  E  ++   R+  W+G      RV+N     E  R
Sbjct  259  KYVSVHLRFEEDMVAFSCCNYDGGSTENNAMENARERSWRGKFHRPGRVINP----EANR  314

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              GRCPLTP EVG++L  +GFDN T LY+AS K+Y     ++ LRRLFP ++ K +L + 
Sbjct  315  RNGRCPLTPLEVGMMLRGMGFDNTTSLYVASGKIYNAEKYMTPLRRLFPFLQTKHALVTP  374

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFI  466
            EE  + KG +S LAA+DY + +HS++F+
Sbjct  375  EELAQFKGHSSRLAALDYTICLHSEVFV  402



>ref|NP_001132122.1| uncharacterized protein LOC100193539 [Zea mays]
 gb|ACF80826.1| unknown [Zea mays]
Length=313

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 96/150 (64%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C + GG  EK  +   R+  W+G      RV+N     E  R
Sbjct  82   KYVSVHLRFEEDMVAFSCCTYDGGWREKTEMDNARERSWRGKFRRHGRVINP----EANR  137

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              G+CPLTP EVG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K SLA  
Sbjct  138  RDGKCPLTPLEVGMMLRGMGFDNTTSLYVASGKIYNSEKYMAPLRQMFPLLTTKDSLALP  197

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            EE  + KG +S LAA+DY V +HS++F++ 
Sbjct  198  EELAQFKGHSSQLAALDYTVCVHSEVFVTT  227



>gb|EEC80777.1| hypothetical protein OsI_23300 [Oryza sativa Indica Group]
Length=605

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 98/146 (67%), Gaps = 3/146 (2%)
 Frame = +2

Query  35   PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG---RVLNSQFTDEELRS  205
            P +++A+H+RF++DM A+S CDFGGG AE+  L  YR+ ++     R+ N+  + EE RS
Sbjct  366  PSRYLALHMRFEEDMVAYSLCDFGGGDAEREELQAYRETHFPTLAMRLRNTSVSPEEQRS  425

Query  206  QGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSE  385
             GRCPLTPEE GL+L ALG+D  T +Y+A  ++YGGAAR+  L RLFP +  K+ + SS 
Sbjct  426  LGRCPLTPEEAGLVLTALGYDRGTFIYVAGSQIYGGAARLRPLTRLFPNLVTKEDVLSSA  485

Query  386  ERGEIKGKASLLAAVDYYVGMHSDIF  463
            E    K  +S LAA+D+     +D+F
Sbjct  486  ELAPFKNFSSRLAALDFIACASADVF  511



>ref|NP_001057817.1| Os06g0545900 [Oryza sativa Japonica Group]
 dbj|BAD54578.1| putative axi 1 [Oryza sativa Japonica Group]
 dbj|BAD54113.1| putative axi 1 [Oryza sativa Japonica Group]
 dbj|BAF19731.1| Os06g0545900 [Oryza sativa Japonica Group]
 dbj|BAG91783.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65849.1| hypothetical protein OsJ_21623 [Oryza sativa Japonica Group]
Length=603

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 98/146 (67%), Gaps = 3/146 (2%)
 Frame = +2

Query  35   PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG---RVLNSQFTDEELRS  205
            P +++A+H+RF++DM A+S CDFGGG AE+  L  YR+ ++     R+ N+  + EE RS
Sbjct  364  PSRYLALHMRFEEDMVAYSLCDFGGGDAEREELQAYRETHFPTLAMRLRNTSVSPEEQRS  423

Query  206  QGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSE  385
             GRCPLTPEE GL+L ALG+D  T +Y+A  ++YGGAAR+  L RLFP +  K+ + SS 
Sbjct  424  LGRCPLTPEEAGLVLTALGYDRGTFIYVAGSQIYGGAARLRPLTRLFPNLVTKEDVLSSA  483

Query  386  ERGEIKGKASLLAAVDYYVGMHSDIF  463
            E    K  +S LAA+D+     +D+F
Sbjct  484  ELAPFKNFSSRLAALDFIACASADVF  509



>ref|XP_008669807.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Zea mays]
Length=492

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 96/148 (65%), Gaps = 10/148 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C++ GG  E  ++   R+  W+G      RV+N     E  R
Sbjct  306  KYVSVHLRFEEDMVAFSCCNYDGGSTENNAMENARERSWRGKFHRPGRVINP----EANR  361

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              GRCPLTP EVG++L  +GFDN T LY+AS K+Y     ++ LRRLFP ++ K +L + 
Sbjct  362  RNGRCPLTPLEVGMMLRGMGFDNTTSLYVASGKIYNAEKYMTPLRRLFPFLQTKHALVTP  421

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFI  466
            EE  + KG +S LAA+DY + +HS++F+
Sbjct  422  EELAQFKGHSSRLAALDYTICLHSEVFV  449



>ref|XP_008669805.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
Length=544

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 96/148 (65%), Gaps = 10/148 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C++ GG  E  ++   R+  W+G      RV+N     E  R
Sbjct  306  KYVSVHLRFEEDMVAFSCCNYDGGSTENNAMENARERSWRGKFHRPGRVINP----EANR  361

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              GRCPLTP EVG++L  +GFDN T LY+AS K+Y     ++ LRRLFP ++ K +L + 
Sbjct  362  RNGRCPLTPLEVGMMLRGMGFDNTTSLYVASGKIYNAEKYMTPLRRLFPFLQTKHALVTP  421

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFI  466
            EE  + KG +S LAA+DY + +HS++F+
Sbjct  422  EELAQFKGHSSRLAALDYTICLHSEVFV  449



>gb|KJB59186.1| hypothetical protein B456_009G243300 [Gossypium raimondii]
Length=435

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 101/157 (64%), Gaps = 10/157 (6%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C + GG+AEKL +  +R+  W+G      RV+         R
Sbjct  179  KYVSVHLRFEQDMVAFSCCVYEGGEAEKLKMDSFREQEWKGKFKRKDRVIVPALN----R  234

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
             +G+CPLTP EVGL+L  +GFDNNT +Y+AS K+Y     ++ LR +FPL+  K+SLA+ 
Sbjct  235  IEGKCPLTPVEVGLMLRGMGFDNNTSIYIASGKIYQAEKHLAPLREMFPLLYTKESLATP  294

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISASPRKYAQ  493
            +E    +G +S LAA+DY V + S++F++     + Q
Sbjct  295  DELAPFEGHSSKLAALDYTVSLFSEVFVTTQGGNFPQ  331



>ref|XP_006657039.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=594

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 99/146 (68%), Gaps = 3/146 (2%)
 Frame = +2

Query  35   PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG---RVLNSQFTDEELRS  205
            P +++A+H+RF++DM A+S C+FGGG AE+  L  YR+ ++     R+ N+  + EE RS
Sbjct  350  PSRYLALHMRFEEDMVAYSLCEFGGGDAERKELQAYRETHFPTLAMRLRNTSVSPEEQRS  409

Query  206  QGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSE  385
             GRCPLTPEE GL+LAALG+D  T +Y+A  ++YGGAAR+  L RLFP +  K+ + SS 
Sbjct  410  LGRCPLTPEEAGLVLAALGYDRRTFIYVAGSQIYGGAARLRPLTRLFPNLVTKEDVLSSG  469

Query  386  ERGEIKGKASLLAAVDYYVGMHSDIF  463
            E    K  +S LAA+D+     +D+F
Sbjct  470  ELAPFKNFSSRLAALDFIACASADVF  495



>ref|XP_010274355.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=599

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 99/146 (68%), Gaps = 2/146 (1%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEE--LRSQGR  214
            +FV+VHLRF++DM A S C + GG++EKL + K R+  W+G+       D     R  G+
Sbjct  344  RFVSVHLRFEEDMVAFSCCIYDGGESEKLKMDKIREKGWRGKFTREGREDRPDLNRIDGK  403

Query  215  CPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERG  394
            CPLTP EVG++L  +GFDNNT +YLAS K+Y     ++ L+++FPL++ K+SLA+ EE  
Sbjct  404  CPLTPLEVGMMLRGMGFDNNTAIYLASGKIYEAERNLTPLKKMFPLLQTKESLATPEELA  463

