BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF045K14

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|WP_032263054.1|  isochorismate synthase                             269   1e-88   
ref|WP_000389165.1|  isochorismate synthase EntC                        272   3e-86   
gb|ESD40405.1|  isochorismate synthase                                  271   3e-86   Escherichia coli 908519
gb|ABE06095.1|  isochorismate synthase                                  271   3e-86   Escherichia coli UTI89
gb|EGI16630.1|  isochorismate synthase EntC (Isochorismate mutase)      271   4e-86   Escherichia coli M605
gb|AAB40793.1|  isochorismate synthase                                  271   4e-86   Escherichia coli [E. coli]
ref|WP_044068683.1|  isochorismate synthase                             265   4e-86   
ref|WP_042957411.1|  isochorismate synthase                             262   4e-86   
gb|KEN97766.1|  isochorismate synthase entC domain protein              262   7e-86   Escherichia coli 2-222-05_S3_C1
ref|WP_000381305.1|  hypothetical protein                               263   9e-86   
ref|WP_044070716.1|  isochorismate synthase                             264   1e-85   
ref|WP_042099941.1|  isochorismate synthase                             262   1e-85   
gb|EFK50652.1|  isochorismate synthase                                  270   1e-85   Escherichia coli MS 107-1
gb|ESA68049.1|  isochorismate synthase                                  270   1e-85   Escherichia coli 110957
gb|ADB98051.1|  EntC                                                    270   2e-85   Escherichia coli [E. coli]
gb|KDW87190.1|  isochorismate synthase entC domain protein              261   2e-85   Escherichia coli 2-210-07_S4_C1
gb|EFO58180.1|  isochorismate synthase                                  270   2e-85   Escherichia coli MS 145-7
gb|EFK18973.1|  isochorismate synthase                                  270   2e-85   Escherichia coli MS 21-1
emb|CDL28450.1|  isochorismate synthase                                 263   2e-85   Escherichia coli ISC7
gb|ABJ00014.1|  isochorismate synthase                                  269   3e-85   Escherichia coli APEC O1
ref|WP_032257963.1|  isochorismate synthase                             259   3e-85   
ref|WP_042105440.1|  isochorismate synthase                             266   4e-85   Escherichia coli [E. coli]
ref|WP_044712706.1|  isochorismate synthase                             259   5e-85   
gb|EFJ79637.1|  isochorismate synthase                                  268   7e-85   Escherichia coli MS 69-1
ref|WP_032263476.1|  isochorismate synthase                             266   7e-85   Escherichia coli [E. coli]
gb|EGI42441.1|  isochorismate synthase EntC (Isochorismate mutase)      268   7e-85   Escherichia coli TA280
gb|EGI32345.1|  isochorismate synthase EntC (Isochorismate mutase)      268   8e-85   Escherichia coli TA143
ref|WP_044815215.1|  isochorismate synthase                             265   9e-85   
ref|WP_023567826.1|  isochorismate synthase                             265   2e-84   
gb|ESA82367.1|  isochorismate synthase                                  266   3e-84   Escherichia coli 907713
ref|WP_001305553.1|  isochorismate synthase entC                        261   3e-84   
ref|WP_042105912.1|  isochorismate synthase                             263   4e-84   Escherichia coli [E. coli]
gb|ESD05224.1|  isochorismate synthase                                  266   7e-84   Escherichia coli 907672
gb|EGI21937.1|  isochorismate synthase EntC (Isochorismate mutase)      266   7e-84   Escherichia coli M718
ref|WP_032084147.1|  isochorismate synthase                             264   9e-84   
ref|WP_001336900.1|  isochorismate synthase EntC                        265   1e-83   Escherichia coli [E. coli]
ref|WP_001455372.1|  isochorismate synthase EntC                        265   1e-83   Escherichia coli [E. coli]
ref|WP_001476831.1|  isochorismate synthase EntC                        265   2e-83   Escherichia coli [E. coli]
pdb|3HWO|A  Chain A, Crystal Structure Of Escherichia Coli Entero...    265   2e-83   Escherichia coli K-12
ref|WP_034173296.1|  isochorismate synthase                             265   2e-83   Escherichia coli [E. coli]
ref|WP_033554952.1|  isochorismate synthase                             265   2e-83   Escherichia coli [E. coli]
ref|WP_021540154.1|  isochorismate synthase entC                        264   2e-83   Escherichia coli [E. coli]
ref|WP_001651712.1|  isochorismate synthase entC                        264   2e-83   Escherichia coli [E. coli]
ref|WP_024218995.1|  isochorismate synthase                             264   2e-83   Escherichia coli [E. coli]
ref|WP_001295851.1|  isochorismate synthase EntC                        264   2e-83   Escherichia coli [E. coli]
ref|WP_001298341.1|  MULTISPECIES: isochorismate synthase EntC          264   2e-83   Escherichia
ref|WP_032304745.1|  isochorismate synthase                             264   2e-83   Escherichia coli [E. coli]
ref|WP_001359696.1|  isochorismate synthase EntC                        264   2e-83   Escherichia coli [E. coli]
ref|WP_032248681.1|  isochorismate synthase                             264   2e-83   Escherichia coli [E. coli]
ref|WP_000381303.1|  MULTISPECIES: isochorismate synthase 1             264   2e-83   Proteobacteria [purple bacteria]
gb|AAA18491.1|  iron chelator protein                                   264   2e-83   Escherichia coli [E. coli]
ref|WP_001337908.1|  isochorismate synthase EntC                        264   2e-83   Enterobacteriaceae
ref|WP_001535886.1|  isochorismate synthase entC                        264   2e-83   Escherichia coli [E. coli]
gb|KHH67516.1|  isochorismate synthase                                  264   2e-83   Escherichia coli [E. coli]
ref|WP_001694650.1|  isochorismate synthase entC                        264   2e-83   Escherichia coli [E. coli]
ref|WP_032234407.1|  isochorismate synthase                             264   2e-83   Escherichia coli [E. coli]
ref|WP_024238608.1|  isochorismate synthase                             264   2e-83   Escherichia coli [E. coli]
ref|WP_001619219.1|  isochorismate synthase entC                        264   2e-83   Escherichia coli [E. coli]
ref|WP_001572625.1|  isochorismate synthase entC                        264   2e-83   Escherichia coli [E. coli]
ref|WP_044694323.1|  isochorismate synthase                             264   2e-83   Escherichia coli [E. coli]
ref|WP_042012964.1|  isochorismate synthase                             264   3e-83   Escherichia coli [E. coli]
ref|WP_032208731.1|  isochorismate synthase                             264   3e-83   Escherichia coli [E. coli]
ref|WP_001405574.1|  isochorismate synthase EntC                        264   3e-83   Escherichia coli [E. coli]
ref|WP_042108504.1|  isochorismate synthase                             263   3e-83   Escherichia coli [E. coli]
ref|WP_021514949.1|  isochorismate synthase entC                        264   3e-83   Escherichia coli [E. coli]
ref|WP_038817186.1|  isochorismate synthase                             263   4e-83   
gb|EGC96072.1|  EntC                                                    263   4e-83   Escherichia fergusonii ECD227
ref|WP_023281825.1|  isochorismate synthase entC                        263   5e-83   Escherichia coli [E. coli]
ref|WP_005116406.1|  isochorismate synthase EntC                        263   5e-83   
ref|WP_004980869.1|  MULTISPECIES: isochorismate synthase EntC          263   6e-83   Enterobacteriaceae
ref|WP_032359848.1|  isochorismate synthase                             263   6e-83   Escherichia coli [E. coli]
ref|WP_032205789.1|  isochorismate synthase                             263   7e-83   Escherichia coli [E. coli]
ref|WP_001529596.1|  isochorismate synthase entC                        263   7e-83   Escherichia coli [E. coli]
ref|WP_001522524.1|  isochorismate synthase entC                        263   7e-83   Enterobacteriaceae
ref|WP_001711554.1|  isochorismate synthase entC                        263   7e-83   Escherichia coli [E. coli]
ref|WP_032343549.1|  isochorismate synthase                             263   7e-83   Escherichia coli [E. coli]
ref|WP_023278239.1|  isochorismate synthase entC                        263   7e-83   Escherichia coli [E. coli]
ref|WP_016244378.1|  isochorismate synthase entC                        263   8e-83   Escherichia coli [E. coli]
ref|WP_001625041.1|  isochorismate synthase entC                        263   8e-83   Escherichia coli [E. coli]
ref|WP_024240944.1|  isochorismate synthase                             263   8e-83   Escherichia coli [E. coli]
ref|WP_001351525.1|  isochorismate synthase EntC                        263   8e-83   Enterobacteriaceae
ref|WP_005024896.1|  isochorismate synthase EntC                        263   8e-83   Shigella
ref|WP_032229675.1|  isochorismate synthase                             263   8e-83   Escherichia coli [E. coli]
ref|WP_012421470.1|  MULTISPECIES: isochorismate synthase EntC          263   8e-83   Shigella boydii
ref|WP_033800941.1|  isochorismate synthase                             263   9e-83   Escherichia coli [E. coli]
ref|WP_001297274.1|  isochorismate synthase EntC                        263   9e-83   Enterobacteriaceae
ref|WP_044188617.1|  isochorismate synthase                             263   1e-82   Escherichia coli [E. coli]
ref|WP_041328331.1|  isochorismate synthase                             263   1e-82   Escherichia coli [E. coli]
ref|WP_001571088.1|  isochorismate synthase entC                        263   1e-82   Enterobacteriaceae
ref|WP_001466878.1|  isochorismate synthase entC                        263   1e-82   Escherichia coli [E. coli]
ref|WP_001465215.1|  isochorismate synthase entC                        263   1e-82   Enterobacteriaceae
ref|WP_001381853.1|  isochorismate synthase entC                        263   1e-82   Escherichia coli [E. coli]
ref|WP_001448432.1|  isochorismate synthase EntC                        263   1e-82   Escherichia coli [E. coli]
ref|WP_001378779.1|  isochorismate synthase EntC                        263   1e-82   Escherichia coli [E. coli]
ref|WP_001295313.1|  isochorismate synthase EntC                        263   1e-82   Enterobacteriaceae
ref|WP_024247750.1|  isochorismate synthase                             263   1e-82   Escherichia coli [E. coli]
ref|WP_012602222.1|  isochorismate synthase EntC                        262   1e-82   Enterobacteriaceae
ref|WP_001444946.1|  isochorismate synthase EntC                        262   1e-82   Escherichia coli [E. coli]
ref|WP_001591663.1|  isochorismate synthase entC                        262   1e-82   Escherichia coli [E. coli]
ref|WP_001601850.1|  isochorismate synthase entC                        262   1e-82   Escherichia coli [E. coli]
ref|WP_044687897.1|  isochorismate synthase                             262   1e-82   Escherichia coli [E. coli]
ref|WP_032202769.1|  isochorismate synthase                             262   1e-82   Escherichia coli [E. coli]
ref|WP_001361270.1|  isochorismate synthase EntC                        262   1e-82   Escherichia
ref|WP_042099633.1|  isochorismate synthase                             262   1e-82   Escherichia coli [E. coli]
ref|WP_001721171.1|  isochorismate synthase entC                        262   1e-82   Escherichia coli [E. coli]
ref|WP_001620485.1|  isochorismate synthase entC                        262   1e-82   Escherichia coli [E. coli]
ref|WP_032277975.1|  isochorismate synthase                             262   1e-82   Escherichia coli [E. coli]
ref|WP_024232038.1|  isochorismate synthase                             262   1e-82   Escherichia coli [E. coli]
ref|WP_040062414.1|  isochorismate synthase                             262   1e-82   Escherichia coli [E. coli]
ref|WP_001479118.1|  isochorismate synthase entC                        262   1e-82   Escherichia coli [E. coli]
ref|WP_001501799.1|  isochorismate synthase entC                        262   1e-82   Escherichia coli [E. coli]
ref|WP_012601363.1|  isochorismate synthase EntC                        262   1e-82   Escherichia coli [E. coli]
ref|WP_042200307.1|  isochorismate synthase                             262   2e-82   Escherichia coli [E. coli]
ref|WP_001382923.1|  isochorismate synthase EntC                        262   2e-82   Escherichia coli [E. coli]
ref|WP_014639855.1|  isochorismate synthase EntC                        262   2e-82   Escherichia coli [E. coli]
ref|WP_042107748.1|  isochorismate synthase                             262   2e-82   Escherichia coli [E. coli]
ref|WP_001550788.1|  isochorismate synthase entC                        262   2e-82   Enterobacteriaceae
ref|WP_001366512.1|  isochorismate synthase EntC                        262   2e-82   Enterobacteriaceae
ref|WP_001561618.1|  isochorismate synthase entC                        262   2e-82   Escherichia coli [E. coli]
ref|WP_044381867.1|  isochorismate synthase                             260   2e-82   Escherichia coli [E. coli]
ref|WP_001308469.1|  isochorismate synthase EntC                        262   2e-82   Escherichia coli [E. coli]
ref|WP_001484389.1|  isochorismate synthase entC                        261   2e-82   Escherichia coli [E. coli]
ref|WP_032237441.1|  isochorismate synthase                             261   3e-82   Escherichia coli [E. coli]
ref|WP_001532401.1|  isochorismate synthase entC                        261   3e-82   Escherichia coli [E. coli]
ref|WP_001490901.1|  isochorismate synthase EntC                        261   3e-82   Escherichia coli [E. coli]
ref|WP_042096337.1|  isochorismate synthase                             261   3e-82   Escherichia coli [E. coli]
ref|WP_001471198.1|  isochorismate synthase entC                        261   3e-82   Escherichia coli [E. coli]
ref|WP_001571368.1|  isochorismate synthase entC                        261   3e-82   Escherichia coli [E. coli]
ref|WP_001427126.1|  isochorismate synthase EntC                        261   3e-82   Escherichia coli [E. coli]
ref|WP_001684702.1|  isochorismate synthase entC                        261   3e-82   Escherichia coli [E. coli]
ref|WP_001317684.1|  isochorismate synthase EntC                        261   3e-82   Escherichia coli [E. coli]
ref|WP_001379582.1|  isochorismate synthase EntC                        261   3e-82   Escherichia coli [E. coli]
ref|WP_033817361.1|  isochorismate synthase                             261   3e-82   Escherichia coli [E. coli]
ref|WP_001345701.1|  isochorismate synthase EntC                        261   3e-82   Escherichia coli [E. coli]
ref|WP_021564064.1|  isochorismate synthase entC                        261   4e-82   Escherichia coli [E. coli]
ref|WP_032241550.1|  isochorismate synthase                             261   4e-82   Escherichia coli [E. coli]
ref|WP_001389896.1|  isochorismate synthase EntC                        261   4e-82   Escherichia coli [E. coli]
ref|WP_021573741.1|  isochorismate synthase entC                        261   4e-82   Escherichia coli [E. coli]
ref|WP_025491956.1|  isochorismate synthase                             261   4e-82   Escherichia coli [E. coli]
ref|WP_044688479.1|  isochorismate synthase                             261   4e-82   Escherichia coli [E. coli]
ref|WP_024212089.1|  isochorismate synthase                             261   4e-82   Escherichia
ref|WP_002431411.1|  MULTISPECIES: isochorismate synthase EntC          261   4e-82   Escherichia
ref|WP_032292717.1|  isochorismate synthase                             261   4e-82   Escherichia coli [E. coli]
ref|WP_001648551.1|  isochorismate synthase entC                        261   4e-82   Escherichia coli [E. coli]
ref|WP_024211635.1|  isochorismate synthase                             261   4e-82   
ref|WP_001512249.1|  isochorismate synthase entC                        261   5e-82   Escherichia coli [E. coli]
ref|WP_032170888.1|  isochorismate synthase                             261   5e-82   Escherichia coli [E. coli]
ref|WP_024226873.1|  isochorismate synthase                             261   5e-82   Escherichia coli [E. coli]
ref|WP_001552555.1|  isochorismate synthase entC                        261   5e-82   Escherichia coli [E. coli]
ref|WP_044806139.1|  isochorismate synthase                             260   7e-82   Escherichia coli [E. coli]