Query  395  EIKGKASLLAAVDYYVGMHSDIFISA  472
              +G +S LAA+DY V + S+IF++ 
Sbjct  464  SFEGYSSRLAALDYTVCLFSEIFVTT  489



>gb|KJB59187.1| hypothetical protein B456_009G243300 [Gossypium raimondii]
Length=611

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 101/157 (64%), Gaps = 10/157 (6%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C + GG+AEKL +  +R+  W+G      RV+         R
Sbjct  355  KYVSVHLRFEQDMVAFSCCVYEGGEAEKLKMDSFREQEWKGKFKRKDRVIVPALN----R  410

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
             +G+CPLTP EVGL+L  +GFDNNT +Y+AS K+Y     ++ LR +FPL+  K+SLA+ 
Sbjct  411  IEGKCPLTPVEVGLMLRGMGFDNNTSIYIASGKIYQAEKHLAPLREMFPLLYTKESLATP  470

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISASPRKYAQ  493
            +E    +G +S LAA+DY V + S++F++     + Q
Sbjct  471  DELAPFEGHSSKLAALDYTVSLFSEVFVTTQGGNFPQ  507



>gb|EMT33054.1| hypothetical protein F775_09106 [Aegilops tauschii]
Length=463

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 100/150 (67%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C + GG+ EK+ +   R+  W+G      RV+N     E  R
Sbjct  233  KYVSVHLRFEEDMVAFSCCTYDGGRKEKIEMENARERSWRGKFHRPGRVINP----EANR  288

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              G+CPLTP EVG++L  +GFDN T LY+AS K+Y  A  ++ LR++FPL++ K +LA S
Sbjct  289  RDGKCPLTPLEVGMMLRGMGFDNTTFLYVASGKIYNAAKYMAPLRQMFPLLQTKDTLALS  348

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            EE  + +G +S LAA+DY V + S++F++ 
Sbjct  349  EELAKFEGYSSRLAALDYTVCVQSEVFVTT  378



>ref|XP_010227672.1| PREDICTED: uncharacterized protein At1g04910 [Brachypodium distachyon]
Length=524

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 97/146 (66%), Gaps = 3/146 (2%)
 Frame = +2

Query  35   PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG---RVLNSQFTDEELRS  205
            P +FVA+H+RF+ DM A+S C+FGGG+ E+  L  +R+ ++     R+ N+  + EE RS
Sbjct  285  PSRFVALHMRFEVDMVAYSLCEFGGGEEERRELQAFRETHFPALATRLRNTTVSPEEQRS  344

Query  206  QGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSE  385
             GRCPLTPEE GL+L+ LG+D+ T LY+A  ++YGGA R+  L RL+P +  K  + SS+
Sbjct  345  LGRCPLTPEEAGLILSGLGYDHRTFLYVAGSRIYGGATRLRPLTRLYPNLVTKDDILSSD  404

Query  386  ERGEIKGKASLLAAVDYYVGMHSDIF  463
            E    K  +S LAA+D+     SD+F
Sbjct  405  ELAPFKNFSSRLAALDFIACASSDVF  430



>gb|KJB59188.1| hypothetical protein B456_009G243300 [Gossypium raimondii]
Length=628

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 101/157 (64%), Gaps = 10/157 (6%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C + GG+AEKL +  +R+  W+G      RV+         R
Sbjct  372  KYVSVHLRFEQDMVAFSCCVYEGGEAEKLKMDSFREQEWKGKFKRKDRVIVPALN----R  427

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
             +G+CPLTP EVGL+L  +GFDNNT +Y+AS K+Y     ++ LR +FPL+  K+SLA+ 
Sbjct  428  IEGKCPLTPVEVGLMLRGMGFDNNTSIYIASGKIYQAEKHLAPLREMFPLLYTKESLATP  487

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISASPRKYAQ  493
            +E    +G +S LAA+DY V + S++F++     + Q
Sbjct  488  DELAPFEGHSSKLAALDYTVSLFSEVFVTTQGGNFPQ  524



>ref|XP_010272863.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=587

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 100/146 (68%), Gaps = 2/146 (1%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTD--EELRSQGR  214
            K+V+VHLRF++DM A S C + GG++EKL +   RQ  W+G+       D  +  R  G+
Sbjct  340  KYVSVHLRFEEDMVAFSCCVYDGGESEKLKMDFIRQQGWRGKFTREGRIDRPDHNRINGK  399

Query  215  CPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERG  394
            CPLTP EVG++L  +GFDNNT +YLAS K+Y G   ++ L ++FPL+++K+SLA+ EE  
Sbjct  400  CPLTPLEVGMMLRGMGFDNNTSIYLASGKIYDGERNLAPLLKMFPLLQSKESLATPEELA  459

Query  395  EIKGKASLLAAVDYYVGMHSDIFISA  472
              +G +S +AA+DY V + S++F++ 
Sbjct  460  SFQGFSSRMAALDYTVCLFSEVFVTT  485



>ref|XP_008661414.1| PREDICTED: uncharacterized protein LOC100193539 isoform X1 [Zea 
mays]
Length=564

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 96/150 (64%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C + GG  EK  +   R+  W+G      RV+N     E  R
Sbjct  333  KYVSVHLRFEEDMVAFSCCTYDGGWREKTEMDNARERSWRGKFRRHGRVINP----EANR  388

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              G+CPLTP EVG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K SLA  
Sbjct  389  RDGKCPLTPLEVGMMLRGMGFDNTTSLYVASGKIYNSEKYMAPLRQMFPLLTTKDSLALP  448

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            EE  + KG +S LAA+DY V +HS++F++ 
Sbjct  449  EELAQFKGHSSQLAALDYTVCVHSEVFVTT  478



>ref|XP_003578848.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=558

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 100/150 (67%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C + GG  EK+ +   R+  W+G      RV+N     E  R
Sbjct  328  KYVSVHLRFEEDMVAFSCCTYDGGWKEKIEMENARERSWRGKFHRPGRVINP----EANR  383

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              G+CPLTP EVG++L  +GFD++T LY+AS K+Y  A  ++ LR++FPL+E K+SLA  
Sbjct  384  RDGKCPLTPLEVGMMLRGMGFDHSTFLYVASGKIYNAAKYMAPLRQMFPLLETKESLALP  443

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            EE  E +G +S LAA+DY V + S++F++ 
Sbjct  444  EELAEFEGYSSRLAAIDYTVCVQSEVFVTT  473



>gb|AFW56213.1| hypothetical protein ZEAMMB73_697257 [Zea mays]
Length=518

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 96/150 (64%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C + GG  EK  +   R+  W+G      RV+N     E  R
Sbjct  287  KYVSVHLRFEEDMVAFSCCTYDGGWREKTEMDNARERSWRGKFRRHGRVINP----EANR  342

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              G+CPLTP EVG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K SLA  
Sbjct  343  RDGKCPLTPLEVGMMLRGMGFDNTTSLYVASGKIYNSEKYMAPLRQMFPLLTTKDSLALP  402

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            EE  + KG +S LAA+DY V +HS++F++ 
Sbjct  403  EELAQFKGHSSQLAALDYTVCVHSEVFVTT  432



>ref|XP_008784225.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=552

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 94/146 (64%), Gaps = 2/146 (1%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGR  214
            K+V+VHLRF++DM A S C + GGK EK  +   R+  W+G  R    +   E  R  GR
Sbjct  322  KYVSVHLRFEEDMVAFSCCTYDGGKEEKREMDIARERSWRGKFRRHGRKINPEANRMDGR  381

Query  215  CPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERG  394
            CPLTP EVG++L  +GFDN T +Y+AS K+Y     +  LR+LFP +E K +LAS++E  
Sbjct  382  CPLTPLEVGMMLRGMGFDNTTSVYVASGKIYNAKKYMDPLRQLFPRLETKDTLASADELA  441

Query  395  EIKGKASLLAAVDYYVGMHSDIFISA  472
              KG +S LAA+DY V  HS++F++ 
Sbjct  442  PFKGHSSRLAALDYTVCAHSEVFVTT  467



>ref|XP_011101082.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=567

 Score =   132 bits (331),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 96/144 (67%), Gaps = 4/144 (3%)
 Frame = +2

Query  38   QKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRC  217
            + ++A+HLRF+ DM A S C +GGG  E+  LAK R+ +   + L++   D E R QGRC
Sbjct  266  KHYIALHLRFEPDMLAFSGCYYGGGDKERRELAKIRRRW---KTLHNHNPDRE-RRQGRC  321

Query  218  PLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGE  397
            PLTPEEVGLLL ALG+D  T +Y+AS +VYGG A +  L+ LFP   +K +LAS +E G 
Sbjct  322  PLTPEEVGLLLRALGYDRETHIYVASGEVYGGEATLGPLKALFPNFYSKDTLASPDELGP  381

Query  398  IKGKASLLAAVDYYVGMHSDIFIS  469
                +S +AA+D+ V   SD+F++
Sbjct  382  FSSFSSRMAALDFMVCDESDVFVT  405


 Score = 40.8 bits (94),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 33/61 (54%), Gaps = 5/61 (8%)
 Frame = +3

Query  480  ANMHNAMVGHRTYHNLK-TIRPNMQLLGQLFLNK-NLTWPEFXDAV---IEGHANRPGEI  644
             NM   + G R Y   K TIRPN + L +LFL++ N+TW EF  +V     G    P E+
Sbjct  409  GNMAKILAGRRRYFGHKPTIRPNAKKLYKLFLSRDNMTWEEFASSVRMFQRGFMGEPKEV  468

Query  645  R  647
            R
Sbjct  469  R  469



>dbj|BAJ97328.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 99/150 (66%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            ++V+VHLRF++DM A S C + GG+ EK+ +   R+  W+G      RV+N     E  R
Sbjct  327  RYVSVHLRFEEDMVAFSCCTYDGGRKEKIEMENARERSWRGKFHRPGRVINP----EANR  382

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              G+CPLTP EVG++L  +GFDN T LY+AS K+Y  A  ++ LR++FPL++ K +LA  
Sbjct  383  RDGKCPLTPLEVGMMLRGMGFDNTTFLYVASGKIYNAAKYMAPLRQMFPLLQTKDTLALP  442

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            EE  E +G +S LAA+DY V + S++F++ 
Sbjct  443  EELAEFEGYSSRLAALDYTVCVQSEVFVTT  472



>ref|XP_009390063.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=541

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 97/146 (66%), Gaps = 2/146 (1%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGR  214
            K+++VHLRF++DM A S C + GG+ EK  + K R+  W+G  R      + E  R  G+
Sbjct  311  KYISVHLRFEEDMVAFSCCTYDGGQQEKNEMDKARERSWRGKFRRPGRVISPEANRRNGK  370

Query  215  CPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERG  394
            CPLTP EVG++L  +GF N T +Y+AS K+Y     ++ LR+LFPL+E K++LAS++E  
Sbjct  371  CPLTPLEVGMMLRGMGFGNTTSVYVASGKIYNAEKYMAPLRQLFPLLETKETLASADELA  430

Query  395  EIKGKASLLAAVDYYVGMHSDIFISA  472
              KG +S LAA+DY V  HS++F++ 
Sbjct  431  PFKGHSSQLAALDYTVCAHSEVFVTT  456



>ref|XP_006644988.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=448

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 102/159 (64%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS-  178
            R+R  ++++ G  K+VAVHLRF++DM A S C F GG+ EK+ L   R+  W+G+     
Sbjct  198  RMREKSAENNG--KYVAVHLRFEEDMVAFSCCVFDGGEEEKMELDAARERGWRGKFTRPG  255

Query  179  -QFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
                   +R  G+CPLTP EVGL+L  +GF NNT +YLAS ++Y     ++ L  +FPL+
Sbjct  256  RVIKPGAIRMNGKCPLTPLEVGLMLRGMGFSNNTAIYLASGRIYKAEKNMAPLLEMFPLL  315

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            + K++LAS EE    K  +S +AA+DY V +HS++F++ 
Sbjct  316  QTKETLASDEELAPFKNFSSRMAAIDYSVCVHSEVFVTT  354



>dbj|BAD81763.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
 dbj|BAG87369.1| unnamed protein product [Oryza sativa Japonica Group]
Length=334

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 101/159 (64%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS-  178
            R+R  ++++ G  K+VAVHLRF++DM A S C F GG+ EK  L   R+  W+G+     
Sbjct  84   RMREKSAENNG--KYVAVHLRFEEDMVAFSCCVFDGGEKEKKELDAARERGWRGKFTRPG  141

Query  179  -QFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
                   +R  G+CPLTP EVGL+L  +GF NNT +YLAS ++Y     ++ L  +FPL+
Sbjct  142  RVIRPGAIRMNGKCPLTPLEVGLMLRGMGFSNNTAIYLASGRIYKSEKNMAPLLEMFPLL  201

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            + K++LAS EE    K  +S +AA+DY V +HS++F++ 
Sbjct  202  QTKETLASDEELAPFKNFSSRMAAIDYTVCVHSEVFVTT  240



>ref|XP_004965564.1| PREDICTED: uncharacterized protein At1g04910-like isoform X4 
[Setaria italica]
Length=506

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG---RVLNSQFTDEELR  202
            GP +++A+H+RF++DM A+S C+FGGG+ E+  L  YR+ ++     R+ N+  + EE R
Sbjct  266  GPSRYLALHMRFEEDMVAYSLCEFGGGEEERRELQAYRETHFPTLAMRLRNATVSPEEQR  325

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
            S GRCPLTPEE GL+L+ALG+D  T +Y+A  ++YGGA R+  L RL+P +  K+ + ++
Sbjct  326  SLGRCPLTPEESGLILSALGYDGRTFIYVAGSQIYGGAPRLRPLTRLYPNLVTKEDILTT  385

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIF  463
            +E    K  +S LAA+D+     +D+F
Sbjct  386  DELAPFKNFSSRLAALDFIACASADVF  412



>ref|XP_010925619.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=626

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 96/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG---RVLNSQFTDEELR  202
            GP +++A+H+RF+ DM A+S CDFGGG+ E+  L  YR+I++     R+ N   + EELR
Sbjct  385  GPARYLALHMRFEMDMVAYSLCDFGGGEKERRELQAYREIHFPTLLMRIRNDSISPEELR  444

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
            + GRCPL PEE  L+L+ALGF   T +YLA  ++YGG +R+    RL+P +  K+ L SS
Sbjct  445  NLGRCPLMPEEAALMLSALGFKRETYIYLAGSQIYGGQSRMLPFTRLYPNLITKEDLLSS  504

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIF  463
             E G  +  +S LAA+D+     +D+F
Sbjct  505  SELGPFRNFSSQLAALDFIACATADVF  531



>ref|NP_001044765.1| Os01g0841200 [Oryza sativa Japonica Group]
 dbj|BAF06679.1| Os01g0841200, partial [Oryza sativa Japonica Group]
Length=381

 Score =   135 bits (340),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 101/159 (64%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS-  178
            R+R  ++++ G  K+VAVHLRF++DM A S C F GG+ EK  L   R+  W+G+     
Sbjct  131  RMREKSAENNG--KYVAVHLRFEEDMVAFSCCVFDGGEKEKKELDAARERGWRGKFTRPG  188

Query  179  -QFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
                   +R  G+CPLTP EVGL+L  +GF NNT +YLAS ++Y     ++ L  +FPL+
Sbjct  189  RVIRPGAIRMNGKCPLTPLEVGLMLRGMGFSNNTAIYLASGRIYKSEKNMAPLLEMFPLL  248

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            + K++LAS EE    K  +S +AA+DY V +HS++F++ 
Sbjct  249  QTKETLASDEELAPFKNFSSRMAAIDYTVCVHSEVFVTT  287



>ref|XP_006472724.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
Length=529

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 101/149 (68%), Gaps = 8/149 (5%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL-----RS  205
            K+V++HLRF++DM A S C + GGKAEKL +  +R+ +W+G+    +  D  +     R 
Sbjct  283  KYVSIHLRFEEDMVAFSCCLYDGGKAEKLEMDMFREKWWKGKF---KRKDRVILPGLNRI  339