ref|WP_001704865.1|  isochorismate synthase entC                        260   7e-82   Escherichia coli [E. coli]
ref|WP_001487018.1|  isochorismate synthase entC                        260   8e-82   Escherichia coli [E. coli]
ref|WP_001307665.1|  isochorismate synthase EntC                        260   8e-82   Escherichia coli [E. coli]
ref|WP_001446422.1|  isochorismate synthase EntC                        260   9e-82   Escherichia coli [E. coli]
ref|WP_001616613.1|  isochorismate synthase entC                        260   9e-82   Escherichia coli [E. coli]
ref|WP_021036428.1|  isochorismate synthase EntC                        260   1e-81   Escherichia coli [E. coli]
ref|WP_001309338.1|  MULTISPECIES: isochorismate synthase EntC          260   1e-81   Escherichia
ref|WP_001666377.1|  isochorismate synthase entC                        260   1e-81   Escherichia coli [E. coli]
ref|WP_001657880.1|  isochorismate synthase entC                        259   1e-81   Escherichia coli [E. coli]
gb|AHE58774.1|  isochorismate synthase, entC                            259   2e-81   Escherichia albertii KF1
ref|WP_042039409.1|  isochorismate synthase                             259   2e-81   Escherichia coli [E. coli]
ref|WP_032221983.1|  isochorismate synthase                             259   2e-81   Escherichia coli [E. coli]
ref|WP_032352401.1|  isochorismate synthase                             259   2e-81   Escherichia coli [E. coli]
ref|WP_001544326.1|  isochorismate synthase entC                        259   2e-81   Escherichia coli [E. coli]
ref|WP_039021064.1|  isochorismate synthase                             259   2e-81   Escherichia
ref|WP_033868134.1|  isochorismate synthase                             259   3e-81   Escherichia coli [E. coli]
ref|WP_010352083.1|  MULTISPECIES: isochorismate synthase EntC          259   3e-81   Escherichia
ref|WP_001401287.1|  isochorismate synthase EntC                        259   3e-81   Escherichia coli [E. coli]
ref|WP_001354841.1|  isochorismate synthase EntC                        259   3e-81   Escherichia
ref|WP_024257730.1|  isochorismate synthase                             258   4e-81   Escherichia coli [E. coli]
ref|WP_012565048.1|  isochorismate synthase EntC                        258   5e-81   Escherichia coli [E. coli]
ref|WP_001301140.1|  isochorismate synthase EntC                        258   5e-81   Enterobacteriaceae
ref|WP_012311984.1|  isochorismate synthase EntC                        258   5e-81   Escherichia coli [E. coli]
ref|WP_001353366.1|  MULTISPECIES: isochorismate synthase EntC          258   5e-81   Escherichia
ref|WP_001509658.1|  isochorismate synthase entC                        258   5e-81   Escherichia coli [E. coli]
ref|WP_001719822.1|  isochorismate synthase entC                        258   6e-81   Escherichia coli [E. coli]
ref|WP_001427091.1|  isochorismate synthase entC                        258   8e-81   Escherichia coli [E. coli]
ref|WP_010355437.1|  isochorismate synthase EntC                        258   9e-81   Escherichia
ref|WP_005141144.1|  isochorismate synthase EntC                        258   9e-81   Shigella
ref|WP_016159117.1|  MULTISPECIES: isochorismate synthase entC          257   1e-80   Escherichia
ref|WP_010346610.1|  MULTISPECIES: isochorismate synthase EntC          257   1e-80   Escherichia
ref|WP_001688499.1|  isochorismate synthase entC                        257   2e-80   Escherichia coli [E. coli]
ref|WP_015953598.1|  isochorismate synthase EntC                        256   2e-80   Escherichia fergusonii
ref|WP_024256922.1|  isochorismate synthase                             256   3e-80   Escherichia fergusonii
ref|WP_032224891.1|  isochorismate synthase                             255   3e-80   Escherichia coli [E. coli]
ref|WP_032220434.1|  isochorismate synthase                             256   4e-80   Escherichia coli [E. coli]
ref|WP_032216629.1|  isochorismate synthase                             256   4e-80   Escherichia coli [E. coli]
ref|WP_032254782.1|  isochorismate synthase                             255   7e-80   Escherichia coli [E. coli]
ref|WP_001455965.1|  isochorismate synthase entC                        255   7e-80   Escherichia coli [E. coli]
ref|WP_032224902.1|  isochorismate synthase                             255   8e-80   Escherichia coli [E. coli]
ref|WP_025237418.1|  isochorismate synthase                             255   1e-79   Escherichia albertii
ref|WP_032293942.1|  isochorismate synthase                             254   1e-79   Escherichia coli [E. coli]
ref|WP_033556039.1|  isochorismate synthase                             254   1e-79   Escherichia coli [E. coli]
ref|WP_010380682.1|  isochorismate synthase EntC                        254   2e-79   Escherichia
ref|WP_016248453.1|  MULTISPECIES: isochorismate synthase entC          254   3e-79   Escherichia
ref|WP_001404775.1|  isochorismate synthase entC                        254   3e-79   Escherichia coli [E. coli]
ref|WP_010333946.1|  isochorismate synthase EntC                        253   6e-79   Escherichia albertii
ref|WP_032252249.1|  isochorismate synthase                             253   6e-79   Escherichia coli [E. coli]
ref|WP_002430226.1|  isochorismate synthase EntC                        253   7e-79   Escherichia albertii
ref|WP_032203496.1|  isochorismate synthase                             243   1e-78   
ref|WP_001515951.1|  MULTISPECIES: isochorismate synthase entC          250   6e-78   Escherichia
ref|WP_010342363.1|  isochorismate synthase EntC                        248   3e-77   Escherichia
ref|WP_032222609.1|  isochorismate synthase                             248   6e-77   Escherichia coli [E. coli]
gb|EQP28380.1|  isochorismate synthase entC                             241   2e-74   Escherichia coli HVH 59 (4-1119338)
ref|WP_023565082.1|  isochorismate synthase                             225   8e-72   
ref|WP_001456947.1|  isochorismate synthase entC domain protein         225   1e-71   
gb|EFW53349.1|  isochorismate synthase                                  223   4e-71   Shigella boydii ATCC 9905
ref|WP_042286202.1|  isochorismate synthase                             227   5e-69   Citrobacter sedlakii
ref|WP_044266421.1|  isochorismate synthase                             227   5e-69   Citrobacter
ref|WP_042320784.1|  isochorismate synthase                             224   5e-68   Citrobacter farmeri
gb|EGK62685.1|  isochorismate synthase                                  226   8e-68   Enterobacter hormaechei ATCC 49162
ref|WP_043001459.1|  isochorismate synthase                             224   1e-67   Citrobacter sp. MGH 55
ref|WP_044256627.1|  MULTISPECIES: isochorismate synthase               223   2e-67   Gammaproteobacteria
ref|WP_001503543.1|  isochorismate synthase entC domain protein         213   6e-67   
emb|CDL37973.1|  Isochorismate synthase [enterobactin] siderophore      209   3e-65   Escherichia coli ISC11
gb|EGI99305.1|  entC                                                    204   6e-64   Shigella boydii 5216-82
ref|WP_003022040.1|  MULTISPECIES: isochorismate synthase EntC          213   2e-63   Citrobacter
ref|WP_012133396.1|  isochorismate synthase EntC                        211   1e-62   Citrobacter koseri
ref|WP_012904941.1|  isochorismate synthase EntC                        211   1e-62   Citrobacter rodentium
gb|KGY17236.1|  isochorismate synthase                                  211   1e-62   
emb|CDZ84261.1|  isochorismate synthase                                 211   2e-62   Citrobacter koseri
ref|WP_032948772.1|  isochorismate synthase                             210   2e-62   Citrobacter freundii
ref|WP_044699498.1|  isochorismate synthase                             210   2e-62   Citrobacter freundii complex
ref|WP_044712743.1|  isochorismate synthase                             210   2e-62   Enterobacteriaceae
ref|WP_003831195.1|  isochorismate synthase EntC                        210   2e-62   Citrobacter portucalensis
ref|WP_008784058.1|  isochorismate synthase EntC                        210   2e-62   Citrobacter portucalensis
ref|WP_032942659.1|  isochorismate synthase                             210   3e-62   Citrobacter portucalensis
ref|WP_003835641.1|  isochorismate synthase EntC                        209   5e-62   Citrobacter freundii
ref|WP_003847433.1|  MULTISPECIES: isochorismate synthase EntC          209   7e-62   Citrobacter
ref|WP_032936903.1|  isochorismate synthase                             209   9e-62   Citrobacter freundii complex
gb|KGZ33017.1|  isochorismate synthase                                  208   1e-61   
gb|AHO21866.1|  isochorismate synthase                                  202   3e-61   
gb|KHE09718.1|  isochorismate synthase                                  207   3e-61   Citrobacter braakii
gb|KHE06577.1|  isochorismate synthase                                  207   4e-61   Citrobacter braakii
ref|WP_016152197.1|  MULTISPECIES: isochorismate synthase entC          207   4e-61   Enterobacteriaceae
ref|WP_016155945.1|  isochorismate synthase entC                        207   4e-61   Citrobacter
ref|WP_042309868.1|  isochorismate synthase                             206   6e-61   Citrobacter werkmanii
ref|WP_043015537.1|  isochorismate synthase                             206   8e-61   Citrobacter freundii
ref|WP_038638631.1|  isochorismate synthase                             206   1e-60   Citrobacter freundii
ref|WP_040232589.1|  isochorismate synthase                             206   1e-60   Citrobacter pasteurii
ref|WP_031610105.1|  isochorismate synthase                             196   4e-60   
ref|WP_023196646.1|  isochorismate synthase EntC                        199   7e-60   
ref|WP_006685580.1|  isochorismate synthase EntC                        203   8e-60   Citrobacter youngae
ref|WP_038447527.1|  isochorismate synthase                             201   2e-59   
ref|WP_038448666.1|  isochorismate synthase                             201   2e-59   
ref|WP_023182908.1|  isochorismate synthase EntC                        202   3e-59   Salmonella enterica
ref|WP_000381300.1|  hypothetical protein                               192   4e-59   
ref|WP_038388995.1|  isochorismate synthase                             202   4e-59   
ref|WP_038422538.1|  isochorismate synthase                             201   4e-59   
ref|WP_038425772.1|  isochorismate synthase                             201   5e-59   
ref|WP_038450708.1|  isochorismate synthase                             201   5e-59   
gb|AHP40105.1|  isochorismate synthase                                  201   5e-59   
ref|WP_000367603.1|  isochorismate synthase EntC                        201   5e-59   Salmonella enterica
ref|WP_031236120.1|  isochorismate synthase                             201   5e-59   Salmonella enterica
ref|WP_000367605.1|  isochorismate synthase EntC                        201   5e-59   Salmonella enterica
ref|WP_000367604.1|  isochorismate synthase EntC                        201   5e-59   Salmonella enterica
ref|WP_031608353.1|  isochorismate synthase                             201   5e-59   Salmonella enterica
ref|WP_000367602.1|  isochorismate synthase EntC                        201   5e-59   Salmonella enterica
ref|WP_038393826.1|  isochorismate synthase                             201   5e-59   
ref|WP_000367601.1|  isochorismate synthase EntC                        201   5e-59   Salmonella
ref|WP_038421674.1|  isochorismate synthase                             201   5e-59   
ref|WP_000367600.1|  isochorismate synthase EntC                        201   5e-59   Salmonella enterica
ref|WP_023243103.1|  isochorismate synthase EntC                        201   5e-59   Salmonella enterica
ref|WP_020976759.1|  isochorismate synthase EntC                        201   6e-59   Salmonella enterica
ref|WP_000367608.1|  isochorismate synthase EntC                        201   6e-59   Salmonella enterica
gb|AHR87200.1|  isochorismate synthase                                  201   7e-59   
ref|WP_016506008.1|  isochorismate synthase                             201   8e-59   Salmonella enterica
ref|WP_039773597.1|  isochorismate synthase                             201   8e-59   Salmonella enterica
ref|WP_016505483.1|  isochorismate synthase                             201   8e-59   Salmonella enterica
ref|WP_023177587.1|  isochorismate synthase EntC                        200   1e-58   Salmonella enterica
ref|WP_023234721.1|  isochorismate synthase EntC                        200   2e-58   Salmonella enterica
gb|EIQ78358.1|  isochorismate synthase entC                             200   2e-58   Shigella flexneri 1235-66
ref|WP_000367594.1|  isochorismate synthase EntC                        200   2e-58   Salmonella enterica
ref|WP_000367595.1|  isochorismate synthase EntC                        199   3e-58   Salmonella enterica
ref|WP_023237196.1|  isochorismate synthase EntC                        199   3e-58   Salmonella enterica
ref|WP_000367598.1|  isochorismate synthase EntC                        199   4e-58   
gb|AHQ40426.1|  isochorismate synthase                                  199   4e-58   Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121177
ref|WP_023253694.1|  isochorismate synthase EntC                        199   4e-58   Salmonella enterica
ref|WP_023257709.1|  isochorismate synthase EntC                        199   4e-58   Salmonella enterica
ref|WP_024797992.1|  isochorismate synthase                             199   4e-58   
ref|WP_000367596.1|  isochorismate synthase EntC                        199   4e-58   
ref|WP_023231632.1|  isochorismate synthase EntC                        199   4e-58   
ref|WP_038389829.1|  isochorismate synthase                             199   5e-58   
ref|WP_023242592.1|  isochorismate synthase EntC                        199   5e-58   
ref|WP_023206871.1|  isochorismate synthase EntC                        199   5e-58   
ref|WP_023137881.1|  isochorismate synthase                             199   5e-58   
ref|WP_000367597.1|  isochorismate synthase EntC                        199   5e-58   
ref|WP_000367599.1|  isochorismate synthase EntC                        199   5e-58   
gb|KFT02362.1|  isochorismate synthase                                  199   5e-58   
ref|WP_023240933.1|  isochorismate synthase EntC                        199   5e-58   
ref|WP_023238692.1|  isochorismate synthase EntC                        199   5e-58   
ref|WP_000367607.1|  isochorismate synthase EntC                        199   5e-58   
ref|WP_006893254.1|  isochorismate synthase EntC                        199   5e-58   
ref|WP_023225745.1|  isochorismate synthase EntC                        199   5e-58   
ref|WP_023229972.1|  isochorismate synthase EntC                        199   6e-58   
ref|WP_000367593.1|  isochorismate synthase EntC                        198   7e-58   
ref|WP_032074368.1|  isochorismate synthase                             198   7e-58   
ref|WP_042350091.1|  isochorismate synthase                             189   9e-58   
ref|WP_031340489.1|  isochorismate synthase                             197   1e-57   
ref|WP_002948753.1|  Isochorismate synthase entC                        198   1e-57   
ref|WP_042948058.1|  isochorismate synthase                             198   1e-57   
ref|WP_039512945.1|  isochorismate synthase                             197   1e-57   
gb|KEO14522.1|  isochorismate synthase entC domain protein              189   2e-57   
ref|WP_024159036.1|  isochorismate synthase                             197   2e-57   
ref|WP_011233106.1|  isochorismate synthase EntC                        197   2e-57   
ref|WP_038390692.1|  isochorismate synthase                             197   3e-57   
ref|WP_001523370.1|  isochorismate synthase EntC                        197   3e-57   
ref|WP_020322282.1|  isochorismate synthase                             197   3e-57   
ref|WP_017441646.1|  isochorismate synthase EntC                        197   3e-57   
ref|WP_000367609.1|  isochorismate synthase EntC                        196   4e-57   
ref|WP_000367606.1|  isochorismate synthase EntC                        196   8e-57   
ref|WP_016506309.1|  isochorismate synthase                             196   9e-57   