Query  206  QGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSE  385
             G+CPLTP EVG++L  +GFDNNT +YLAS K+Y     +++L ++FPL+  K+SLA+ +
Sbjct  340  NGKCPLTPLEVGMMLRGMGFDNNTSIYLASGKIYQAERHLASLLKMFPLVYTKESLATPD  399

Query  386  ERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            E    +G +S LAA+DY V + S++F++ 
Sbjct  400  ELAPFEGYSSRLAALDYTVCLFSEVFVTT  428



>ref|XP_004965563.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Setaria italica]
Length=614

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG---RVLNSQFTDEELR  202
            GP +++A+H+RF++DM A+S C+FGGG+ E+  L  YR+ ++     R+ N+  + EE R
Sbjct  374  GPSRYLALHMRFEEDMVAYSLCEFGGGEEERRELQAYRETHFPTLAMRLRNATVSPEEQR  433

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
            S GRCPLTPEE GL+L+ALG+D  T +Y+A  ++YGGA R+  L RL+P +  K+ + ++
Sbjct  434  SLGRCPLTPEESGLILSALGYDGRTFIYVAGSQIYGGAPRLRPLTRLYPNLVTKEDILTT  493

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIF  463
            +E    K  +S LAA+D+     +D+F
Sbjct  494  DELAPFKNFSSRLAALDFIACASADVF  520



>ref|XP_004965562.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Setaria italica]
Length=623

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG---RVLNSQFTDEELR  202
            GP +++A+H+RF++DM A+S C+FGGG+ E+  L  YR+ ++     R+ N+  + EE R
Sbjct  383  GPSRYLALHMRFEEDMVAYSLCEFGGGEEERRELQAYRETHFPTLAMRLRNATVSPEEQR  442

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
            S GRCPLTPEE GL+L+ALG+D  T +Y+A  ++YGGA R+  L RL+P +  K+ + ++
Sbjct  443  SLGRCPLTPEESGLILSALGYDGRTFIYVAGSQIYGGAPRLRPLTRLYPNLVTKEDILTT  502

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIF  463
            +E    K  +S LAA+D+     +D+F
Sbjct  503  DELAPFKNFSSRLAALDFIACASADVF  529



>ref|XP_006434132.1| hypothetical protein CICLE_v10000652mg [Citrus clementina]
 gb|ESR47372.1| hypothetical protein CICLE_v10000652mg [Citrus clementina]
Length=529

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 101/149 (68%), Gaps = 8/149 (5%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL-----RS  205
            K+V++HLRF++DM A S C + GGKAEKL +  +R+ +W+G+    +  D  +     R 
Sbjct  283  KYVSIHLRFEEDMVAFSCCLYDGGKAEKLEMDMFREKWWKGKF---KRKDRVILPGLNRI  339

Query  206  QGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSE  385
             G+CPLTP EVG++L  +GFDNNT +YLAS K+Y     +++L ++FPL+  K+SLA+ +
Sbjct  340  NGKCPLTPLEVGMMLRGMGFDNNTSIYLASGKIYQAERHLASLLKMFPLVYTKESLATPD  399

Query  386  ERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            E    +G +S LAA+DY V + S++F++ 
Sbjct  400  ELAPFEGYSSRLAALDYTVCLFSEVFVTT  428



>ref|XP_004965561.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Setaria italica]
Length=630

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = +2

Query  32   GPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG---RVLNSQFTDEELR  202
            GP +++A+H+RF++DM A+S C+FGGG+ E+  L  YR+ ++     R+ N+  + EE R
Sbjct  390  GPSRYLALHMRFEEDMVAYSLCEFGGGEEERRELQAYRETHFPTLAMRLRNATVSPEEQR  449

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
            S GRCPLTPEE GL+L+ALG+D  T +Y+A  ++YGGA R+  L RL+P +  K+ + ++
Sbjct  450  SLGRCPLTPEESGLILSALGYDGRTFIYVAGSQIYGGAPRLRPLTRLYPNLVTKEDILTT  509

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIF  463
            +E    K  +S LAA+D+     +D+F
Sbjct  510  DELAPFKNFSSRLAALDFIACASADVF  536



>ref|XP_001760728.1| predicted protein [Physcomitrella patens]
 gb|EDQ74467.1| predicted protein [Physcomitrella patens]
Length=558

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 106/167 (63%), Gaps = 5/167 (3%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS-  178
            R++  ++K  G   +V++HLRF++DM A S C + GG+ EK  L   R+  W+G+     
Sbjct  291  RMKAKSAKTNG--NYVSIHLRFEEDMVAFSQCVYTGGEEEKTRLDNTRERGWRGKFTREG  348

Query  179  --QFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPL  352
                + E++R  G+CPLTP EVG++L  +GF N+T +YLA+  +Y G   +  LRR+FP 
Sbjct  349  RVNASPEQIRRNGKCPLTPVEVGMMLRGMGFSNSTPIYLAAGLIYKGEESMEPLRRMFPY  408

Query  353  MENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASPRKYAQ  493
            +++K++L + EE  + KG +S LAA+DY V +HS++F++     + Q
Sbjct  409  LQSKETLLTPEEYKQFKGFSSRLAAIDYTVCLHSEVFVTTQGGNFPQ  455



>ref|XP_006472723.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
Length=595

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 100/150 (67%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V++HLRF++DM A S C + GGKAEKL +  +R+ +W+G      RV+         R
Sbjct  349  KYVSIHLRFEEDMVAFSCCLYDGGKAEKLEMDMFREKWWKGKFKRKDRVILPGLN----R  404

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              G+CPLTP EVG++L  +GFDNNT +YLAS K+Y     +++L ++FPL+  K+SLA+ 
Sbjct  405  INGKCPLTPLEVGMMLRGMGFDNNTSIYLASGKIYQAERHLASLLKMFPLVYTKESLATP  464

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            +E    +G +S LAA+DY V + S++F++ 
Sbjct  465  DELAPFEGYSSRLAALDYTVCLFSEVFVTT  494



>ref|XP_006434133.1| hypothetical protein CICLE_v10000652mg [Citrus clementina]
 gb|ESR47373.1| hypothetical protein CICLE_v10000652mg [Citrus clementina]
Length=595

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 100/150 (67%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V++HLRF++DM A S C + GGKAEKL +  +R+ +W+G      RV+         R
Sbjct  349  KYVSIHLRFEEDMVAFSCCLYDGGKAEKLEMDMFREKWWKGKFKRKDRVILPGLN----R  404

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              G+CPLTP EVG++L  +GFDNNT +YLAS K+Y     +++L ++FPL+  K+SLA+ 
Sbjct  405  INGKCPLTPLEVGMMLRGMGFDNNTSIYLASGKIYQAERHLASLLKMFPLVYTKESLATP  464

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            +E    +G +S LAA+DY V + S++F++ 
Sbjct  465  DELAPFEGYSSRLAALDYTVCLFSEVFVTT  494



>gb|EEE55649.1| hypothetical protein OsJ_04031 [Oryza sativa Japonica Group]
Length=422

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 101/159 (64%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS-  178
            R+R  ++++ G  K+VAVHLRF++DM A S C F GG+ EK  L   R+  W+G+     
Sbjct  172  RMREKSAENNG--KYVAVHLRFEEDMVAFSCCVFDGGEKEKKELDAARERGWRGKFTRPG  229

Query  179  -QFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
                   +R  G+CPLTP EVGL+L  +GF NNT +YLAS ++Y     ++ L  +FPL+
Sbjct  230  RVIRPGAIRMNGKCPLTPLEVGLMLRGMGFSNNTAIYLASGRIYKSEKNMAPLLEMFPLL  289

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            + K++LAS EE    K  +S +AA+DY V +HS++F++ 
Sbjct  290  QTKETLASDEELAPFKNFSSRMAAIDYTVCVHSEVFVTT  328



>gb|EEC71770.1| hypothetical protein OsI_04380 [Oryza sativa Indica Group]
Length=440

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 101/159 (64%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS-  178
            R+R  ++++ G  K+VAVHLRF++DM A S C F GG+ EK  L   R+  W+G+     
Sbjct  190  RMREKSAENNG--KYVAVHLRFEEDMVAFSCCVFDGGEKEKKELDAARERGWRGKFTRPG  247

Query  179  -QFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
                   +R  G+CPLTP EVGL+L  +GF NNT +YLAS ++Y     ++ L  +FPL+
Sbjct  248  RVIRPGAIRMNGKCPLTPLEVGLMLRGMGFSNNTAIYLASGRIYKSEKNMAPLLEMFPLL  307

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            + K++LAS EE    K  +S +AA+DY V +HS++F++ 
Sbjct  308  QTKETLASDEELAPFKNFSSRMAAIDYTVCVHSEVFVTT  346



>gb|EMS55867.1| hypothetical protein TRIUR3_34733 [Triticum urartu]
Length=463

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 99/150 (66%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C + GG+ EK+ +   R+  W+G      RV+N     E  R
Sbjct  233  KYVSVHLRFEEDMVAFSCCTYDGGRKEKIEMENARERSWRGKFHRPGRVINP----EANR  288

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              G+CPLTP EVG++L  +GFDN T LY+AS K+Y  A  ++ L ++FPL++ K +LA S
Sbjct  289  RDGKCPLTPLEVGMMLRGMGFDNTTFLYVASGKIYNAAKYMAPLGQMFPLLQTKDTLALS  348

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            EE  + +G +S LAA+DY V + S++F++ 
Sbjct  349  EELAKFEGYSSRLAALDYTVCVQSEVFVTT  378



>ref|XP_002441904.1| hypothetical protein SORBIDRAFT_08g004650 [Sorghum bicolor]
 gb|EES15742.1| hypothetical protein SORBIDRAFT_08g004650 [Sorghum bicolor]
Length=533

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 95/150 (63%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C + GG  EK  +   R+  W+G      RV+N     E  R
Sbjct  302  KYVSVHLRFEEDMVAFSCCTYDGGWREKTEMDNARERSWRGKFRRHGRVINP----EANR  357

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              G+CPLTP EVG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K SLA  
Sbjct  358  RDGKCPLTPLEVGMMLRGMGFDNTTSLYVASGKIYNSEKYMAPLRQMFPLLTTKDSLALP  417

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            EE  + KG +S LAA+DY V + S++F++ 
Sbjct  418  EELAQFKGHSSQLAALDYTVCVQSEVFVTT  447



>ref|XP_009799750.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Nicotiana 
sylvestris]
Length=509

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQ---GRVLNSQ-FTDEE  196
            EGP K++A+HLRF+ DM A+S C+FGGG+ E+  L  YRQ+++     R+  S+ ++ EE
Sbjct  275  EGPSKYLALHLRFEIDMVAYSMCEFGGGETERRELQTYRQVHFPLLLERLKESKSYSPEE  334

Query  197  LRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLA  376
            LR  G+CPLTPEE  L+LA LGF + T +YLA   +YGG +R+ AL  L+P +  K++L 
Sbjct  335  LRRMGKCPLTPEEAALVLAGLGFKHGTYIYLAGSDIYGGQSRMQALTTLYPNLVTKENLL  394

Query  377  SSEERGEIKGKASLLAAVDYYVGMHSDIF  463
            S  E    +  +S LAA+D+     SD+F
Sbjct  395  SPSELAPFRNFSSQLAALDFIACATSDVF  423



>ref|NP_001066285.2| Os12g0174100 [Oryza sativa Japonica Group]
 gb|ABA96586.1| Growth regulator protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29304.2| Os12g0174100 [Oryza sativa Japonica Group]
Length=491

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 95/150 (63%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            KFV+VHLRF++DM A S C + GG  EK  +   R+  W+G      RV+N     E  R
Sbjct  260  KFVSVHLRFEEDMVAFSCCTYDGGLKEKTEMENARERSWRGKFHRHGRVINP----EANR  315

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              G+CPLTP EVG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K +LA  
Sbjct  316  RDGKCPLTPLEVGMMLRGMGFDNTTSLYVASGKIYNAEKYMAPLRQMFPLLATKDTLALP  375

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            EE  E +G +S LAA+DY V + S++F++ 
Sbjct  376  EELAEFEGHSSRLAALDYSVCLPSEVFVTT  405



>ref|XP_006664382.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=431

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 96/150 (64%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C + GG  EK+ +   R+  W+G      RV+N     E  R
Sbjct  200  KYVSVHLRFEEDMVAFSCCIYDGGLKEKIEMENARERSWKGKFHRHGRVINP----EANR  255

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              G+CPLTP EVG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K +LA  
Sbjct  256  RDGKCPLTPLEVGMMLRGMGFDNTTSLYVASGKIYNAEKYMAPLRQMFPLLATKDTLALP  315

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            EE  E +G +S LAA+DY V + S++F++ 
Sbjct  316  EELAEFEGHSSRLAALDYTVCLPSEVFVTT  345



>ref|XP_002489034.1| hypothetical protein SORBIDRAFT_0344s002010 [Sorghum bicolor]
 gb|EES20474.1| hypothetical protein SORBIDRAFT_0344s002010 [Sorghum bicolor]
Length=595

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 99/146 (68%), Gaps = 3/146 (2%)
 Frame = +2

Query  35   PQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG---RVLNSQFTDEELRS  205
            P +++A+H+RF++DM A+S C+FGGG+ E+  L  YR+ ++     R+ N+  + EE RS
Sbjct  356  PNRYLALHMRFEEDMVAYSLCEFGGGEEERRELQAYRETHFPALALRLRNTTVSPEEQRS  415

Query  206  QGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSE  385
             GRCPLTPEE GL+L+ALG+D  T +Y+A  ++YGGA R+  L RL+P +  K+ + +++
Sbjct  416  LGRCPLTPEEAGLVLSALGYDRRTFIYVAGSQIYGGAPRLRPLTRLYPNLVTKEDVLTAD  475

Query  386  ERGEIKGKASLLAAVDYYVGMHSDIF  463
            E    K  +S LAA+D+     +D+F
Sbjct  476  ELAPFKNFSSRLAALDFIACASADVF  501



>gb|EEE52851.1| hypothetical protein OsJ_35390 [Oryza sativa Japonica Group]
Length=562

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 95/150 (63%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            KFV+VHLRF++DM A S C + GG  EK  +   R+  W+G      RV+N     E  R
Sbjct  331  KFVSVHLRFEEDMVAFSCCTYDGGLKEKTEMENARERSWRGKFHRHGRVINP----EANR  386

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              G+CPLTP EVG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K +LA  
Sbjct  387  RDGKCPLTPLEVGMMLRGMGFDNTTSLYVASGKIYNAEKYMAPLRQMFPLLATKDTLALP  446

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            EE  E +G +S LAA+DY V + S++F++ 
Sbjct  447  EELAEFEGHSSRLAALDYSVCLPSEVFVTT  476



>ref|XP_006841300.1| hypothetical protein AMTR_s00134p00086190 [Amborella trichopoda]
 gb|ERN02975.1| hypothetical protein AMTR_s00134p00086190 [Amborella trichopoda]
Length=471

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 96/146 (66%), Gaps = 2/146 (1%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ--FTDEELRSQGR  214
            K+V+VHLRF++DM A S C + GG+ EK  +   R+  W+G+   +        +R  G+
Sbjct  230  KYVSVHLRFEEDMVAFSCCIYDGGEEEKWEMDNARERGWRGKFNKTGRIIRPGAIRMDGK  289

Query  215  CPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERG  394
            CPLTP EVG++L  +GFDN T +Y+A+ K+Y     +  LR++FPL+E K++LAS EE  
Sbjct  290  CPLTPLEVGMMLRGMGFDNTTSVYVAAGKIYKAERYMLPLRQIFPLLETKETLASPEELA  349

Query  395  EIKGKASLLAAVDYYVGMHSDIFISA  472
              KG +S LAA+DY V +HS++F++ 
Sbjct  350  PFKGHSSRLAALDYTVCLHSEVFVTT  375



>ref|XP_006826849.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda]
 gb|ERM94086.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda]
Length=554