gb|EDZ05625.1|  isochorismate synthase EntC                             194   3e-56   
ref|WP_001534018.1|  isochorismate synthase EntC                        194   3e-56   
gb|EHC93930.1|  Isochorismate synthase                                  194   3e-56   
gb|EHD06211.1|  Isochorismate synthase                                  194   3e-56   
gb|ESG72388.1|  isochorismate synthase EntC                             194   4e-56   
ref|WP_031626571.1|  isochorismate synthase                             192   4e-56   
ref|WP_038392597.1|  isochorismate synthase                             192   2e-55   
ref|WP_038396605.1|  isochorismate synthase                             192   3e-55   
gb|KDQ71898.1|  hypothetical protein CFSAN000661_22755                  184   3e-55   
gb|KDR07255.1|  hypothetical protein CFSAN001087_23035                  184   3e-55   
ref|WP_023246781.1|  isochorismate synthase EntC                        191   4e-55   
gb|ETC74220.1|  isochorismate synthase EntC                             184   4e-53   
gb|ETC32984.1|  isochorismate synthase EntC                             184   1e-52   
gb|ETB74741.1|  isochorismate synthase EntC                             184   1e-52   
gb|ETC42105.1|  isochorismate synthase EntC                             184   1e-52   
gb|ESC56353.1|  isochorismate synthase EntC                             184   2e-52   
gb|ETC07081.1|  isochorismate synthase EntC                             182   1e-51   
ref|WP_020456935.1|  isochorismate synthase EntC                        181   2e-51   
ref|WP_017455806.1|  isochorismate synthase EntC                        180   8e-51   
gb|KHI12159.1|  isochorismate synthase                                  177   2e-50   
gb|EJW32637.1|  isochorismate synthase EntC                             169   9e-50   
ref|WP_032673595.1|  MULTISPECIES: isochorismate synthase               177   1e-49   
ref|WP_014882950.1|  isochorismate synthase EntC                        177   1e-49   
ref|WP_032641778.1|  isochorismate synthase                             176   2e-49   
ref|WP_032637224.1|  isochorismate synthase                             176   2e-49   
ref|WP_042713307.1|  isochorismate synthase                             176   2e-49   
ref|WP_039264074.1|  isochorismate synthase                             176   4e-49   
ref|WP_032649608.1|  MULTISPECIES: isochorismate synthase               175   5e-49   
ref|WP_008916421.1|  isochorismate synthase EntC                        175   6e-49   
ref|WP_023332358.1|  MULTISPECIES: isochorismate synthase entC          175   6e-49   
ref|WP_032661013.1|  isochorismate synthase                             175   6e-49   
ref|WP_023336894.1|  MULTISPECIES: isochorismate synthase entC          175   6e-49   
ref|WP_042898729.1|  isochorismate synthase                             175   8e-49   
ref|WP_033144896.1|  isochorismate synthase                             174   9e-49   
ref|WP_022647381.1|  MULTISPECIES: isochorismate synthase entC          174   1e-48   
ref|WP_041910947.1|  isochorismate synthase                             174   1e-48   
gb|KGI65158.1|  isochorismate synthase                                  174   1e-48   
ref|WP_023299559.1|  MULTISPECIES: isochorismate synthase entC          174   1e-48   
gb|KGY63789.1|  isochorismate synthase                                  174   1e-48   
ref|WP_023310706.1|  isochorismate synthase entC                        174   1e-48   
ref|WP_042716111.1|  isochorismate synthase                             173   2e-48   
ref|WP_022650570.1|  MULTISPECIES: isochorismate synthase entC          174   2e-48   
ref|WP_038981018.1|  isochorismate synthase                             174   2e-48   
ref|WP_043954377.1|  isochorismate synthase                             173   2e-48   
ref|WP_032608824.1|  MULTISPECIES: isochorismate synthase               173   2e-48   
ref|WP_023315594.1|  isochorismate synthase entC                        173   3e-48   
ref|WP_007373769.1|  isochorismate synthase EntC                        173   3e-48   
ref|WP_023324292.1|  isochorismate synthase entC                        173   3e-48   
ref|WP_035886035.1|  isochorismate synthase                             173   3e-48   
ref|WP_023479253.1|  isochorismate synthase entC                        173   4e-48   
ref|WP_014831041.1|  isochorismate synthase EntC                        173   4e-48   
ref|WP_028012296.1|  isochorismate synthase                             173   4e-48   
ref|WP_029740107.1|  isochorismate synthase                             173   4e-48   
ref|WP_024906982.1|  isochorismate synthase                             172   6e-48   
ref|WP_013097634.1|  isochorismate synthase EntC                        172   7e-48   
ref|WP_023618962.1|  isochorismate synthase EntC                        172   7e-48   
ref|WP_023326876.1|  isochorismate synthase entC                        172   8e-48   
ref|WP_032674342.1|  isochorismate synthase                             172   8e-48   
ref|WP_025912698.1|  isochorismate synthase                             172   8e-48   
ref|WP_008500991.1|  isochorismate synthase EntC                        172   8e-48   
ref|WP_038418883.1|  isochorismate synthase                             171   2e-47   
ref|WP_029883761.1|  isochorismate synthase                             171   2e-47   
ref|WP_032670393.1|  isochorismate synthase                             171   2e-47   
ref|WP_023305661.1|  isochorismate synthase entC                        171   2e-47   
ref|WP_032638756.1|  isochorismate synthase                             171   2e-47   
ref|WP_015571177.1|  isochorismate synthases                            171   2e-47   
ref|WP_017382512.1|  MULTISPECIES: isochorismate synthase EntC          171   2e-47   
ref|WP_032647640.1|  MULTISPECIES: isochorismate synthase               171   2e-47   
ref|WP_040020565.1|  isochorismate synthase                             171   2e-47   
ref|WP_039265931.1|  isochorismate synthase                             171   2e-47   
ref|WP_021242612.1|  isochorismate synthase EntC                        171   2e-47   
ref|WP_032656472.1|  isochorismate synthase                             171   2e-47   
ref|WP_023293060.1|  isochorismate synthase entC                        171   2e-47   
ref|WP_039024450.1|  isochorismate synthase                             171   2e-47   
gb|KGY91387.1|  isochorismate synthase                                  170   4e-47   
ref|WP_044857518.1|  isochorismate synthase                             168   4e-47   
ref|WP_023334852.1|  isochorismate synthase entC                        170   4e-47   
ref|WP_023343562.1|  isochorismate synthase entC                        170   5e-47   
ref|WP_039271372.1|  isochorismate synthase                             170   5e-47   
ref|WP_006177078.1|  isochorismate synthase EntC                        170   5e-47   
ref|WP_040076618.1|  isochorismate synthase                             170   6e-47   
ref|WP_028019513.1|  isochorismate synthase                             169   7e-47   
ref|WP_032652930.1|  isochorismate synthase                             169   8e-47   
ref|WP_012016526.1|  isochorismate synthase EntC                        169   8e-47   
ref|WP_010428423.1|  isochorismate synthase EntC                        167   4e-46   
ref|WP_039054768.1|  isochorismate synthase                             167   4e-46   
ref|WP_044866157.1|  isochorismate synthase                             167   4e-46   
ref|WP_025204697.1|  MULTISPECIES: isochorismate synthase               167   4e-46   
ref|WP_032681445.1|  isochorismate synthase                             167   5e-46   
ref|WP_014169070.1|  MULTISPECIES: isochorismate synthase EntC          167   6e-46   
ref|WP_041852187.1|  isochorismate synthase                             167   8e-46   
ref|WP_014069270.1|  isochorismate synthase EntC                        166   1e-45   
ref|WP_020885026.1|  isochorismate synthase                             165   3e-45   
ref|WP_033812375.1|  isochorismate synthase                             155   4e-45   
ref|WP_031618114.1|  isochorismate synthase                             156   4e-45   
gb|AAX64532.1|  isochorismate synthetase, enterochelin biosynthesis     164   8e-45   
ref|WP_038391156.1|  isochorismate synthase                             152   1e-43   
gb|ERI55554.1|  isochorismate synthase                                  159   5e-43   
ref|WP_042391926.1|  isochorismate synthase                             159   7e-43   
gb|EUC84685.1|  isochorismate synthase                                  159   9e-43   
emb|CDQ53505.1|  entC                                                   158   1e-42   
ref|WP_042893318.1|  isochorismate synthase                             157   3e-42   
ref|WP_032714048.1|  isochorismate synthase                             157   3e-42   
gb|KGB06843.1|  isochorismate synthase entC                             157   3e-42   
ref|WP_032712836.1|  isochorismate synthase                             157   3e-42   
ref|WP_015704712.1|  isochorismate synthase EntC                        157   3e-42   
ref|WP_015367770.1|  Isochorismate synthase [enterobactin] sidero...    157   3e-42   
ref|WP_039031405.1|  isochorismate synthase                             157   4e-42   
ref|WP_025108239.1|  isochorismate synthase                             157   4e-42   
ref|WP_032748646.1|  isochorismate synthase                             157   4e-42   
ref|WP_032189267.1|  isochorismate synthase                             147   6e-42   
gb|AGT25354.1|  isochorismate synthase                                  157   6e-42   
dbj|BAH62310.1|  isochorismate synthase                                 156   9e-42   
gb|EHM48413.1|  isochorismate synthase                                  156   9e-42   
ref|WP_025714612.1|  isochorismate synthase                             155   3e-41   
ref|WP_024358842.1|  MULTISPECIES: isochorismate synthase               154   4e-41   
gb|AIE02250.1|  isochorismate synthase                                  154   4e-41   
ref|WP_023297206.1|  isochorismate synthase entC                        154   4e-41   
ref|WP_020079369.1|  isochorismate synthase EntC                        154   4e-41   
ref|WP_042948390.1|  isochorismate synthase                             154   5e-41   
ref|WP_008805585.1|  MULTISPECIES: isochorismate synthase EntC          154   5e-41   
ref|WP_016160467.1|  isochorismate synthase entC                        154   5e-41   
ref|WP_032205724.1|  isochorismate synthase                             145   7e-41   
ref|WP_012542487.1|  MULTISPECIES: isochorismate synthase EntC          153   1e-40   
ref|WP_023322214.1|  isochorismate synthase entC                        153   1e-40   
ref|WP_040973843.1|  isochorismate synthase                             153   1e-40   
ref|WP_040200191.1|  isochorismate synthase                             153   1e-40   
ref|WP_023283409.1|  isochorismate synthase entC                        153   1e-40   
ref|WP_029602329.1|  isochorismate synthase                             152   2e-40   
ref|WP_004147528.1|  isochorismate synthase EntC                        152   2e-40   
ref|WP_004130331.1|  isochorismate synthase EntC                        152   2e-40   
ref|WP_040225598.1|  isochorismate synthase                             152   2e-40   
ref|WP_004848677.1|  isochorismate synthase EntC                        152   2e-40   
ref|WP_032410701.1|  isochorismate synthase                             152   2e-40   
ref|WP_021313368.1|  isochorismate synthase EntC                        152   2e-40   
ref|WP_004176916.1|  MULTISPECIES: isochorismate synthase EntC          152   2e-40   
ref|WP_040153891.1|  isochorismate synthase                             152   2e-40   
ref|WP_032445715.1|  isochorismate synthase                             152   2e-40   
ref|WP_004191397.1|  isochorismate synthase EntC                        152   2e-40   
ref|WP_023341180.1|  isochorismate synthase entC                        152   2e-40   
ref|WP_004178973.1|  isochorismate synthase EntC                        152   2e-40   
emb|CDO13423.1|  entC                                                   152   2e-40   
ref|WP_032432766.1|  isochorismate synthase                             152   2e-40   
ref|WP_044179219.1|  isochorismate synthase                             152   4e-40   
ref|WP_023279186.1|  isochorismate synthase entC                        151   5e-40   
ref|WP_032423912.1|  isochorismate synthase                             151   5e-40   
ref|WP_032411014.1|  isochorismate synthase                             151   7e-40   
ref|WP_009653180.1|  isochorismate synthase EntC                        151   8e-40   
ref|WP_042939166.1|  isochorismate synthase                             150   9e-40   
ref|WP_032414663.1|  isochorismate synthase                             150   9e-40   
ref|WP_032424700.1|  isochorismate synthase                             150   9e-40   
ref|WP_040166677.1|  isochorismate synthase                             150   2e-39   
ref|WP_023288784.1|  isochorismate synthase entC                        150   2e-39   
ref|WP_016946824.1|  isochorismate synthase EntC                        150   2e-39   
ref|WP_023320537.1|  isochorismate synthase entC                        150   2e-39   
ref|WP_004100073.1|  MULTISPECIES: isochorismate synthase EntC          150   2e-39   
ref|WP_038254761.1|  isochorismate synthase                             150   2e-39   
ref|WP_032455077.1|  isochorismate synthase                             150   2e-39   
ref|WP_040903923.1|  isochorismate synthase                             150   2e-39   
ref|WP_002893882.1|  isochorismate synthase EntC                        149   2e-39   
ref|WP_040154874.1|  isochorismate synthase                             149   2e-39   
ref|WP_020803422.1|  isochorismate synthase                             149   2e-39   
ref|WP_044521547.1|  isochorismate synthase                             149   3e-39   
ref|WP_044294605.1|  isochorismate synthase                             149   3e-39   
ref|WP_021464372.1|  isochorismate synthase EntC                        149   3e-39   
ref|WP_043521703.1|  isochorismate synthase                             149   3e-39   
ref|WP_004885741.1|  MULTISPECIES: isochorismate synthase EntC          149   3e-39   
ref|WP_014907941.1|  isochorismate synthase EntC                        149   4e-39   
ref|WP_014599079.1|  isochorismate synthase EntC                        149   5e-39   
ref|WP_032429837.1|  isochorismate synthase                             149   5e-39   
ref|WP_004223592.1|  isochorismate synthase EntC                        149   5e-39   
ref|WP_032616985.1|  isochorismate synthase                             148   1e-38   
ref|WP_041144529.1|  isochorismate synthase                             148   1e-38   
ref|WP_032688948.1|  MULTISPECIES: isochorismate synthase               146   4e-38   
ref|WP_038159401.1|  isochorismate synthase                             146   6e-38   
ref|WP_032694351.1|  MULTISPECIES: isochorismate synthase               144   2e-37   
ref|WP_032718736.1|  isochorismate synthase                             144   2e-37   
ref|WP_014228359.1|  isochorismate synthase EntC                        144   2e-37   
ref|WP_040189264.1|  isochorismate synthase                             144   3e-37   
ref|WP_023329427.1|  isochorismate synthase entC                        144   3e-37   
ref|WP_042944596.1|  isochorismate synthase                             144   3e-37   
ref|WP_044349685.1|  isochorismate synthase                             144   4e-37   
ref|WP_004859361.1|  isochorismate synthase EntC                        144   4e-37   
ref|WP_015584922.1|  isochorismate synthase EntC                        143   5e-37   
gb|ELX84724.1|  isochorismate synthase EntC                             135   7e-37   
ref|WP_032716863.1|  isochorismate synthase                             142   1e-36   
ref|WP_029593561.1|  isochorismate synthase                             141   3e-36   
ref|WP_014837777.1|  isochorismate synthase EntC                        141   3e-36   