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 97/146 (66%), Gaps = 2/146 (1%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGR  214
            ++V+VHLRF++DM A S C F GG+ EKL +   R+  W+G+   +        +R  G+
Sbjct  315  EYVSVHLRFEEDMVAFSCCVFDGGEQEKLEMNAARERGWRGKFTRAGRVIRPGAIRINGK  374

Query  215  CPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERG  394
            CPLTP EVGL+L  +GFDNNT ++LAS ++Y     ++ L ++FPL++ K++LAS EE  
Sbjct  375  CPLTPLEVGLMLRGMGFDNNTAIFLASGRIYKAENTMAPLLQMFPLLQTKETLASDEELA  434

Query  395  EIKGKASLLAAVDYYVGMHSDIFISA  472
              K  +S +AA+DY V +HS++F++ 
Sbjct  435  PFKNYSSRMAAIDYTVCLHSEVFVTT  460



>emb|CDY50783.1| BnaA09g54120D [Brassica napus]
Length=615

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 103/157 (66%), Gaps = 4/157 (3%)
 Frame = +2

Query  5    LRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQ---GRVLN  175
            ++Y A +D+ P K++A+HLRF++DM A+S CDFGGG+ E+  L  YR+ ++     R+  
Sbjct  373  VKYSAKEDQEPLKYLALHLRFEEDMVAYSLCDFGGGETERKELQAYREDHFPLLLERLKE  432

Query  176  SQ-FTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPL  352
            S+  + EELR  GRCPLTPEE  L+LA LGF   T +YLA  ++YGG++R+  L  L+P 
Sbjct  433  SKAVSPEELRKTGRCPLTPEEATLVLAGLGFKRGTYIYLAGSQIYGGSSRMLPLTTLYPN  492

Query  353  MENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIF  463
            +  K++L + +E    K  +S LAA+D+     SD+F
Sbjct  493  LVTKETLLTPQELAPFKNFSSQLAALDFIACAASDVF  529



>ref|XP_009115262.1| PREDICTED: uncharacterized protein At1g04910-like [Brassica rapa]
Length=616

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 103/157 (66%), Gaps = 4/157 (3%)
 Frame = +2

Query  5    LRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQ---GRVLN  175
            ++Y A +D+ P K++A+HLRF++DM A+S CDFGGG+ E+  L  YR+ ++     R+  
Sbjct  374  VKYSAKEDQEPLKYLALHLRFEEDMVAYSLCDFGGGETERKELQAYREDHFPLLLERLKE  433

Query  176  SQ-FTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPL  352
            S+  + EELR  GRCPLTPEE  L+LA LGF   T +YLA  ++YGG++R+  L  L+P 
Sbjct  434  SKAVSPEELRKTGRCPLTPEEATLVLAGLGFKRGTYIYLAGSQIYGGSSRMLPLTTLYPN  493

Query  353  MENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIF  463
            +  K++L + +E    K  +S LAA+D+     SD+F
Sbjct  494  LVTKETLLTPQELAPFKNFSSQLAALDFIACAASDVF  530



>ref|XP_009345471.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Pyrus 
x bretschneideri]
Length=574

 Score =   128 bits (321),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 93/144 (65%), Gaps = 4/144 (3%)
 Frame = +2

Query  38   QKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRC  217
            + F+A+HLRF+ DM A S CD+GGG+ E+  L K R+  W+    N+    +++R  GRC
Sbjct  313  KHFIALHLRFEPDMLAFSGCDYGGGEKERKELGKLRK-RWKTLHANNP---DKVRRHGRC  368

Query  218  PLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGE  397
            PLTPEEVGL+L ALGF ++  LY+AS  VYGG   ++ L+ LFP    K++L S EE   
Sbjct  369  PLTPEEVGLMLRALGFGSDVHLYVASGDVYGGEETLAPLKTLFPNFHTKETLLSKEELAP  428

Query  398  IKGKASLLAAVDYYVGMHSDIFIS  469
                +S +AA+D+ V   SD+F++
Sbjct  429  FSSFSSRMAALDFIVCDESDVFVT  452


 Score = 40.8 bits (94),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 5/61 (8%)
 Frame = +3

Query  480  ANMHNAMVGHRTYHNLK-TIRPNMQLLGQLFLNK-NLTWPEFXDAVIE---GHANRPGEI  644
             NM   + G R Y   K TIRPN + L QLF+N+ N+TW EF   +     G    P E+
Sbjct  456  GNMAKMLAGRRRYFGHKPTIRPNAKKLSQLFINRNNMTWEEFASRIRTDQIGFLGEPNEV  515

Query  645  R  647
            +
Sbjct  516  K  516



>ref|XP_002513766.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48349.1| conserved hypothetical protein [Ricinus communis]
Length=591

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 98/150 (65%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            K+V+VHLRF++DM A S C + GG AEKL +A  R++ W+G      RV+         R
Sbjct  337  KYVSVHLRFEEDMVAFSCCVYDGGDAEKLKMASIRELEWKGKFKRKDRVILPGLN----R  392

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
             +G+CPLTP EVG++L  +GFDNNT +YLAS K+Y     ++ L ++FPL+  K SLA+ 
Sbjct  393  IEGKCPLTPLEVGMMLRGMGFDNNTAIYLASGKIYKAERHLAPLLQMFPLLYTKDSLATV  452

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            +E    +G +S LAA+DY V + S++F++ 
Sbjct  453  DELAPFEGYSSRLAALDYTVCLFSEVFVTT  482



>gb|EEC68940.1| hypothetical protein OsI_37646 [Oryza sativa Indica Group]
Length=566

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 95/150 (63%), Gaps = 10/150 (7%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELR  202
            KFV+VHLRF++DM A S C + GG  EK  +   R+  W+G      RV+N     E  R
Sbjct  335  KFVSVHLRFEEDMVAFSCCTYDGGLKEKTEMENARERSWRGKFHRHGRVINP----EANR  390

Query  203  SQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASS  382
              G+CPLTP EVG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K +LA  
Sbjct  391  RDGKCPLTPLEVGMMLRGMGFDNTTSLYVASGKIYNAEKYMAPLRQMFPLLATKDTLALP  450

Query  383  EERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            EE  E +G +S LAA+DY V + S++F++ 
Sbjct  451  EELAEFEGHSSRLAALDYSVCLPSEVFVTT  480



>ref|NP_001117378.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AEE31060.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
Length=421

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 99/150 (66%), Gaps = 4/150 (3%)
 Frame = +2

Query  26   DEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ----FTDE  193
            +E P K++A+HLRF++DM A+S CDFGGG+AE+  L  YR+ ++   +   +     + E
Sbjct  186  EEEPLKYLALHLRFEEDMVAYSLCDFGGGEAERKELQAYREDHFPLLLKRLKKSKPVSPE  245

Query  194  ELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSL  373
            ELR  G+CPLTPEE  L+LA LGF   T +YLA  ++YGG++R+  L RL+P +  K++L
Sbjct  246  ELRKTGKCPLTPEEATLVLAGLGFKRKTYIYLAGSQIYGGSSRMLPLTRLYPNIATKETL  305

Query  374  ASSEERGEIKGKASLLAAVDYYVGMHSDIF  463
             + +E    K  +S LAA+D+   + SD+F
Sbjct  306  LTPQELAPFKNFSSQLAALDFIACIASDVF  335



>ref|XP_009799749.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nicotiana 
sylvestris]
Length=625

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQ---GRVLNSQ-FTDEE  196
            EGP K++A+HLRF+ DM A+S C+FGGG+ E+  L  YRQ+++     R+  S+ ++ EE
Sbjct  391  EGPSKYLALHLRFEIDMVAYSMCEFGGGETERRELQTYRQVHFPLLLERLKESKSYSPEE  450

Query  197  LRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLA  376
            LR  G+CPLTPEE  L+LA LGF + T +YLA   +YGG +R+ AL  L+P +  K++L 
Sbjct  451  LRRMGKCPLTPEEAALVLAGLGFKHGTYIYLAGSDIYGGQSRMQALTTLYPNLVTKENLL  510

Query  377  SSEERGEIKGKASLLAAVDYYVGMHSDIF  463
            S  E    +  +S LAA+D+     SD+F
Sbjct  511  SPSELAPFRNFSSQLAALDFIACATSDVF  539



>ref|XP_009604296.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nicotiana 
tomentosiformis]
Length=622

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 100/156 (64%), Gaps = 4/156 (3%)
 Frame = +2

Query  8    RYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQ---GRVLNS  178
            R   S  EGP K++A+HLRF+ DM A+S C+FGGG+ E+  L  YRQ+++     R+  S
Sbjct  381  RVDHSAAEGPSKYLALHLRFEIDMVAYSLCEFGGGETERRELQTYRQVHFPLLLERLKES  440

Query  179  Q-FTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
            + ++ EELR  G+CPLTPEE  L+LA LGF + T +YLA   +YGG +R+ AL  L+P +
Sbjct  441  KSYSPEELRRMGKCPLTPEEAALVLAGLGFKHGTYIYLAGSDIYGGQSRMQALTTLYPNL  500

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIF  463
              K++L S  E    +  +S LAA+D+     SD+F
Sbjct  501  VTKENLLSPSELAPFRNFSSQLAALDFIACATSDVF  536



>ref|NP_174215.2| O-fucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAX23764.1| hypothetical protein At1g29200 [Arabidopsis thaliana]
 gb|AAZ52699.1| hypothetical protein At1g29200 [Arabidopsis thaliana]
 gb|AEE31058.1| O-fucosyltransferase-like protein [Arabidopsis thaliana]
Length=495

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 99/150 (66%), Gaps = 4/150 (3%)
 Frame = +2

Query  26   DEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ----FTDE  193
            +E P K++A+HLRF++DM A+S CDFGGG+AE+  L  YR+ ++   +   +     + E
Sbjct  260  EEEPLKYLALHLRFEEDMVAYSLCDFGGGEAERKELQAYREDHFPLLLKRLKKSKPVSPE  319

Query  194  ELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSL  373
            ELR  G+CPLTPEE  L+LA LGF   T +YLA  ++YGG++R+  L RL+P +  K++L
Sbjct  320  ELRKTGKCPLTPEEATLVLAGLGFKRKTYIYLAGSQIYGGSSRMLPLTRLYPNIATKETL  379

Query  374  ASSEERGEIKGKASLLAAVDYYVGMHSDIF  463
             + +E    K  +S LAA+D+   + SD+F
Sbjct  380  LTPQELAPFKNFSSQLAALDFIACIASDVF  409



>gb|EYU22927.1| hypothetical protein MIMGU_mgv1a018388mg, partial [Erythranthe 
guttata]
Length=451

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 95/146 (65%), Gaps = 2/146 (1%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVL--NSQFTDEELRSQGR  214
            K+V+VHLRF++DM A S C + GG  EK  +   R+  W  + +  N  F     R  GR
Sbjct  209  KYVSVHLRFEEDMVAFSCCVYDGGDTEKSDMDAIREKGWGKKFMQKNRTFAPGLNRVNGR  268

Query  215  CPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERG  394
            CP+TP EVG++L  +GF NNT +YLAS  +Y     +  LR++FPL++ K+SLA+S+E  
Sbjct  269  CPMTPVEVGMMLRGMGFSNNTSIYLASGTIYHEERYLEPLRKMFPLLQTKESLATSDELA  328

Query  395  EIKGKASLLAAVDYYVGMHSDIFISA  472
             I+G +S LAA+DY V ++S++F++ 
Sbjct  329  SIQGFSSRLAALDYMVCLYSEVFVTT  354



>ref|XP_009799748.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nicotiana 
sylvestris]
Length=629

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 98/149 (66%), Gaps = 4/149 (3%)
 Frame = +2

Query  29   EGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQ---GRVLNSQ-FTDEE  196
            EGP K++A+HLRF+ DM A+S C+FGGG+ E+  L  YRQ+++     R+  S+ ++ EE
Sbjct  395  EGPSKYLALHLRFEIDMVAYSMCEFGGGETERRELQTYRQVHFPLLLERLKESKSYSPEE  454

Query  197  LRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLA  376
            LR  G+CPLTPEE  L+LA LGF + T +YLA   +YGG +R+ AL  L+P +  K++L 
Sbjct  455  LRRMGKCPLTPEEAALVLAGLGFKHGTYIYLAGSDIYGGQSRMQALTTLYPNLVTKENLL  514

Query  377  SSEERGEIKGKASLLAAVDYYVGMHSDIF  463
            S  E    +  +S LAA+D+     SD+F
Sbjct  515  SPSELAPFRNFSSQLAALDFIACATSDVF  543



>ref|XP_010103337.1| hypothetical protein L484_014377 [Morus notabilis]
 gb|EXB95404.1| hypothetical protein L484_014377 [Morus notabilis]
Length=601

 Score =   128 bits (322),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 96/144 (67%), Gaps = 4/144 (3%)
 Frame = +2

Query  38   QKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRC  217
            + F+A+HLRF+ DM A S CDFGGG+ E++ L   R+  W+   L++   D+ +R  GRC
Sbjct  293  KHFIALHLRFEPDMLAFSGCDFGGGEKERVELGAIRK-RWKS--LHTSNPDK-VRRNGRC  348

Query  218  PLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGE  397
            PLTPEEVGL+L ALGF ++  LY+AS +VYGG   ++ L++LF     K+++AS EE   
Sbjct  349  PLTPEEVGLMLRALGFGSDVHLYVASGEVYGGEETLAPLKKLFANFHTKETIASKEELAP  408

Query  398  IKGKASLLAAVDYYVGMHSDIFIS  469
                +S +AA+D+ V   SD+F+S
Sbjct  409  FTSFSSRMAALDFIVCDESDVFVS  432


 Score = 39.7 bits (91),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 32/60 (53%), Gaps = 5/60 (8%)
 Frame = +3

Query  483  NMHNAMVGHRTYHNLK-TIRPNMQLLGQLFLNK-NLTWPEFXDAVIE---GHANRPGEIR  647
            NM   + G R Y   K TIRPN + L +LF+N+ N+TW EF   V     G    P EI+
Sbjct  437  NMARMLAGRRRYFGHKPTIRPNAKKLYKLFMNRHNMTWEEFASKVQTHQIGFMGEPNEIK  496



>ref|XP_010262908.1| PREDICTED: uncharacterized protein At1g04910-like isoform X5 
[Nelumbo nucifera]
Length=510

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 101/159 (64%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS-  178
            R++  ++ + G  K+VAVHLRF++DM A S C F GG+ EK  +   R+  W+G+     
Sbjct  313  RMKLNSANNNG--KYVAVHLRFEEDMVAFSCCVFDGGEEEKHDMNAARERGWRGKFTKPG  370

Query  179  -QFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
                   +R  G+CPLTP EVGL+L  +GFDN+T +YLAS K+Y     ++ L  +FPL+
Sbjct  371  RVIKPGAIRINGKCPLTPLEVGLMLRGMGFDNSTSIYLASGKIYKAEKTMAPLLEMFPLL  430

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            + K++LAS EE    K  +S +AA+DY V +HS++F++ 
Sbjct  431  QTKETLASVEELAPFKNYSSRMAALDYTVCLHSEVFVTT  469



>ref|XP_009373425.1| PREDICTED: uncharacterized protein At1g04910-like [Pyrus x bretschneideri]
Length=516

 Score =   126 bits (317),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 93/144 (65%), Gaps = 4/144 (3%)
 Frame = +2

Query  38   QKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRC  217
            + F+A+HLRF+ DM A S CD+GGG+ E+  L K R+ +   + L++   D+ +R  GRC
Sbjct  313  KHFIALHLRFEPDMLAFSGCDYGGGEKERKELGKLRKRW---KTLHASNPDK-VRRHGRC  368

Query  218  PLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGE  397
            PLTPEEVGL+L ALGF  +  LY+AS  VYGG   ++ L+ LFP    K++L S EE   
Sbjct  369  PLTPEEVGLMLRALGFGRDVHLYVASGDVYGGEETLAPLKTLFPNFHTKETLLSKEELAP  428