>ref|WP_032263054.1| isochorismate synthase, partial [Escherichia coli]
Length=139

 Score =   269 bits (687),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQTT  +   R
Sbjct  121  VVERQAIPEQTTFEQMVAR  139



>ref|WP_000389165.1| isochorismate synthase EntC [Escherichia coli]
 ref|NP_752611.1| isochorismate synthase [Escherichia coli CFT073]
 gb|AAN79155.1|AE016757_59 Isochorismate synthase entC [Escherichia coli CFT073]
 gb|EEJ48978.1| isochorismate synthase [Escherichia coli 83972]
 gb|EFJ90729.1| isochorismate synthase [Escherichia coli MS 45-1]
 gb|EFU50718.1| isochorismate synthase [Escherichia coli MS 153-1]
 gb|AER83243.1| isochorismate synthase [Escherichia coli str. 'clone D i2']
 gb|AER88162.1| isochorismate synthase [Escherichia coli str. 'clone D i14']
 gb|ESC97177.1| isochorismate synthase [Escherichia coli 907391]
 gb|ESD38795.1| isochorismate synthase [Escherichia coli 907892]
 gb|ESE35376.1| isochorismate synthase [Escherichia coli A25922R]
Length=395

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQTT  +   R
Sbjct  121  VVERQAIPEQTTFEQMVAR  139



>gb|ESD40405.1| isochorismate synthase [Escherichia coli 908519]
Length=395

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQTT  +   R
Sbjct  121  VVERQAIPEQTTFEQMVAR  139



>gb|ABE06095.1| isochorismate synthase [Escherichia coli UTI89]
 gb|EEH84902.1| isochorismate synthase [Escherichia sp. 3_2_53FAA]
 gb|EFJ58944.1| isochorismate synthase [Escherichia coli MS 200-1]
 gb|EFU46446.1| isochorismate synthase [Escherichia coli MS 110-3]
 gb|EFU58401.1| isochorismate synthase [Escherichia coli MS 16-3]
 gb|EGB79735.1| isochorismate synthase [Escherichia coli MS 60-1]
 gb|ESC91319.1| isochorismate synthase [Escherichia coli 907446]
 gb|ESE10146.1| isochorismate synthase [Escherichia coli 908675]
 gb|ESE22247.1| isochorismate synthase [Escherichia coli 910096-2]
 gb|ESE27826.1| isochorismate synthase [Escherichia coli A35218R]
Length=395

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQTT  +   R
Sbjct  121  VVERQAIPEQTTFEQMVAR  139



>gb|EGI16630.1| isochorismate synthase EntC (Isochorismate mutase) [Escherichia 
coli M605]
 gb|ESA93947.1| isochorismate synthase [Escherichia coli 907779]
 gb|ESD22432.1| isochorismate synthase [Escherichia coli 907701]
 gb|ESD63010.1| isochorismate synthase [Escherichia coli 908524]
 gb|ESD94844.1| isochorismate synthase [Escherichia coli 908624]
 gb|ESE05731.1| isochorismate synthase [Escherichia coli 908632]
 gb|ESE16941.1| isochorismate synthase [Escherichia coli 908691]
 emb|CDN80966.1| isochorismate synthase [Escherichia coli O25b:H4-ST131]
Length=395

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQTT  +   R
Sbjct  121  VVERQAIPEQTTFEQMVAR  139



>gb|AAB40793.1| isochorismate synthase [Escherichia coli]
 gb|EFJ95718.1| isochorismate synthase [Escherichia coli MS 115-1]
 gb|EFK92457.1| isochorismate synthase [Escherichia coli MS 146-1]
 gb|EGI10112.1| isochorismate synthase EntC (Isochorismate mutase) [Escherichia 
coli H736]
 gb|EIE36035.1| isochorismate synthase [Escherichia coli J53]
 gb|ESA94846.1| isochorismate synthase [Escherichia coli 909945-2]
 gb|ESE04121.1| isochorismate synthase [Escherichia coli 908658]
 gb|AHA63506.1| Isochorismate synthase [Shigella dysenteriae 1617]
 gb|ESU80540.1| Isochorismate synthase [Shigella dysenteriae WRSd3]
 gb|ESU80932.1| Isochorismate synthase [Shigella dysenteriae WRSd5]
Length=395

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/139 (95%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQTT  +   R
Sbjct  121  VVERQAIPEQTTFEQMVAR  139



>ref|WP_044068683.1| isochorismate synthase, partial [Escherichia coli]
Length=199

 Score =   265 bits (676),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_042957411.1| isochorismate synthase, partial [Escherichia coli]
 gb|KEJ52522.1| isochorismate synthase entC domain protein, partial [Escherichia 
coli 3-020-07_S3_C2]
Length=139

 Score =   262 bits (670),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>gb|KEN97766.1| isochorismate synthase entC domain protein, partial [Escherichia 
coli 2-222-05_S3_C1]
Length=135

 Score =   262 bits (669),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_000381305.1| hypothetical protein, partial [Escherichia coli]
 gb|EIL16820.1| isochorismate synthase EntC, partial [Escherichia coli O111:H8 
str. CVM9570]
Length=165

 Score =   263 bits (671),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_044070716.1| isochorismate synthase, partial [Escherichia coli]
Length=221

 Score =   264 bits (675),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_042099941.1| isochorismate synthase, partial [Escherichia coli]
Length=153

 Score =   262 bits (669),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>gb|EFK50652.1| isochorismate synthase [Escherichia coli MS 107-1]
 gb|EGB85357.1| isochorismate synthase [Escherichia coli MS 117-3]
 gb|EGU97221.1| isochorismate synthase [Escherichia coli MS 79-10]
Length=395

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIP+QTT  +   R
Sbjct  121  VVERQAIPQQTTFEQMVAR  139



>gb|ESA68049.1| isochorismate synthase [Escherichia coli 110957]
 gb|ESD34070.1| isochorismate synthase [Escherichia coli 907889]
Length=395

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 134/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIP+QTT  +   R
Sbjct  121  VVERQAIPDQTTFEQMVAR  139



>gb|ADB98051.1| EntC [Escherichia coli]
 gb|EFK00043.1| isochorismate synthase [Escherichia coli MS 182-1]
 gb|EFK45514.1| isochorismate synthase [Escherichia coli MS 119-7]
 gb|EFU35079.1| isochorismate synthase [Escherichia coli MS 85-1]
 gb|EGI47589.1| isochorismate synthase EntC (Isochorismate mutase) [Escherichia 
coli H591]
 gb|EGJ07426.1| isochorismate synthase [Escherichia coli D9]
 gb|EID66334.1| isochorismate synthase [Escherichia coli W26]
 gb|ESD71905.1| isochorismate synthase [Escherichia coli 908541]
 gb|ESD74341.1| isochorismate synthase [Escherichia coli 908555]
Length=395

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQTT  +   R
Sbjct  121  VVERQAIPEQTTFEQMVAR  139



>gb|KDW87190.1| isochorismate synthase entC domain protein [Escherichia coli 
2-210-07_S4_C1]
Length=143

 Score =   261 bits (667),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>gb|EFO58180.1| isochorismate synthase [Escherichia coli MS 145-7]
Length=395

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQTT  +   R
Sbjct  121  VVERQAIPEQTTFEQMVAR  139



>gb|EFK18973.1| isochorismate synthase [Escherichia coli MS 21-1]
Length=395

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQ T  +   R
Sbjct  121  VVERQAIPEQATFEQMVAR  139



>emb|CDL28450.1| isochorismate synthase [Escherichia coli ISC7]
Length=207

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>gb|ABJ00014.1| isochorismate synthase [Escherichia coli APEC O1]
Length=395

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/139 (94%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +E DMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEGDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQTT  +   R
Sbjct  121  VVERQAIPEQTTFEQMVAR  139



>ref|WP_032257963.1| isochorismate synthase, partial [Escherichia coli]
 gb|KDX55627.1| isochorismate synthase entC domain protein, partial [Escherichia 
coli 2-210-07_S4_C2]
Length=128

 Score =   259 bits (663),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/128 (100%), Positives = 128/128 (100%), Gaps = 0/128 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTT  31
            QAIPEQTT
Sbjct  121  QAIPEQTT  128



>ref|WP_042105440.1| isochorismate synthase, partial [Escherichia coli]
Length=304

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_044712706.1| isochorismate synthase, partial [Escherichia coli]
Length=139

 Score =   259 bits (663),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/139 (91%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAK+QGIKNP++VGAIPFDPRQPSSLYIPESWQ FSR+EKQ SARRFTRSQSLN
Sbjct  61   LAALFADAKSQGIKNPLLVGAIPFDPRQPSSLYIPESWQPFSRKEKQTSARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQTT  +   R
Sbjct  121  VVERQAIPEQTTFEQMVAR  139



>gb|EFJ79637.1| isochorismate synthase [Escherichia coli MS 69-1]
 gb|ESD78240.1| isochorismate synthase [Escherichia coli 908573]
Length=395

 Score =   268 bits (686),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQ T  +   R
Sbjct  121  VVERQAIPEQATFEQMVAR  139



>ref|WP_032263476.1| isochorismate synthase, partial [Escherichia coli]
 gb|KEN93554.1| isochorismate synthase entC, partial [Escherichia coli 2-222-05_S3_C2]
 gb|KEO03199.1| isochorismate synthase entC, partial [Escherichia coli 2-222-05_S3_C2]
Length=313

 Score =   266 bits (679),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>gb|EGI42441.1| isochorismate synthase EntC (Isochorismate mutase) [Escherichia 
coli TA280]
Length=395

 Score =   268 bits (685),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQ T  +   R
Sbjct  121  VVERQAIPEQATFEQMVAR  139



>gb|EGI32345.1| isochorismate synthase EntC (Isochorismate mutase) [Escherichia 
coli TA143]
Length=395

 Score =   268 bits (685),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 130/139 (94%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQ T  +   R
Sbjct  121  VVERQAIPEQATFEQMVAR  139



>ref|WP_044815215.1| isochorismate synthase, partial [Escherichia coli]
Length=292

 Score =   265 bits (676),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_023567826.1| isochorismate synthase, partial [Escherichia coli]
 gb|EST76240.1| isochorismate synthase, partial [Escherichia coli ECC-1470]
Length=321

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>gb|ESA82367.1| isochorismate synthase [Escherichia coli 907713]
 gb|ESD21917.1| isochorismate synthase [Escherichia coli 907715]
 gb|ESD88897.1| isochorismate synthase [Escherichia coli 908585]
Length=395

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LA LFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSLN
Sbjct  61   LAELFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIP+QTT  +   R
Sbjct  121  VVERQAIPDQTTFEQMVAR  139



>ref|WP_001305553.1| isochorismate synthase entC [Escherichia coli]
 gb|EHP67541.1| isochorismate synthase entC [Escherichia coli 4_1_47FAA]
Length=244

 Score =   261 bits (668),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_042105912.1| isochorismate synthase, partial [Escherichia coli]
Length=296

 Score =   263 bits (672),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>gb|ESD05224.1| isochorismate synthase [Escherichia coli 907672]
 gb|ESD70677.1| isochorismate synthase [Escherichia coli 908525]
Length=395

 Score =   266 bits (679),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESW SFSRQEKQASARRFTRSQSLN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWLSFSRQEKQASARRFTRSQSLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIP+Q T  +   R
Sbjct  121  VVERQAIPQQATFEQMVAR  139



>gb|EGI21937.1| isochorismate synthase EntC (Isochorismate mutase) [Escherichia 
coli M718]
 gb|ESA60294.1| isochorismate synthase [Escherichia coli 113290]
Length=395

 Score =   266 bits (679),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPE WQSFSRQEKQ SARRFTRSQ LN
Sbjct  61   LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPECWQSFSRQEKQTSARRFTRSQLLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQTT  +   R
Sbjct  121  VVERQAIPEQTTFEQMVAR  139



>ref|WP_032084147.1| isochorismate synthase, partial [Escherichia coli]
Length=348

 Score =   264 bits (674),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001336900.1| isochorismate synthase EntC [Escherichia coli]
 gb|EFJ54844.1| isochorismate synthase [Escherichia coli MS 185-1]
 gb|ADN45240.1| isochorismate synthase [Escherichia coli ABU 83972]
 gb|ELC58800.1| isochorismate synthase entC [Escherichia coli KTE39]
 gb|ELC74969.1| isochorismate synthase entC [Escherichia coli KTE187]
 gb|ELC84141.1| isochorismate synthase entC [Escherichia coli KTE188]
 gb|ELD01962.1| isochorismate synthase entC [Escherichia coli KTE201]
 gb|ELD40984.1| isochorismate synthase entC [Escherichia coli KTE214]
 gb|ELD52757.1| isochorismate synthase entC [Escherichia coli KTE220]
 gb|ELD64396.1| isochorismate synthase entC [Escherichia coli KTE230]
 gb|ELE07896.1| isochorismate synthase entC [Escherichia coli KTE53]
 gb|ELE35115.1| isochorismate synthase entC [Escherichia coli KTE60]
 gb|ELE42427.1| isochorismate synthase entC [Escherichia coli KTE67]
 gb|ELE92790.1| isochorismate synthase entC [Escherichia coli KTE87]
 gb|ELG19417.1| isochorismate synthase entC [Escherichia coli KTE63]
 gb|ELG80826.1| isochorismate synthase entC [Escherichia coli KTE141]
 gb|ELH62083.1| isochorismate synthase entC [Escherichia coli KTE209]
 gb|ELH87933.1| isochorismate synthase entC [Escherichia coli KTE218]
 gb|ELH92180.1| isochorismate synthase entC [Escherichia coli KTE223]
 gb|ELI46690.1| isochorismate synthase entC [Escherichia coli KTE124]
 gb|ELI78795.1| isochorismate synthase entC [Escherichia coli KTE137]
 gb|ELJ05125.1| isochorismate synthase entC [Escherichia coli KTE153]
 gb|ELJ17563.1| isochorismate synthase entC [Escherichia coli KTE160]
 gb|ELJ31880.1| isochorismate synthase entC [Escherichia coli KTE167]
 gb|ELJ42988.1| isochorismate synthase entC [Escherichia coli KTE174]
 gb|ELJ96278.1| isochorismate synthase entC [Escherichia coli KTE97]
 gb|ELJ99481.1| isochorismate synthase entC [Escherichia coli KTE99]
 emb|CCQ07600.1| isochorismate synthase [Escherichia coli Nissle 1917]
 gb|EOR51332.1| isochorismate synthase EntC [Escherichia coli ATCC 25922]
 gb|EOX12763.1| isochorismate synthase entC [Escherichia coli KTE226]
 gb|EQN08605.1| isochorismate synthase entC [Escherichia coli HVH 2 (4-6943160)]
 gb|EQN38441.1| isochorismate synthase entC [Escherichia coli HVH 7 (4-7315031)]
 gb|EQN54092.1| isochorismate synthase entC [Escherichia coli HVH 13 (4-7634056)]
 gb|EQN55030.1| isochorismate synthase entC [Escherichia coli HVH 16 (4-7649002)]
 gb|EQN64700.1| isochorismate synthase entC [Escherichia coli HVH 20 (4-5865042)]
 gb|EQN99217.1| isochorismate synthase entC [Escherichia coli HVH 27 (4-7449267)]
 gb|EQO22420.1| isochorismate synthase entC [Escherichia coli HVH 31 (4-2602156)]
 gb|EQO44909.1| isochorismate synthase entC [Escherichia coli HVH 37 (4-2773848)]
 gb|EQO48219.1| isochorismate synthase entC [Escherichia coli HVH 39 (4-2679949)]
 gb|EQO54723.1| isochorismate synthase entC [Escherichia coli HVH 40 (4-1219782)]
 gb|EQO98559.1| isochorismate synthase entC [Escherichia coli HVH 51 (4-2172526)]
 gb|EQP14665.1| isochorismate synthase entC [Escherichia coli HVH 58 (4-2839709)]
 gb|EQP23349.1| isochorismate synthase entC [Escherichia coli HVH 61 (4-2736020)]
 gb|EQP41694.1| isochorismate synthase entC [Escherichia coli HVH 68 (4-0888028)]
 gb|EQP56254.1| isochorismate synthase entC [Escherichia coli HVH 74 (4-1034782)]
 gb|EQP77157.1| isochorismate synthase entC [Escherichia coli HVH 77 (4-2605759)]
 gb|EQQ11103.1| isochorismate synthase entC [Escherichia coli HVH 89 (4-5885604)]
 gb|EQQ29391.1| isochorismate synthase entC [Escherichia coli HVH 95 (4-6074464)]
 gb|EQQ31375.1| isochorismate synthase entC [Escherichia coli HVH 92 (4-5930790)]
 gb|EQQ49948.1| isochorismate synthase entC [Escherichia coli HVH 96 (4-5934869)]
 gb|EQQ55900.1| isochorismate synthase entC [Escherichia coli HVH 103 (4-5904188)]
 gb|EQQ80004.1| isochorismate synthase entC [Escherichia coli HVH 109 (4-6977162)]
 gb|EQQ93302.1| isochorismate synthase entC [Escherichia coli HVH 114 (4-7037740)]
 gb|EQR09456.1| isochorismate synthase entC [Escherichia coli HVH 116 (4-6879942)]
 gb|EQR20519.1| isochorismate synthase entC [Escherichia coli HVH 117 (4-6857191)]
 gb|EQR33322.1| isochorismate synthase entC [Escherichia coli HVH 120 (4-6978681)]
 gb|EQR68918.1| isochorismate synthase entC [Escherichia coli HVH 132 (4-6876862)]
 gb|EQS23745.1| isochorismate synthase entC [Escherichia coli HVH 142 (4-5627451)]
 gb|EQS28283.1| isochorismate synthase entC [Escherichia coli HVH 144 (4-4451937)]
 gb|EQS42265.1| isochorismate synthase entC [Escherichia coli HVH 149 (4-4451880)]
 gb|EQS69468.1| isochorismate synthase entC [Escherichia coli HVH 161 (4-3119890)]
 gb|EQT01478.1| isochorismate synthase entC [Escherichia coli HVH 169 (4-1075578)]
 gb|EQT17138.1| isochorismate synthase entC [Escherichia coli HVH 172 (4-3248542)]
 gb|EQU45331.1| isochorismate synthase entC [Escherichia coli HVH 204 (4-3112802)]
 gb|EQU61207.1| isochorismate synthase entC [Escherichia coli HVH 207 (4-3113221)]
 gb|EQU80423.1| isochorismate synthase entC [Escherichia coli HVH 212 (3-9305343)]
 gb|EQU99256.1| isochorismate synthase entC [Escherichia coli HVH 216 (4-3042952)]
 gb|EQV04078.1| isochorismate synthase entC [Escherichia coli HVH 218 (4-4500903)]
 gb|EQV12547.1| isochorismate synthase entC [Escherichia coli HVH 220 (4-5876842)]
 gb|EQV30202.1| isochorismate synthase entC [Escherichia coli HVH 227 (4-2277670)]
 gb|EQV58583.1| isochorismate synthase entC [Escherichia coli KOEGE 43 (105a)]
 gb|EQV60313.1| isochorismate synthase entC [Escherichia coli KOEGE 44 (106a)]
 gb|EQV71496.1| isochorismate synthase entC [Escherichia coli KOEGE 61 (174a)]
 gb|EQW22756.1| isochorismate synthase entC [Escherichia coli UMEA 3014-1]
 gb|EQW54462.1| isochorismate synthase entC [Escherichia coli UMEA 3087-1]
 gb|EQW83199.1| isochorismate synthase entC [Escherichia coli UMEA 3121-1]
 gb|EQX14439.1| isochorismate synthase entC [Escherichia coli UMEA 3159-1]
 gb|EQX23363.1| isochorismate synthase entC [Escherichia coli UMEA 3161-1]
 gb|EQX38649.1| isochorismate synthase entC [Escherichia coli UMEA 3172-1]
 gb|EQX46761.1| isochorismate synthase entC [Escherichia coli UMEA 3175-1]
 gb|EQX48236.1| isochorismate synthase entC [Escherichia coli UMEA 3173-1]
 gb|EQX61425.1| isochorismate synthase entC [Escherichia coli UMEA 3178-1]
 gb|EQY13575.1| isochorismate synthase entC [Escherichia coli UMEA 3208-1]
 gb|EQY24019.1| isochorismate synthase entC [Escherichia coli UMEA 3216-1]
 gb|EQY35207.1| isochorismate synthase entC [Escherichia coli UMEA 3220-1]
 gb|EQY48723.1| isochorismate synthase entC [Escherichia coli UMEA 3222-1]
 gb|EQY62246.1| isochorismate synthase entC [Escherichia coli UMEA 3233-1]
 gb|EQY71972.1| isochorismate synthase entC [Escherichia coli UMEA 3264-1]
 gb|EQY75696.1| isochorismate synthase entC [Escherichia coli UMEA 3257-1]
 gb|EQY79645.1| isochorismate synthase entC [Escherichia coli UMEA 3268-1]
 gb|EQZ07399.1| isochorismate synthase entC [Escherichia coli UMEA 3337-1]
 gb|EQZ31251.1| isochorismate synthase entC [Escherichia coli UMEA 3490-1]
 gb|EQZ81319.1| isochorismate synthase entC [Escherichia coli UMEA 3687-1]
 gb|EQZ81720.1| isochorismate synthase entC [Escherichia coli UMEA 3694-1]
 gb|EQZ84227.1| isochorismate synthase entC [Escherichia coli UMEA 3705-1]
 gb|EQZ93114.1| isochorismate synthase entC [Escherichia coli UMEA 3707-1]
 gb|ERA12492.1| isochorismate synthase entC [Escherichia coli UMEA 3821-1]
 gb|ERA48458.1| isochorismate synthase entC [Escherichia coli UMEA 4207-1]
 gb|ERA77439.1| isochorismate synthase entC [Escherichia coli HVH 156 (4-3206505)]
 gb|ERA78835.1| isochorismate synthase entC [Escherichia coli HVH 157 (4-3406229)]
 gb|ERA83294.1| isochorismate synthase entC [Escherichia coli HVH 159 (4-5818141)]
 gb|ERA91888.1| isochorismate synthase entC [Escherichia coli HVH 160 (4-5695937)]
 gb|ERF50957.1| isochorismate synthase entC [Escherichia coli UMEA 3652-1]
 gb|ESK32427.1| isochorismate synthase entC [Escherichia coli UMEA 3342-1]
 gb|ESP25629.1| isochorismate synthase entC [Escherichia coli HVH 86 (4-7026218)]
 gb|ETE18626.1| isochorismate synthase EntC [Escherichia coli LAU-EC6]
 gb|ETF22093.1| isochorismate synthase entC [Escherichia coli HVH 83 (4-2051087)]
 gb|ETF30146.1| isochorismate synthase entC [Escherichia coli HVH 23 (4-6066488)]
 gb|EYB40451.1| isochorismate synthase [Escherichia coli]
 gb|EYB62075.1| isochorismate synthase [Escherichia coli]
 gb|KEJ14958.1| isochorismate synthase entC [Escherichia coli 8-415-05_S4_C2]
 gb|KEJ16375.1| isochorismate synthase entC [Escherichia coli 8-415-05_S4_C1]
 gb|KEJ34641.1| isochorismate synthase entC [Escherichia coli 8-415-05_S4_C3]
 gb|KEN44793.1| isochorismate synthase entC [Escherichia coli 8-415-05_S3_C1]
 gb|KEN76418.1| isochorismate synthase entC [Escherichia coli 8-415-05_S3_C2]
 gb|AID77649.1| isochorismate synthase [Escherichia coli Nissle 1917]
 gb|KEP04614.1| isochorismate synthase [Escherichia coli]
 gb|KEP06755.1| isochorismate synthase [Escherichia coli]
 gb|AIL15846.1| isochorismate synthase entC [Escherichia coli ATCC 25922]
Length=391