Query  398  IKGKASLLAAVDYYVGMHSDIFIS  469
                +S +AA+D+ V   SD+F++
Sbjct  429  FSSFSSRMAALDFIVCDESDVFVT  452


 Score = 41.2 bits (95),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 28/46 (61%), Gaps = 2/46 (4%)
 Frame = +3

Query  480  ANMHNAMVGHRTYHNLK-TIRPNMQLLGQLFLNK-NLTWPEFXDAV  611
             NM   + G R Y + K TIRPN + L QLF+N+ N+TW EF   +
Sbjct  456  GNMAKMLAGRRRYFDHKPTIRPNAKKLSQLFINRNNMTWEEFASRI  501



>ref|XP_009604295.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nicotiana 
tomentosiformis]
Length=626

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 100/156 (64%), Gaps = 4/156 (3%)
 Frame = +2

Query  8    RYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQ---GRVLNS  178
            R   S  EGP K++A+HLRF+ DM A+S C+FGGG+ E+  L  YRQ+++     R+  S
Sbjct  385  RVDHSAAEGPSKYLALHLRFEIDMVAYSLCEFGGGETERRELQTYRQVHFPLLLERLKES  444

Query  179  Q-FTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
            + ++ EELR  G+CPLTPEE  L+LA LGF + T +YLA   +YGG +R+ AL  L+P +
Sbjct  445  KSYSPEELRRMGKCPLTPEEAALVLAGLGFKHGTYIYLAGSDIYGGQSRMQALTTLYPNL  504

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIF  463
              K++L S  E    +  +S LAA+D+     SD+F
Sbjct  505  VTKENLLSPSELAPFRNFSSQLAALDFIACATSDVF  540



>ref|XP_010262622.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=563

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 101/159 (64%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS-  178
            R++  ++ + G  K+VAVHLRF++DM A S C F GG+ EK  +   R+  W+G+     
Sbjct  313  RMKLNSANNNG--KYVAVHLRFEEDMVAFSCCVFDGGEEEKHDMNAARERGWRGKFTKPG  370

Query  179  -QFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
                   +R  G+CPLTP EVGL+L  +GFDN+T +YLAS K+Y     ++ L  +FPL+
Sbjct  371  RVIKPGAIRINGKCPLTPLEVGLMLRGMGFDNSTSIYLASGKIYKAEKTMAPLLEMFPLL  430

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            + K++LAS EE    K  +S +AA+DY V +HS++F++ 
Sbjct  431  QTKETLASVEELAPFKNYSSRMAALDYTVCLHSEVFVTT  469



>ref|XP_004970534.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=564

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 100/159 (63%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS-  178
            R+R  ++++ G  K+VAVHLRF++DM A S C F GG  EK  L   R+  W+G+     
Sbjct  314  RMREKSAENNG--KYVAVHLRFEEDMVAFSCCVFDGGDNEKKELDAAREKGWRGKFTRPG  371

Query  179  -QFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
                   +R  G+CPLTP EVGL+L  +GF NNT +YLAS ++Y     ++ L  +FPL+
Sbjct  372  RVIRPGAIRMNGKCPLTPLEVGLMLRGMGFSNNTAIYLASGRIYKAEKNMAPLLEMFPLL  431

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            + K++LAS EE    K  +S +AA+DY V +HS++F++ 
Sbjct  432  QTKETLASDEELSPFKNFSSRMAAIDYSVCVHSEVFVTT  470



>ref|XP_010262851.1| PREDICTED: uncharacterized protein At1g04910-like isoform X4 
[Nelumbo nucifera]
Length=539

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 101/159 (64%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS-  178
            R++  ++ + G  K+VAVHLRF++DM A S C F GG+ EK  +   R+  W+G+     
Sbjct  313  RMKLNSANNNG--KYVAVHLRFEEDMVAFSCCVFDGGEEEKHDMNAARERGWRGKFTKPG  370

Query  179  -QFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
                   +R  G+CPLTP EVGL+L  +GFDN+T +YLAS K+Y     ++ L  +FPL+
Sbjct  371  RVIKPGAIRINGKCPLTPLEVGLMLRGMGFDNSTSIYLASGKIYKAEKTMAPLLEMFPLL  430

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            + K++LAS EE    K  +S +AA+DY V +HS++F++ 
Sbjct  431  QTKETLASVEELAPFKNYSSRMAALDYTVCLHSEVFVTT  469



>ref|XP_010262779.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Nelumbo nucifera]
Length=542

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 101/159 (64%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS-  178
            R++  ++ + G  K+VAVHLRF++DM A S C F GG+ EK  +   R+  W+G+     
Sbjct  313  RMKLNSANNNG--KYVAVHLRFEEDMVAFSCCVFDGGEEEKHDMNAARERGWRGKFTKPG  370

Query  179  -QFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
                   +R  G+CPLTP EVGL+L  +GFDN+T +YLAS K+Y     ++ L  +FPL+
Sbjct  371  RVIKPGAIRINGKCPLTPLEVGLMLRGMGFDNSTSIYLASGKIYKAEKTMAPLLEMFPLL  430

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            + K++LAS EE    K  +S +AA+DY V +HS++F++ 
Sbjct  431  QTKETLASVEELAPFKNYSSRMAALDYTVCLHSEVFVTT  469



>ref|XP_010262705.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nelumbo nucifera]
Length=551

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 101/159 (64%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS-  178
            R++  ++ + G  K+VAVHLRF++DM A S C F GG+ EK  +   R+  W+G+     
Sbjct  313  RMKLNSANNNG--KYVAVHLRFEEDMVAFSCCVFDGGEEEKHDMNAARERGWRGKFTKPG  370

Query  179  -QFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
                   +R  G+CPLTP EVGL+L  +GFDN+T +YLAS K+Y     ++ L  +FPL+
Sbjct  371  RVIKPGAIRINGKCPLTPLEVGLMLRGMGFDNSTSIYLASGKIYKAEKTMAPLLEMFPLL  430

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            + K++LAS EE    K  +S +AA+DY V +HS++F++ 
Sbjct  431  QTKETLASVEELAPFKNYSSRMAALDYTVCLHSEVFVTT  469



>ref|XP_010695805.1| PREDICTED: uncharacterized protein At1g04910-like [Beta vulgaris 
subsp. vulgaris]
Length=572

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 93/146 (64%), Gaps = 2/146 (1%)
 Frame = +2

Query  41   KFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ--FTDEELRSQGR  214
            K+V+VHLRF++DM A S C F GGK EKL +   R+  W+G+            +R  G+
Sbjct  333  KYVSVHLRFEEDMVAFSCCIFDGGKQEKLDMEAARERGWRGKFTKPGRIIRPGAIRINGK  392

Query  215  CPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERG  394
            CPLTP EVGL+L  +GFD NT +YLAS K+Y     ++ L  +FPL++ K+ LAS EE  
Sbjct  393  CPLTPLEVGLMLRGMGFDRNTSIYLASGKIYDAERNMAPLFEMFPLLQTKEMLASPEELA  452

Query  395  EIKGKASLLAAVDYYVGMHSDIFISA  472
              +  +S +AA+DY V +HS++F++ 
Sbjct  453  SYQNYSSRMAAIDYTVCLHSEVFVTT  478



>ref|XP_010274715.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=558

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 100/159 (63%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    RLRYPASKDEGPQKFVAVHLRFDKDMAAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS-  178
            R++  ++K+ G  K++AVHLRF++DM A S C F GGK E   +   R+  W+G+     
Sbjct  308  RMKERSAKNNG--KYIAVHLRFEEDMVAFSCCVFDGGKEEMQEMNAARERGWRGKFTKPG  365

Query  179  -QFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLM  355
                   +R  G+CPLTP EVGL+L  +GFDN+T +YLAS K+Y     ++ L  +FPL+
Sbjct  366  RVIRPGAIRINGKCPLTPLEVGLMLRGMGFDNSTSIYLASGKIYKAEKTMAPLLEMFPLL  425

Query  356  ENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISA  472
            + K +LAS EE    K  +S +AA+DY V +HS++F++ 
Sbjct  426  QTKDTLASMEELAPFKNFSSRMAAIDYTVCLHSEVFVTT  464



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600