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001455372.1| isochorismate synthase EntC [Escherichia coli]
 gb|EIO69007.1| isochorismate synthase entC [Escherichia coli TW11039]
Length=391

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001476831.1| isochorismate synthase EntC [Escherichia coli]
 gb|EKK78930.1| isochorismate synthase EntC [Escherichia coli 8.0416]
Length=391

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>pdb|3HWO|A Chain A, Crystal Structure Of Escherichia Coli Enterobactin-Specific 
Isochorismate Synthase Entc In Complex With Isochorismate
 pdb|3HWO|B Chain B, Crystal Structure Of Escherichia Coli Enterobactin-Specific 
Isochorismate Synthase Entc In Complex With Isochorismate
Length=394

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  4    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  63

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  64   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  123

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  124  QAIPEQTTFEQMVAR  138



>ref|WP_034173296.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_033554952.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_021540154.1| isochorismate synthase entC [Escherichia coli]
 gb|EQT69194.1| isochorismate synthase entC [Escherichia coli HVH 190 (4-3255514)]
 gb|EQX10194.1| isochorismate synthase entC [Escherichia coli UMEA 3155-1]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001651712.1| isochorismate synthase entC [Escherichia coli]
 gb|EMZ74800.1| isochorismate synthase entC [Escherichia coli 2846750]
 gb|ENG22080.1| isochorismate synthase entC [Escherichia coli P0305260.6]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_024218995.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001295851.1| isochorismate synthase EntC [Escherichia coli]
 gb|EGH38865.1| isochorismate synthase [Escherichia coli AA86]
 gb|AEG35358.1| isochorismate synthase [Escherichia coli NA114]
 gb|ELC38674.1| isochorismate synthase entC [Escherichia coli KTE25]
 gb|ELC52769.1| isochorismate synthase entC [Escherichia coli KTE28]
 gb|ELC66861.1| isochorismate synthase entC [Escherichia coli KTE178]
 gb|ELD99674.1| isochorismate synthase entC [Escherichia coli KTE49]
 gb|ELF45580.1| isochorismate synthase entC [Escherichia coli KTE6]
 gb|ELF59631.1| isochorismate synthase entC [Escherichia coli KTE17]
 gb|ELF66408.1| isochorismate synthase entC [Escherichia coli KTE18]
 gb|ELF77311.1| isochorismate synthase entC [Escherichia coli KTE23]
 gb|ELH06415.1| isochorismate synthase entC [Escherichia coli KTE165]
 gb|ELH77334.1| isochorismate synthase entC [Escherichia coli KTE217]
 gb|ELI99412.1| isochorismate synthase entC [Escherichia coli KTE150]
 gb|EQN56234.1| isochorismate synthase entC [Escherichia coli HVH 17 (4-7473087)]
 gb|EQP96843.1| isochorismate synthase entC [Escherichia coli HVH 84 (4-1021478)]
 gb|EQQ18492.1| isochorismate synthase entC [Escherichia coli HVH 90 (4-3191362)]
 gb|EQS08653.1| isochorismate synthase entC [Escherichia coli HVH 141 (4-5995973)]
 gb|EQS42793.1| isochorismate synthase entC [Escherichia coli HVH 146 (4-3189767)]
 gb|EQS71588.1| isochorismate synthase entC [Escherichia coli HVH 154 (4-5636698)]
 gb|EQS85788.1| isochorismate synthase entC [Escherichia coli HVH 162 (4-5627982)]
 gb|EQT27032.1| isochorismate synthase entC [Escherichia coli HVH 176 (4-3428664)]
 gb|EQT62315.1| isochorismate synthase entC [Escherichia coli HVH 186 (4-3405044)]
 gb|EQU40921.1| isochorismate synthase entC [Escherichia coli HVH 202 (4-3163997)]
 gb|EQU57316.1| isochorismate synthase entC [Escherichia coli HVH 205 (4-3094677)]
 gb|EQW68210.1| isochorismate synthase entC [Escherichia coli UMEA 3108-1]
 gb|EQZ97555.1| isochorismate synthase entC [Escherichia coli UMEA 3703-1]
 gb|ERO89484.1| isochorismate synthase entC [Escherichia coli BWH 24]
 gb|ESD06237.1| isochorismate synthase [Escherichia coli 907700]
 gb|AGY83514.1| isochorismate synthase EntC [Escherichia coli JJ1886]
 gb|ESL44059.1| isochorismate synthase entC [Escherichia coli BIDMC 38]
 gb|ESP48282.1| isochorismate synthase entC [Escherichia coli HVH 108 (4-6924867)]
 gb|ETE32142.1| isochorismate synthase EntC [Escherichia coli LAU-EC7]
 gb|ETF21916.1| isochorismate synthase entC [Escherichia coli HVH 177 (4-2876612)]
 emb|CDL06608.1| Isochorismate synthase of siderophore biosynthesis [Escherichia 
coli IS35]
 emb|CDK85792.1| Isochorismate synthase of siderophore biosynthesis [Escherichia 
coli IS29]
 gb|ETX93606.1| isochorismate synthase entC [Escherichia coli BIDMC 20B]
 gb|ETX97735.1| isochorismate synthase entC [Escherichia coli BIDMC 20A]
 gb|ETY43844.1| isochorismate synthase entC [Escherichia coli BWH 34]
 emb|CDL48991.1| isochorismate synthase [Escherichia coli ISC41]
 gb|EYB51050.1| isochorismate synthase [Escherichia coli]
 gb|KCW94533.1| isochorismate synthase [Escherichia coli]
 gb|KDF78508.1| isochorismate synthase entC [Escherichia coli BIDMC 58]
 gb|KDF82344.1| isochorismate synthase entC [Escherichia coli BIDMC 62]
 gb|KDF82986.1| isochorismate synthase entC [Escherichia coli BIDMC 63]
 gb|KDF92919.1| isochorismate synthase entC [Escherichia coli BIDMC 64]
 gb|KDG00951.1| isochorismate synthase entC [Escherichia coli BIDMC 70]
 gb|KDG31140.1| isochorismate synthase entC [Escherichia coli BIDMC 76]
 gb|KDG32713.1| isochorismate synthase entC [Escherichia coli BIDMC 75]
 gb|KDG35614.1| isochorismate synthase entC [Escherichia coli BIDMC 78]
 gb|KDG46342.1| isochorismate synthase entC [Escherichia coli BIDMC 79]
 gb|KDG52772.1| isochorismate synthase entC [Escherichia coli CHS 69]
 gb|KDG53582.1| isochorismate synthase entC [Escherichia coli CHS 68]
 gb|KDG75963.1| isochorismate synthase entC [Escherichia coli UCI 51]
 gb|KDN07516.1| Isochorismate synthase of siderophore biosynthesis [Escherichia 
coli]
 gb|KDY16393.1| isochorismate synthase entC [Escherichia coli 2-316-03_S4_C3]
 gb|KDY42910.1| isochorismate synthase entC [Escherichia coli 2-427-07_S4_C2]
 gb|KEJ41761.1| isochorismate synthase entC [Escherichia coli 2-460-02_S1_C3]
 gb|KEJ61859.1| isochorismate synthase entC [Escherichia coli 3-020-07_S4_C1]
 gb|KEO41825.1| isochorismate synthase entC [Escherichia coli 2-460-02_S1_C2]
 gb|KEP14343.1| isochorismate synthase [Escherichia coli]
 gb|KGP52568.1| isochorismate synthase [Escherichia coli]
 gb|KGP54896.1| isochorismate synthase [Escherichia coli]
 gb|AJO82479.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001298341.1| MULTISPECIES: isochorismate synthase EntC [Escherichia]
 ref|YP_002328067.1| isochorismate synthase 1 [Escherichia coli O127:H6 str. E2348/69]
 ref|YP_002390447.1| isochorismate synthase 1 [Escherichia coli S88]
 ref|YP_002555489.1| Isochorismate synthase entC [Escherichia coli LF82]
 ref|YP_006118903.1| isochorismate synthase [Escherichia coli O83:H1 str. NRG 857C]
 ref|YP_008570534.1| Isochorismate synthase entC [Escherichia coli PMV-1]
 gb|ABG68653.1| Isochorismate synthase EntC [Escherichia coli 536]
 gb|EDV67015.1| isochorismate synthase, entC [Escherichia coli F11]
 emb|CAS08043.1| isochorismate synthase 1 [Escherichia coli O127:H6 str. E2348/69]
 emb|CAR01974.1| isochorismate synthase 1 [Escherichia coli S88]
 emb|CAP75094.1| Isochorismate synthase entC [Escherichia coli LF82]
 dbj|BAI54074.1| isochorismate synthase [Escherichia coli SE15]
 gb|ADE91665.1| isochorismate synthase, entC [Escherichia coli IHE3034]
 gb|EFM54175.1| isochorismate synthase [Escherichia coli NC101]
 gb|ADN72271.1| isochorismate synthase [Escherichia coli UM146]
 gb|EFR18717.1| putative isochorismate synthase [Escherichia coli 2362-75]
 gb|ADR25969.1| isochorismate synthase [Escherichia coli O83:H1 str. NRG 857C]
 gb|EFW68852.1| isochorismate synthase [Escherichia coli WV_060327]
 gb|EFZ76496.1| putative isochorismate synthase [Escherichia coli RN587/1]
 gb|EGB48695.1| chorismate binding enzyme [Escherichia coli H252]
 gb|EGB54059.1| chorismate binding enzyme [Escherichia coli H263]
 gb|EGI26878.1| isochorismate synthase EntC (Isochorismate mutase) [Escherichia 
coli TA206]
 gb|EHG02110.1| isochorismate synthase [Escherichia coli cloneA_i1]
 gb|EHN99633.1| isochorismate synthase entC [Escherichia coli H397]
 gb|EHU14070.1| ENTC isochorismate synthase 1 [Escherichia coli DEC1A]
 gb|EHU16017.1| ENTC isochorismate synthase 1 [Escherichia coli DEC1C]
 gb|EHU19108.1| ENTC isochorismate synthase 1 [Escherichia coli DEC1B]
 gb|EHU27703.1| isochorismate synthase entC [Escherichia coli DEC1D]
 gb|EHU31771.1| ENTC isochorismate synthase 1 [Escherichia coli DEC1E]
 gb|EHU33107.1| isochorismate synthase entC [Escherichia coli DEC2A]
 gb|EHU43882.1| ENTC isochorismate synthase 1 [Escherichia coli DEC2B]
 gb|EHU48033.1| ENTC isochorismate synthase 1 [Escherichia coli DEC2D]
 gb|EHU49912.1| ENTC isochorismate synthase 1 [Escherichia coli DEC2C]
 gb|EHU62917.1| ENTC isochorismate synthase 1 [Escherichia coli DEC2E]
 gb|EIA37765.1| isochorismate synthase EntC [Escherichia coli SCI-07]
 gb|EII84623.1| isochorismate synthase [Escherichia coli 3003]
 gb|EII93744.1| isochorismate synthase [Escherichia coli TW07793]
 gb|EIL45883.1| isochorismate synthase [Escherichia coli KD1]
 gb|EIL75668.1| isochorismate synthase [Escherichia coli HM605]
 gb|EKI31769.1| isochorismate synthase EntC [Escherichia coli ARS4.2123]
 gb|EKI45699.1| isochorismate synthase EntC [Escherichia coli 07798]
 gb|ELC03048.1| isochorismate synthase entC [Escherichia coli KTE4]
 gb|ELC12544.1| isochorismate synthase entC [Escherichia coli KTE5]
 gb|ELC30888.1| isochorismate synthase entC [Escherichia coli KTE16]
 gb|ELC32789.1| isochorismate synthase entC [Escherichia coli KTE15]
 gb|ELC86322.1| isochorismate synthase entC [Escherichia coli KTE189]
 gb|ELD13601.1| isochorismate synthase entC [Escherichia coli KTE205]
 gb|ELD16132.1| isochorismate synthase entC [Escherichia coli KTE206]
 gb|ELD44691.1| isochorismate synthase entC [Escherichia coli KTE216]
 gb|ELD54648.1| isochorismate synthase entC [Escherichia coli KTE224]
 gb|ELE14811.1| isochorismate synthase entC [Escherichia coli KTE55]
 gb|ELE22695.1| isochorismate synthase entC [Escherichia coli KTE57]
 gb|ELE26794.1| isochorismate synthase entC [Escherichia coli KTE58]
 gb|ELE35396.1| isochorismate synthase entC [Escherichia coli KTE62]
 gb|ELE52146.1| isochorismate synthase entC [Escherichia coli KTE72]
 gb|ELE83603.1| isochorismate synthase entC [Escherichia coli KTE86]
 gb|ELE93508.1| isochorismate synthase entC [Escherichia coli KTE93]
 gb|ELF31801.1| isochorismate synthase entC [Escherichia coli KTE162]
 gb|ELF40896.1| isochorismate synthase entC [Escherichia coli KTE169]
 gb|ELF52157.1| isochorismate synthase entC [Escherichia coli KTE8]
 gb|ELF85192.1| isochorismate synthase entC [Escherichia coli KTE43]
 gb|ELF94060.1| isochorismate synthase entC [Escherichia coli KTE22]
 gb|ELG17381.1| isochorismate synthase entC [Escherichia coli KTE59]
 gb|ELG28424.1| isochorismate synthase entC [Escherichia coli KTE65]
 gb|ELG56675.1| isochorismate synthase entC [Escherichia coli KTE118]
 gb|ELG59882.1| isochorismate synthase entC [Escherichia coli KTE123]
 gb|ELH11407.1| isochorismate synthase entC [Escherichia coli KTE192]
 gb|ELH17999.1| isochorismate synthase entC [Escherichia coli KTE194]
 gb|ELH27369.1| isochorismate synthase entC [Escherichia coli KTE173]
 gb|ELH29243.1| isochorismate synthase entC [Escherichia coli KTE175]
 gb|ELH34006.1| isochorismate synthase entC [Escherichia coli KTE183]
 gb|ELH65529.1| isochorismate synthase entC [Escherichia coli KTE207]
 gb|ELH73662.1| isochorismate synthase entC [Escherichia coli KTE211]
 gb|ELH84598.1| isochorismate synthase entC [Escherichia coli KTE215]
 gb|ELH94931.1| isochorismate synthase entC [Escherichia coli KTE227]
 gb|ELH96961.1| isochorismate synthase entC [Escherichia coli KTE229]
 gb|ELI11447.1| isochorismate synthase entC [Escherichia coli KTE104]
 gb|ELI20320.1| isochorismate synthase entC [Escherichia coli KTE109]
 gb|ELI28947.1| isochorismate synthase entC [Escherichia coli KTE113]
 gb|ELI63330.1| isochorismate synthase entC [Escherichia coli KTE129]
 gb|ELI70850.1| isochorismate synthase entC [Escherichia coli KTE131]
 gb|ELI74730.1| isochorismate synthase entC [Escherichia coli KTE133]
 gb|ELI88476.1| isochorismate synthase entC [Escherichia coli KTE139]
 gb|ELI91036.1| isochorismate synthase entC [Escherichia coli KTE145]
 gb|ELJ02492.1| isochorismate synthase entC [Escherichia coli KTE148]
 gb|ELJ16088.1| isochorismate synthase entC [Escherichia coli KTE157]
 gb|ELJ32479.1| isochorismate synthase entC [Escherichia coli KTE168]
 gb|ELJ44295.1| isochorismate synthase entC [Escherichia coli KTE176]
 gb|ELJ57217.1| isochorismate synthase entC [Escherichia coli KTE179]
 gb|ELJ58835.1| isochorismate synthase entC [Escherichia coli KTE180]
 gb|ELJ73539.1| isochorismate synthase entC [Escherichia coli KTE88]
 gb|ELJ75599.1| isochorismate synthase entC [Escherichia coli KTE85]
 gb|ELJ89227.1| isochorismate synthase entC [Escherichia coli KTE94]
 gb|ELL42452.1| isochorismate synthase EntC [Escherichia coli J96]
 gb|EOU38181.1| isochorismate synthase entC [Escherichia coli KTE7]
 gb|EOU40657.1| isochorismate synthase entC [Escherichia coli KTE3]
 gb|EOU56877.1| isochorismate synthase entC [Escherichia coli KTE19]
 gb|EOU81763.1| isochorismate synthase entC [Escherichia coli KTE27]
 gb|EOV11344.1| isochorismate synthase entC [Escherichia coli KTE195]
 gb|EOV40761.1| isochorismate synthase entC [Escherichia coli KTE219]
 gb|EOV97372.1| isochorismate synthase entC [Escherichia coli KTE89]
 gb|EOX01715.1| isochorismate synthase entC [Escherichia coli KTE182]
 gb|EOX16389.1| isochorismate synthase entC [Escherichia coli KTE240]
 gb|EOX24840.1| isochorismate synthase entC [Escherichia coli KTE185]
 emb|CDC77892.1| isochorismate synthase [Escherichia coli CAG:4]
 gb|EQN06550.1| isochorismate synthase entC [Escherichia coli HVH 1 (4-6876161)]
 gb|EQN09845.1| isochorismate synthase entC [Escherichia coli HVH 3 (4-7276001)]
 gb|EQN22222.1| isochorismate synthase entC [Escherichia coli HVH 5 (4-7148410)]
 gb|EQN23957.1| isochorismate synthase entC [Escherichia coli HVH 4 (4-7276109)]
 gb|EQN34574.1| isochorismate synthase entC [Escherichia coli HVH 9 (4-6942539)]
 gb|EQN83125.1| isochorismate synthase entC [Escherichia coli HVH 21 (4-4517873)]
 gb|EQN86665.1| isochorismate synthase entC [Escherichia coli HVH 24 (4-5985145)]
 gb|EQN98881.1| isochorismate synthase entC [Escherichia coli HVH 26 (4-5703913)]
 gb|EQO09895.1| isochorismate synthase entC [Escherichia coli HVH 28 (4-0907367)]
 gb|EQO24143.1| isochorismate synthase entC [Escherichia coli HVH 30 (4-2661829)]
 gb|EQO26878.1| isochorismate synthase entC [Escherichia coli HVH 32 (4-3773988)]
 gb|EQO34672.1| isochorismate synthase entC [Escherichia coli HVH 35 (4-2962667)]
 gb|EQO53712.1| isochorismate synthase entC [Escherichia coli HVH 38 (4-2774682)]
 gb|EQO64278.1| isochorismate synthase entC [Escherichia coli HVH 42 (4-2100061)]
 gb|EQO86982.1| isochorismate synthase entC [Escherichia coli HVH 48 (4-2658593)]
 gb|EQO91453.1| isochorismate synthase entC [Escherichia coli HVH 46 (4-2758776)]
 gb|EQP02641.1| isochorismate synthase entC [Escherichia coli HVH 55 (4-2646161)]
 gb|EQP11836.1| isochorismate synthase entC [Escherichia coli HVH 56 (4-2153033)]
 gb|EQP53540.1| isochorismate synthase entC [Escherichia coli HVH 73 (4-2393174)]
 gb|EQP59432.1| isochorismate synthase entC [Escherichia coli HVH 70 (4-2963531)]
 gb|EQP63169.1| isochorismate synthase entC [Escherichia coli HVH 76 (4-2538717)]
 gb|EQP72651.1| isochorismate synthase entC [Escherichia coli HVH 78 (4-2735946)]
 gb|EQP80860.1| isochorismate synthase entC [Escherichia coli HVH 80 (4-2428830)]
 gb|EQQ35503.1| isochorismate synthase entC [Escherichia coli HVH 100 (4-2850729)]
 gb|EQQ43120.1| isochorismate synthase entC [Escherichia coli HVH 102 (4-6906788)]
 gb|EQQ53576.1| isochorismate synthase entC [Escherichia coli HVH 104 (4-6977960)]
 gb|EQQ78709.1| isochorismate synthase entC [Escherichia coli HVH 111 (4-7039018)]
 gb|EQQ80785.1| isochorismate synthase entC [Escherichia coli HVH 107 (4-5860571)]
 gb|EQQ91942.1| isochorismate synthase entC [Escherichia coli HVH 112 (4-5987253)]
 gb|EQR26717.1| isochorismate synthase entC [Escherichia coli HVH 118 (4-7345399)]
 gb|EQR46635.1| isochorismate synthase entC [Escherichia coli HVH 125 (4-2634716)]
 gb|EQR50457.1| isochorismate synthase entC [Escherichia coli HVH 126 (4-6034225)]
 gb|EQR55287.1| isochorismate synthase entC [Escherichia coli HVH 127 (4-7303629)]
 gb|EQR62969.1| isochorismate synthase entC [Escherichia coli HVH 128 (4-7030436)]
 gb|EQR89870.1| isochorismate synthase entC [Escherichia coli HVH 137 (4-2124971)]
 gb|EQR96506.1| isochorismate synthase entC [Escherichia coli HVH 138 (4-6066704)]
 gb|EQS17361.1| isochorismate synthase entC [Escherichia coli HVH 143 (4-5674999)]
 gb|EQS55449.1| isochorismate synthase entC [Escherichia coli HVH 153 (3-9344314)]
 gb|EQS61753.1| isochorismate synthase entC [Escherichia coli HVH 158 (4-3224287)]
 gb|EQT04430.1| isochorismate synthase entC [Escherichia coli HVH 171 (4-3191958)]
 gb|EQT04915.1| isochorismate synthase entC [Escherichia coli HVH 170 (4-3026949)]
 gb|EQT29837.1| isochorismate synthase entC [Escherichia coli HVH 175 (4-3405184)]
 gb|EQT31411.1| isochorismate synthase entC [Escherichia coli HVH 180 (4-3051617)]
 gb|EQT48717.1| isochorismate synthase entC [Escherichia coli HVH 184 (4-3343286)]
 gb|EQT54265.1| isochorismate synthase entC [Escherichia coli HVH 185 (4-2876639)]
 gb|EQT84817.1| isochorismate synthase entC [Escherichia coli HVH 191 (3-9341900)]
 gb|EQT87151.1| isochorismate synthase entC [Escherichia coli HVH 192 (4-3054470)]
 gb|EQT98746.1| isochorismate synthase entC [Escherichia coli HVH 194 (4-2356805)]
 gb|EQU01011.1| isochorismate synthase entC [Escherichia coli HVH 196 (4-4530470)]
 gb|EQU14607.1| isochorismate synthase entC [Escherichia coli HVH 199 (4-5670322)]
 gb|EQU16204.1| isochorismate synthase entC [Escherichia coli HVH 198 (4-3206106)]
 gb|EQU26024.1| isochorismate synthase entC [Escherichia coli HVH 197 (4-4466217)]
 gb|EQU27303.1| isochorismate synthase entC [Escherichia coli HVH 201 (4-4459431)]
 gb|EQU38712.1| isochorismate synthase entC [Escherichia coli HVH 203 (4-3126218)]
 gb|EQU75111.1| isochorismate synthase entC [Escherichia coli HVH 211 (4-3041891)]
 gb|EQU88491.1| isochorismate synthase entC [Escherichia coli HVH 213 (4-3042928)]
 gb|EQU97658.1| isochorismate synthase entC [Escherichia coli HVH 217 (4-1022806)]
 gb|EQV34778.1| isochorismate synthase entC [Escherichia coli KOEGE 30 (63a)]
 gb|EQV37108.1| isochorismate synthase entC [Escherichia coli HVH 225 (4-1273116)]
 gb|EQV38730.1| isochorismate synthase entC [Escherichia coli KOEGE 32 (66a)]
 gb|EQV73494.1| isochorismate synthase entC [Escherichia coli KOEGE 58 (171a)]
 gb|EQV73728.1| isochorismate synthase entC [Escherichia coli KOEGE 56 (169a)]
 gb|EQV90792.1| isochorismate synthase entC [Escherichia coli KOEGE 70 (185a)]
 gb|EQW22365.1| isochorismate synthase entC [Escherichia coli UMEA 3022-1]
 gb|EQW36055.1| isochorismate synthase entC [Escherichia coli UMEA 3041-1]
 gb|EQW46444.1| isochorismate synthase entC [Escherichia coli UMEA 3053-1]
 gb|EQW58599.1| isochorismate synthase entC [Escherichia coli UMEA 3097-1]
 gb|EQW66964.1| isochorismate synthase entC [Escherichia coli UMEA 3088-1]
 gb|EQW72565.1| isochorismate synthase entC [Escherichia coli UMEA 3113-1]
 gb|EQW90074.1| isochorismate synthase entC [Escherichia coli UMEA 3122-1]
 gb|EQX03750.1| isochorismate synthase entC [Escherichia coli UMEA 3152-1]
 gb|EQX22307.1| isochorismate synthase entC [Escherichia coli UMEA 3160-1]
 gb|EQX31692.1| isochorismate synthase entC [Escherichia coli UMEA 3162-1]
 gb|EQX69636.1| isochorismate synthase entC [Escherichia coli UMEA 3185-1]
 gb|EQX78844.1| isochorismate synthase entC [Escherichia coli UMEA 3193-1]
 gb|EQY04728.1| isochorismate synthase entC [Escherichia coli UMEA 3203-1]
 gb|EQY06340.1| isochorismate synthase entC [Escherichia coli UMEA 3206-1]
 gb|EQY18167.1| isochorismate synthase entC [Escherichia coli UMEA 3215-1]
 gb|EQY28210.1| isochorismate synthase entC [Escherichia coli UMEA 3217-1]
 gb|EQY47218.1| isochorismate synthase entC [Escherichia coli UMEA 3221-1]
 gb|EQY47931.1| isochorismate synthase entC [Escherichia coli UMEA 3230-1]
 gb|EQY60712.1| isochorismate synthase entC [Escherichia coli UMEA 3244-1]
 gb|EQZ16680.1| isochorismate synthase entC [Escherichia coli UMEA 3341-1]
 gb|EQZ22975.1| isochorismate synthase entC [Escherichia coli UMEA 3391-1]
 gb|EQZ24868.1| isochorismate synthase entC [Escherichia coli UMEA 3585-1]
 gb|EQZ43579.1| isochorismate synthase entC [Escherichia coli UMEA 3617-1]
 gb|EQZ56645.1| isochorismate synthase entC [Escherichia coli UMEA 3632-1]
 gb|EQZ61341.1| isochorismate synthase entC [Escherichia coli UMEA 3662-1]
 gb|EQZ82978.1| isochorismate synthase entC [Escherichia coli UMEA 3702-1]
 gb|ERA25305.1| isochorismate synthase entC [Escherichia coli UMEA 3893-1]
 gb|ERA26430.1| isochorismate synthase entC [Escherichia coli UMEA 3834-1]
 gb|ERA35056.1| isochorismate synthase entC [Escherichia coli UMEA 3955-1]
 gb|ERA40062.1| isochorismate synthase entC [Escherichia coli UMEA 4075-1]
 gb|ERA51317.1| isochorismate synthase entC [Escherichia coli UMEA 4076-1]
 gb|ERA93215.1| isochorismate synthase entC [Escherichia coli HVH 210 (4-3042480)]
 gb|ERA96456.1| isochorismate synthase entC [Escherichia coli HVH 228 (4-7787030)]
 gb|ERB11293.1| isochorismate synthase entC [Escherichia coli KOEGE 10 (25a)]
 gb|ERB38319.1| isochorismate synthase entC [Escherichia coli UMEA 3298-1]
 emb|CDH64120.1| Isochorismate synthase entC [Escherichia coli PMV-1]
 gb|ESK20519.1| isochorismate synthase entC [Escherichia coli UMEA 3290-1]
 gb|ESK21165.1| isochorismate synthase entC [Escherichia coli UMEA 3426-1]
 gb|ESK31658.1| isochorismate synthase entC [Escherichia coli UMEA 3693-1]
 gb|ESP23789.1| isochorismate synthase entC [Escherichia coli HVH 12 (4-7653042)]
 gb|ESP34143.1| isochorismate synthase entC [Escherichia coli HVH 178 (4-3189163)]
 gb|ETF26219.1| isochorismate synthase entC [Escherichia coli HVH 214 (4-3062198)]
 gb|ETF33149.1| isochorismate synthase entC [Escherichia coli UMEA 3489-1]
 gb|ETY51868.1| isochorismate synthase entC [Escherichia coli BIDMC 49b]
 gb|ETY53677.1| isochorismate synthase entC [Escherichia coli BIDMC 49a]
 gb|EZQ62168.1| isochorismate synthase entC [Escherichia coli BIDMC 83]
 gb|KDG07368.1| isochorismate synthase entC [Escherichia coli BIDMC 65]
 gb|KDG11413.1| isochorismate synthase entC [Escherichia coli BIDMC 72]
 gb|KDG11906.1| isochorismate synthase entC [Escherichia coli BIDMC 73]
 gb|KDO91623.1| isochorismate synthase [Escherichia coli]
 gb|KDT45015.1| isochorismate synthase entC [Escherichia coli 3-105-05_S4_C2]
 gb|KDZ54130.1| isochorismate synthase entC [Escherichia coli 3-073-06_S1_C1]
 gb|KEJ81132.1| isochorismate synthase entC [Escherichia coli 6-175-07_S3_C2]
 gb|KEL98276.1| isochorismate synthase entC [Escherichia coli 6-175-07_S3_C1]
 gb|KEM05950.1| isochorismate synthase entC [Escherichia coli 6-175-07_S3_C3]
 gb|KEM23864.1| isochorismate synthase entC [Escherichia coli 6-319-05_S3_C1]
 gb|KEM33907.1| isochorismate synthase entC [Escherichia coli 6-319-05_S3_C2]
 gb|KEM65381.1| isochorismate synthase entC [Escherichia coli 6-319-05_S3_C3]
 gb|KFB92088.1| isochorismate synthase of siderophore biosynthesis [Escherichia 
coli DSM 30083 = JCM 1649 = ATCC 11775]
 gb|KFH82429.1| isochorismate synthase [Escherichia coli]
 gb|KFH92897.1| isochorismate synthase [Escherichia coli]
 gb|AJB38388.1| isochorismate synthase EntC [Escherichia coli APEC IMT5155]
 gb|KIE68992.1| isochorismate synthase [Escherichia coli]
 gb|KIE74666.1| isochorismate synthase [Escherichia coli]
 gb|KIE83839.1| isochorismate synthase [Escherichia coli RS218]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032304745.1| isochorismate synthase [Escherichia coli]
 gb|KEL24301.1| isochorismate synthase entC [Escherichia coli 5-172-05_S4_C2]
 gb|KEL37213.1| isochorismate synthase entC [Escherichia coli 5-172-05_S4_C1]
 gb|KEL63410.1| isochorismate synthase entC [Escherichia coli 5-172-05_S4_C3]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001359696.1| isochorismate synthase EntC [Escherichia coli]
 gb|EFX27581.1| isochorismate synthase EntC [Escherichia coli O55:H7 str. USDA 
5905]
 gb|EKI01426.1| isochorismate synthase EntC [Escherichia coli 5905]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032248681.1| isochorismate synthase [Escherichia coli]
 gb|KDT92457.1| isochorismate synthase entC [Escherichia coli 3-105-05_S4_C1]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_000381303.1| MULTISPECIES: isochorismate synthase 1 [Enterobacteriaceae]
 ref|NP_286320.1| isochorismate synthase [Escherichia coli O157:H7 str. EDL933]
 ref|NP_308659.1| isochorismate synthase [Escherichia coli O157:H7 str. Sakai]
 ref|NP_415125.1| isochorismate synthase 1 [Escherichia coli str. K-12 substr. 
MG1655]
 ref|YP_402220.1| isochorismate hydroxymutase [Shigella dysenteriae Sd197]
 ref|YP_001457407.1| isochorismate synthase [Escherichia coli HS]
 ref|YP_001729494.1| isochorismate synthase 1 [Escherichia coli str. K-12 substr. 
DH10B]
 ref|YP_001729595.1| isochorismate synthase 1 [Escherichia coli str. K-12 substr. 
DH10B]
 ref|YP_488882.1| isochorismate synthase 1 [Escherichia coli str. K-12 substr. 
W3110]
 sp|P0AEJ3.1|ENTC_ECO57 RecName: Full=Isochorismate synthase EntC; AltName: Full=Isochorismate 
mutase [Escherichia coli O157:H7]
 sp|P0AEJ2.1|ENTC_ECOLI RecName: Full=Isochorismate synthase EntC; AltName: Full=Isochorismate 
mutase [Escherichia coli K-12]
 gb|AAG54928.1|AE005239_3 isochorismate hydroxymutase 2, enterochelin biosynthesis [Escherichia 
coli O157:H7 str. EDL933]
 gb|AAA16100.1| isochorismate synthase [Escherichia coli]
 gb|AAC73694.1| isochorismate synthase 1 [Escherichia coli str. K-12 substr. 
MG1655]
 dbj|BAB34055.1| isochorismate hydroxymutase 2 [Escherichia coli O157:H7 str. 
Sakai]
 gb|ABB60731.1| isochorismate hydroxymutase 2 [Shigella dysenteriae Sd197]
 dbj|BAE76348.1| isochorismate synthase 1 [Escherichia coli str. K-12 substr. 
W3110]
 gb|ABV05024.1| isochorismate synthase, entC [Escherichia coli HS]
 gb|ACA78675.1| isochorismate synthase [Escherichia coli ATCC 8739]
 gb|ACB01716.1| isochorismate synthase 1 [Escherichia coli str. K-12 substr. 
DH10B]
 gb|ACB01817.1| isochorismate synthase 1 [Escherichia coli str. K-12 substr. 
DH10B]
 gb|EDU33632.1| isochorismate synthase, entC [Escherichia coli O157:H7 str. EC4196]
 gb|EDU55764.1| isochorismate synthase, entC [Escherichia coli O157:H7 str. EC4113]
 gb|EDU71687.1| isochorismate synthase, entC [Escherichia coli O157:H7 str. EC4076]
 gb|EDU76542.1| isochorismate synthase, entC [Escherichia coli O157:H7 str. EC4401]
 gb|EDU79335.1| isochorismate synthase, entC [Escherichia coli O157:H7 str. EC4486]
 gb|EDU87613.1| isochorismate synthase, entC [Escherichia coli O157:H7 str. EC4501]
 gb|EDU92178.1| isochorismate synthase, entC [Escherichia coli O157:H7 str. EC869]
 gb|EDU97804.1| isochorismate synthase, entC [Escherichia coli O157:H7 str. EC508]
 gb|EDZ78722.1| isochorismate synthase, entC [Escherichia coli O157:H7 str. EC4206]
 gb|EDZ80282.1| isochorismate synthase, entC [Escherichia coli O157:H7 str. EC4045]
 gb|EDZ84912.1| isochorismate synthase, entC [Escherichia coli O157:H7 str. EC4042]
 gb|ACI36818.1| isochorismate synthase, entC [Escherichia coli O157:H7 str. EC4115]
 gb|ACI87071.1| isochorismate hydroxymutase 2 [Escherichia coli]
 gb|ACI87072.1| isochorismate hydroxymutase 2 [Escherichia coli]
 gb|ACI87073.1| isochorismate hydroxymutase 2 [Escherichia coli]
 gb|ACI87074.1| isochorismate hydroxymutase 2 [Escherichia coli]
 gb|ACI87075.1| isochorismate hydroxymutase 2 [Escherichia coli]
 gb|EEC29655.1| isochorismate synthase, entC [Escherichia coli O157:H7 str. TW14588]
 gb|ACR63558.1| isochorismate synthase 1 [Escherichia coli BW2952]
 gb|ACT70521.1| isochorismate synthase 1 [Escherichia coli O157:H7 str. TW14359]
 gb|ACX40661.1| isochorismate synthase [Escherichia coli DH1]
 gb|ADD55379.1| Isochorismate synthase entC [Escherichia coli O55:H7 str. CB9615]
 gb|EFI86306.1| isochorismate synthase [Escherichia coli MS 196-1]
 gb|EFJ64014.1| isochorismate synthase [Escherichia coli MS 175-1]
 gb|EFK13234.1| isochorismate synthase [Escherichia coli MS 116-1]
 gb|EFP71561.1| isochorismate synthase [Shigella dysenteriae 1617]
 gb|EFQ02456.1| putative isochorismate synthase [Escherichia coli 1827-70]
 dbj|BAJ42419.1| isochorismate synthase entC [Escherichia coli DH1]
 gb|EFU97109.1| putative isochorismate synthase [Escherichia coli 3431]
 gb|EFW67643.1| isochorismate synthase [Escherichia coli O157:H7 str. EC1212]
 gb|EFX07807.1| isochorismate synthase EntC [Escherichia coli O157:H7 str. G5101]
 gb|EFX12619.1| isochorismate synthase EntC [Escherichia coli O157:H- str. 493-89]
 gb|EFX17411.1| isochorismate synthase EntC [Escherichia coli O157:H- str. H 
2687]
 gb|EFX22417.1| isochorismate synthase EntC [Escherichia coli O55:H7 str. 3256-97 
TW 07815]
 gb|EFX31983.1| isochorismate synthase EntC [Escherichia coli O157:H7 str. LSU-61]
 gb|EGB34609.1| chorismate binding enzyme [Escherichia coli E1520]
 gb|EGB39166.1| chorismate binding enzyme [Escherichia coli E482]
 gb|EGB41227.1| chorismate binding enzyme [Escherichia coli H120]
 gb|EGB67343.1| chorismate binding enzyme [Escherichia coli TA007]
 gb|EGD65139.1| isochorismate synthase [Escherichia coli O157:H7 str. 1044]
 gb|EGD69613.1| isochorismate synthase [Escherichia coli O157:H7 str. 1125]
 gb|AEJ55223.1| putative isochorismate synthase [Escherichia coli UMNF18]
 gb|EGU25996.1| isochorismate synthase EntC [Escherichia coli XH140A]
 gb|EGV46927.1| isochorismate synthase EntC [Escherichia coli XH001]
 gb|EGW98193.1| putative isochorismate synthase [Escherichia coli STEC_EH250]
 gb|EGX12749.1| putative isochorismate synthase [Escherichia coli G58-1]
 gb|EGX20527.1| putative isochorismate synthase [Escherichia coli STEC_S1191]
 dbj|BAL37757.1| isochorismate synthase 1 [Escherichia coli str. K-12 substr. 
MDS42]
 gb|AEZ39356.1| isochorismate synthase EntC [Escherichia coli O55:H7 str. RM12579]
 gb|EHU64504.1| ENTC isochorismate synthase 1 [Escherichia coli DEC3A]
 gb|EHU66332.1| ENTC isochorismate synthase 1 [Escherichia coli DEC3B]
 gb|EHU77882.1| ENTC isochorismate synthase 1 [Escherichia coli DEC3C]
 gb|EHU82030.1| ENTC isochorismate synthase 1 [Escherichia coli DEC3D]
 gb|EHU84422.1| ENTC isochorismate synthase 1 [Escherichia coli DEC3E]
 gb|EHU95653.1| ENTC isochorismate synthase 1 [Escherichia coli DEC3F]
 gb|EHU97871.1| ENTC isochorismate synthase 1 [Escherichia coli DEC4A]
 gb|EHV03029.1| ENTC isochorismate synthase 1 [Escherichia coli DEC4B]
 gb|EHV13128.1| ENTC isochorismate synthase 1 [Escherichia coli DEC4C]
 gb|EHV14919.1| ENTC isochorismate synthase 1 [Escherichia coli DEC4D]
 gb|EHV17709.1| ENTC isochorismate synthase 1 [Escherichia coli DEC4E]
 gb|EHV28886.1| ENTC isochorismate synthase 1 [Escherichia coli DEC5A]
 gb|EHV30959.1| ENTC isochorismate synthase 1 [Escherichia coli DEC4F]
 gb|EHV35841.1| ENTC isochorismate synthase 1 [Escherichia coli DEC5B]
 gb|EHV43672.1| ENTC isochorismate synthase 1 [Escherichia coli DEC5C]
 gb|EHV43754.1| ENTC isochorismate synthase 1 [Escherichia coli DEC5D]
 gb|EHV50564.1| isochorismate synthase entC [Escherichia coli DEC5E]
 gb|EHV62656.1| isochorismate synthase entC [Escherichia coli DEC6A]
 gb|EHV64617.1| ENTC isochorismate synthase 1 [Escherichia coli DEC6B]
 gb|EHV66444.1| isochorismate synthase entC [Escherichia coli DEC6C]
 gb|EHV76267.1| isochorismate synthase entC [Escherichia coli DEC6D]
 gb|EHV79308.1| ENTC isochorismate synthase 1 [Escherichia coli DEC6E]
 gb|EHV99864.1| ENTC isochorismate synthase 1 [Escherichia coli DEC7B]
 gb|AFG39456.1| Isochorismate synthase entC [Escherichia coli P12b]
 gb|EIF16712.1| isochorismate synthase EntC [Escherichia coli O32:H37 str. P4]
 gb|EIF86877.1| isochorismate synthase entC [Escherichia coli M919]
 gb|EIG71875.1| isochorismate synthase entC [Escherichia sp. 4_1_40B]
 gb|EII45005.1| isochorismate synthase [Escherichia coli 2.3916]
 gb|EII64543.1| isochorismate synthase [Escherichia coli 2.4168]
 gb|EII78679.1| isochorismate synthase [Escherichia coli 3.2303]
 gb|EIJ05209.1| isochorismate synthase [Escherichia coli B41]
 gb|AFJ27663.1| isochorismate synthase [Escherichia coli Xuzhou21]
 gb|EIL61906.1| isochorismate synthase [Escherichia coli 75]
 gb|EIN29046.1| isochorismate synthase EntC [Escherichia coli FRIK1996]
 gb|EIN30780.1| isochorismate synthase EntC [Escherichia coli FDA517]
 gb|EIN31209.1| isochorismate synthase EntC [Escherichia coli FDA505]
 gb|EIN46193.1| isochorismate synthase EntC [Escherichia coli 93-001]
 gb|EIN48933.1| isochorismate synthase EntC [Escherichia coli FRIK1990]
 gb|EIN49779.1| isochorismate synthase EntC [Escherichia coli FRIK1985]
 gb|EIN63521.1| isochorismate synthase EntC [Escherichia coli PA3]
 gb|EIN66594.1| isochorismate synthase EntC [Escherichia coli PA9]
 gb|EIN81454.1| isochorismate synthase EntC [Escherichia coli PA10]
 gb|EIN83033.1| isochorismate synthase EntC [Escherichia coli PA15]
 gb|EIN84767.1| isochorismate synthase EntC [Escherichia coli PA14]
 gb|EIN93013.1| isochorismate synthase EntC [Escherichia coli PA22]
 gb|EIO04844.1| isochorismate synthase EntC [Escherichia coli PA25]
 gb|EIO05006.1| isochorismate synthase EntC [Escherichia coli PA24]
 gb|EIO07740.1| isochorismate synthase EntC [Escherichia coli PA28]
 gb|EIO21753.1| isochorismate synthase EntC [Escherichia coli PA31]
 gb|EIO22002.1| isochorismate synthase EntC [Escherichia coli PA32]
 gb|EIO24205.1| isochorismate synthase EntC [Escherichia coli PA33]
 gb|EIO31828.1| isochorismate synthase EntC [Escherichia coli PA40]
 gb|EIO43912.1| isochorismate synthase EntC [Escherichia coli PA41]
 gb|EIO45608.1| isochorismate synthase EntC [Escherichia coli PA42]
 gb|EIO51130.1| isochorismate synthase EntC [Escherichia coli PA39]
 gb|EIO53071.1| isochorismate synthase EntC [Escherichia coli TW06591]
 gb|EIO59433.1| isochorismate synthase EntC [Escherichia coli TW10246]
 gb|EIO76237.1| isochorismate synthase EntC [Escherichia coli TW07945]
 gb|EIO78237.1| isochorismate synthase EntC [Escherichia coli TW09109]
 gb|EIO85487.1| isochorismate synthase EntC [Escherichia coli TW10119]
 gb|EIO88885.1| isochorismate synthase EntC [Escherichia coli TW09098]
 gb|EIP01439.1| isochorismate synthase EntC [Escherichia coli EC4203]
 gb|EIP03909.1| isochorismate synthase EntC [Escherichia coli EC4196]
 gb|EIP05510.1| isochorismate synthase EntC [Escherichia coli TW09195]
 gb|EIP18111.1| isochorismate synthase EntC [Escherichia coli TW14301]
 gb|EIP21719.1| isochorismate synthase EntC [Escherichia coli EC4421]
 gb|EIP22078.1| isochorismate synthase EntC [Escherichia coli TW14313]
 gb|EIP32810.1| isochorismate synthase EntC [Escherichia coli EC4422]
 gb|EIP36912.1| isochorismate synthase EntC [Escherichia coli EC4013]
 gb|EIP46138.1| isochorismate synthase EntC [Escherichia coli EC4402]
 gb|EIP47789.1| isochorismate synthase EntC [Escherichia coli EC4439]
 gb|EIP53798.1| isochorismate synthase EntC [Escherichia coli EC4436]
 gb|EIP56541.1| isochorismate synthase EntC [Escherichia coli EC1738]
 gb|EIP68365.1| isochorismate synthase EntC [Escherichia coli EC1734]
 gb|EIP68926.1| isochorismate synthase EntC [Escherichia coli EC4437]
 gb|EIP73469.1| isochorismate synthase EntC [Escherichia coli EC4448]
 gb|EIP82445.1| isochorismate synthase EntC [Escherichia coli EC1863]
 gb|EIP83608.1| isochorismate synthase EntC [Escherichia coli EC1845]
 gb|EJZ49347.1| isochorismate synthase entC [Escherichia sp. 1_1_43]
 gb|EKH06357.1| isochorismate synthase EntC [Escherichia coli PA7]
 gb|EKH09709.1| isochorismate synthase EntC [Escherichia coli FRIK920]
 gb|EKH19408.1| isochorismate synthase EntC [Escherichia coli PA34]
 gb|EKH23204.1| isochorismate synthase EntC [Escherichia coli FDA506]
 gb|EKH28317.1| isochorismate synthase EntC [Escherichia coli FDA507]
 gb|EKH34595.1| isochorismate synthase EntC [Escherichia coli FDA504]
 gb|EKH41707.1| isochorismate synthase EntC [Escherichia coli FRIK1999]
 gb|EKH47742.1| isochorismate synthase EntC [Escherichia coli FRIK1997]
 gb|EKH52736.1| isochorismate synthase EntC [Escherichia coli NE1487]
 gb|EKH60356.1| isochorismate synthase EntC [Escherichia coli NE037]
 gb|EKH62140.1| isochorismate synthase EntC [Escherichia coli FRIK2001]
 gb|EKH70774.1| isochorismate synthase EntC [Escherichia coli PA4]
 gb|EKH78745.1| isochorismate synthase EntC [Escherichia coli PA23]
 gb|EKH81030.1| isochorismate synthase EntC [Escherichia coli PA49]
 gb|EKH85760.1| isochorismate synthase EntC [Escherichia coli PA45]
 gb|EKH94184.1| isochorismate synthase EntC [Escherichia coli TT12B]
 gb|EKH99012.1| isochorismate synthase EntC [Escherichia coli MA6]
 gb|EKI12828.1| isochorismate synthase EntC [Escherichia coli CB7326]
 gb|EKI17175.1| isochorismate synthase EntC [Escherichia coli EC96038]
 gb|EKI17394.1| isochorismate synthase EntC [Escherichia coli 5412]
 gb|EKI23565.1| isochorismate synthase EntC [Escherichia coli TW15901]
 gb|EKI30550.1| isochorismate synthase EntC [Escherichia coli TW00353]
 gb|EKI55967.1| isochorismate synthase EntC [Escherichia coli PA38]
 gb|EKI61690.1| isochorismate synthase EntC [Escherichia coli EC1735]
 gb|EKI70870.1| isochorismate synthase EntC [Escherichia coli EC1736]
 gb|EKI74308.1| isochorismate synthase EntC [Escherichia coli EC1737]
 gb|EKI80242.1| isochorismate synthase EntC [Escherichia coli EC1846]
 gb|EKI88609.1| isochorismate synthase EntC [Escherichia coli EC1847]
 gb|EKI90067.1| isochorismate synthase EntC [Escherichia coli EC1848]
 gb|EKI98434.1| isochorismate synthase EntC [Escherichia coli EC1849]
 gb|EKJ04066.1| isochorismate synthase EntC [Escherichia coli EC1850]
 gb|EKJ06352.1| isochorismate synthase EntC [Escherichia coli EC1856]
 gb|EKJ18089.1| isochorismate synthase EntC [Escherichia coli EC1862]
 gb|EKJ18409.1| isochorismate synthase EntC [Escherichia coli EC1864]
 gb|EKJ33598.1| isochorismate synthase EntC [Escherichia coli EC1868]
 gb|EKJ33736.1| isochorismate synthase EntC [Escherichia coli EC1866]
 gb|EKJ46425.1| isochorismate synthase EntC [Escherichia coli EC1869]
 gb|EKJ51274.1| isochorismate synthase EntC [Escherichia coli NE098]
 gb|EKJ52637.1| isochorismate synthase EntC [Escherichia coli EC1870]
 gb|EKJ64335.1| isochorismate synthase EntC [Escherichia coli FRIK523]
 gb|EKJ66494.1| isochorismate synthase EntC [Escherichia coli 0.1304]
 gb|EKK34804.1| isochorismate synthase entC [Escherichia coli 5.2239]
 gb|EKK35207.1| isochorismate synthase entC [Escherichia coli 3.4870]
 gb|EKK36205.1| isochorismate synthase EntC [Escherichia coli 6.0172]
 gb|EKK48615.1| isochorismate synthase EntC [Escherichia coli 8.0566]
 gb|EKK49146.1| isochorismate synthase entC [Escherichia coli 8.0569]
 gb|EKK59991.1| isochorismate synthase entC [Escherichia coli 8.0586]
 gb|EKK64543.1| isochorismate synthase entC [Escherichia coli 8.2524]
 gb|EKK66198.1| isochorismate synthase EntC [Escherichia coli 10.0833]
 gb|EKK77577.1| isochorismate synthase entC [Escherichia coli 10.0869]
 gb|EKK83419.1| isochorismate synthase entC [Escherichia coli 88.0221]
 gb|EKK90012.1| isochorismate synthase entC [Escherichia coli 10.0821]
 gb|EKV83615.1| isochorismate synthase entC [Escherichia coli 88.1042]
 gb|EKV85469.1| isochorismate synthase entC [Escherichia coli 89.0511]
 gb|EKV85809.1| isochorismate synthase entC [Escherichia coli 88.1467]
 gb|EKW01417.1| isochorismate synthase entC [Escherichia coli 90.2281]
 gb|EKW01532.1| isochorismate synthase entC [Escherichia coli 90.0039]
 gb|EKW03511.1| isochorismate synthase entC [Escherichia coli 90.0091]
 gb|EKW17837.1| isochorismate synthase entC [Escherichia coli 93.0056]
 gb|EKW19252.1| isochorismate synthase entC [Escherichia coli 93.0055]
 gb|EKW20286.1| isochorismate synthase entC [Escherichia coli 94.0618]
 gb|EKW34998.1| isochorismate synthase entC [Escherichia coli 95.0943]
 gb|EKW35215.1| isochorismate synthase entC [Escherichia coli 95.0183]
 gb|EKW40315.1| isochorismate synthase entC [Escherichia coli 95.1288]
 gb|EKW50055.1| isochorismate synthase entC [Escherichia coli 96.0428]
 gb|EKW55175.1| isochorismate synthase entC [Escherichia coli 96.0427]
 gb|EKW56780.1| isochorismate synthase entC [Escherichia coli 96.0939]
 gb|EKW67166.1| isochorismate synthase entC [Escherichia coli 97.0003]
 gb|EKW68640.1| isochorismate synthase entC [Escherichia coli 96.0932]
 gb|EKW72744.1| isochorismate synthase entC [Escherichia coli 96.0107]
 gb|EKW83012.1| isochorismate synthase entC [Escherichia coli 97.1742]
 gb|EKW83827.1| isochorismate synthase entC [Escherichia coli 97.0007]
 gb|EKW94927.1| isochorismate synthase entC [Escherichia coli 99.0713]
 gb|EKW95087.1| isochorismate synthase EntC [Escherichia coli 99.0678]
 gb|EKY43498.1| isochorismate synthase entC [Escherichia coli 96.0109]
 gb|EKY45154.1| isochorismate synthase entC [Escherichia coli 97.0010]
 gb|ELC64000.1| isochorismate synthase entC [Escherichia coli KTE44]
 gb|ELD31538.1| isochorismate synthase entC [Escherichia coli KTE212]
 gb|ELD66485.1| isochorismate synthase entC [Escherichia coli KTE233]
 gb|ELD73155.1| isochorismate synthase entC [Escherichia coli KTE234]
 gb|ELE04728.1| isochorismate synthase entC [Escherichia coli KTE51]
 gb|ELE12925.1| isochorismate synthase entC [Escherichia coli KTE56]
 gb|ELE65640.1| isochorismate synthase entC [Escherichia coli KTE77]
 gb|ELE74220.1| isochorismate synthase entC [Escherichia coli KTE81]
 gb|ELF01869.1| isochorismate synthase entC [Escherichia coli KTE111]
 gb|ELF11117.1| isochorismate synthase entC [Escherichia coli KTE119]
 gb|ELF26751.1| isochorismate synthase entC [Escherichia coli KTE161]
 gb|ELF41046.1| isochorismate synthase entC [Escherichia coli KTE171]
 gb|ELF77525.1| isochorismate synthase entC [Escherichia coli KTE42]
 gb|ELG84994.1| isochorismate synthase entC [Escherichia coli KTE144]
 gb|ELG88574.1| isochorismate synthase entC [Escherichia coli KTE147]
 gb|ELH42653.1| isochorismate synthase entC [Escherichia coli KTE196]
 gb|ELH50146.1| isochorismate synthase entC [Escherichia coli KTE197]
 gb|ELI33263.1| isochorismate synthase entC [Escherichia coli KTE117]
 gb|ELJ61133.1| isochorismate synthase entC [Escherichia coli KTE232]
 emb|CCP98590.1| Isochorismate synthase [Escherichia coli O10:K5(L):H4 str. ATCC 
23506]
 gb|ELV21590.1| isochorismate synthase entC [Escherichia coli 99.0814]
 gb|ELV28488.1| isochorismate synthase entC [Escherichia coli 09BKT078844]
 gb|ELV29585.1| isochorismate synthase entC [Escherichia coli 99.0815]
 gb|ELV41538.1| isochorismate synthase entC [Escherichia coli 99.0839]
 gb|ELV43569.1| isochorismate synthase entC [Escherichia coli 99.0816]
 gb|ELV47500.1| isochorismate synthase entC [Escherichia coli 99.0848]
 gb|ELV57802.1| isochorismate synthase entC [Escherichia coli 99.1753]
 gb|ELV60463.1| isochorismate synthase entC [Escherichia coli 99.1775]
 gb|ELV61333.1| isochorismate synthase entC [Escherichia coli 99.1793]
 gb|ELV74240.1| isochorismate synthase entC [Escherichia coli ATCC 700728]
 gb|ELV74587.1| isochorismate synthase entC [Escherichia coli PA11]
 gb|ELV82607.1| isochorismate synthase entC [Escherichia coli 99.1805]
 gb|ELV88373.1| isochorismate synthase entC [Escherichia coli PA13]
 gb|ELV88570.1| isochorismate synthase entC [Escherichia coli PA19]
 gb|ELV96872.1| isochorismate synthase entC [Escherichia coli PA2]
 gb|ELW05632.1| isochorismate synthase entC [Escherichia coli PA48]
 gb|ELW05928.1| isochorismate synthase entC [Escherichia coli PA47]
 gb|ELW10215.1| isochorismate synthase entC [Escherichia coli PA8]
 gb|ELW20175.1| isochorismate synthase entC [Escherichia coli 7.1982]
 gb|ELW22578.1| isochorismate synthase entC [Escherichia coli 99.1781]
 gb|ELW26002.1| isochorismate synthase entC [Escherichia coli 99.1762]
 gb|ELW34543.1| isochorismate synthase entC [Escherichia coli PA35]
 gb|ELW38802.1| isochorismate synthase entC [Escherichia coli 3.4880]
 gb|ELW45805.1| isochorismate synthase entC [Escherichia coli 99.0670]
 gb|EMD14618.1| isochorismate synthase EntC [Escherichia coli S17]
 gb|EMR97891.1| isochorismate synthase 1 [Escherichia coli ONT:H33 str. C48/93]
 gb|EMS10053.1| isochorismate synthase 1 [Escherichia coli O127:H27 str. C43/90]
 gb|EMV47418.1| isochorismate synthase entC [Escherichia coli BCE019_MS-13]
 gb|EMV64818.1| isochorismate synthase entC [Escherichia coli 2871950]
 gb|EMW37326.1| isochorismate synthase entC [Escherichia coli 2785200]
 gb|EMW63588.1| isochorismate synthase entC [Escherichia coli 2762100]
 gb|EMW86512.1| isochorismate synthase entC [Escherichia coli 2731150]
 gb|EMW90228.1| isochorismate synthase entC [Escherichia coli 180050]
 gb|EMX26614.1| isochorismate synthase entC [Escherichia coli MP021566.1]
 gb|EMX32478.1| isochorismate synthase entC [Escherichia coli MP021561.2]
 gb|EMZ88116.1| isochorismate synthase entC [Escherichia coli 2722950]
 gb|EMZ95518.1| isochorismate synthase entC [Escherichia coli P0305260.1]
 gb|ENA07663.1| isochorismate synthase entC [Escherichia coli P0299438.2]
 gb|ENA34601.1| isochorismate synthase entC [Escherichia coli BCE007_MS-11]
 gb|ENA56665.1| isochorismate synthase entC [Escherichia coli 2726950]
 gb|ENA83588.1| isochorismate synthase entC [Escherichia coli 2730450]
 gb|ENA85356.1| isochorismate synthase entC [Escherichia coli 2741950]
 gb|ENB24853.1| isochorismate synthase entC [Escherichia coli BCE011_MS-01]
 gb|ENB30562.1| isochorismate synthase entC [Escherichia coli BCE030_MS-09]
 gb|ENB40483.1| isochorismate synthase entC [Escherichia coli BCE032_MS-12]
 gb|ENC36336.1| isochorismate synthase entC [Escherichia coli P0299438.9]
 gb|END60165.1| isochorismate synthase entC [Escherichia coli BCE006_MS-23]
 gb|ENE12415.1| isochorismate synthase entC [Escherichia coli P0305260.2]
 gb|ENF78954.1| isochorismate synthase entC [Escherichia coli P0305260.10]
 gb|ENF87366.1| isochorismate synthase entC [Escherichia coli P0305260.11]
 gb|ENF90778.1| isochorismate synthase entC [Escherichia coli P0305260.12]
 gb|ENF93778.1| isochorismate synthase entC [Escherichia coli P0305260.13]
 gb|ENG06443.1| isochorismate synthase entC [Escherichia coli P0305260.3]
 gb|ENG07985.1| isochorismate synthase entC [Escherichia coli P0305260.4]
 gb|ENG22250.1| isochorismate synthase entC [Escherichia coli P0305260.7]
 gb|ENG29257.1| isochorismate synthase entC [Escherichia coli P0305260.8]
 gb|ENG37318.1| isochorismate synthase entC [Escherichia coli P0305260.9]
 gb|EOU55188.1| isochorismate synthase entC [Escherichia coli KTE35]
 gb|EOU70227.1| isochorismate synthase entC [Escherichia coli KTE14]
 gb|EOU99564.1| isochorismate synthase entC [Escherichia coli KTE34]
 gb|EOV15313.1| isochorismate synthase entC [Escherichia coli KTE40]
 gb|EOV54957.1| isochorismate synthase entC [Escherichia coli KTE61]
 gb|EOV64936.1| isochorismate synthase entC [Escherichia coli KTE64]
 gb|EOV82330.1| isochorismate synthase entC [Escherichia coli KTE73]
 gb|EOV83305.1| isochorismate synthase entC [Escherichia coli KTE71]
 gb|EOW09998.1| isochorismate synthase entC [Escherichia coli KTE100]
 gb|EOW18041.1| isochorismate synthase entC [Escherichia coli KTE103]
 gb|EOW27026.1| isochorismate synthase entC [Escherichia coli KTE107]
 gb|EOW50181.1| isochorismate synthase entC [Escherichia coli KTE130]
 gb|EOW50655.1| isochorismate synthase entC [Escherichia coli KTE132]
 gb|EOX00548.1| isochorismate synthase entC [Escherichia coli KTE41]
 gb|EQQ29488.1| isochorismate synthase entC [Escherichia coli HVH 91 (4-4638751)]
 gb|EQS85045.1| isochorismate synthase entC [Escherichia coli HVH 164 (4-5953081)]
 gb|EQU64661.1| isochorismate synthase entC [Escherichia coli HVH 209 (4-3062651)]
 gb|EQV15364.1| isochorismate synthase entC [Escherichia coli HVH 221 (4-3136817)]
 gb|EQW91666.1| isochorismate synthase entC [Escherichia coli UMEA 3124-1]
 gb|EQW98072.1| isochorismate synthase entC [Escherichia coli UMEA 3139-1]
 gb|EQX69279.1| isochorismate synthase entC [Escherichia coli UMEA 3180-1]
 gb|EQX87676.1| isochorismate synthase entC [Escherichia coli UMEA 3199-1]
 gb|EQY32219.1| isochorismate synthase entC [Escherichia coli UMEA 3212-1]
 gb|EQY68274.1| isochorismate synthase entC [Escherichia coli UMEA 3240-1]
 gb|EQY83453.1| isochorismate synthase entC [Escherichia coli UMEA 3317-1]
 gb|EQY92561.1| isochorismate synthase entC [Escherichia coli UMEA 3314-1]
 gb|EQZ04334.1| isochorismate synthase entC [Escherichia coli UMEA 3318-1]
 gb|EQZ04784.1| isochorismate synthase entC [Escherichia coli UMEA 3329-1]
 gb|EQZ43180.1| isochorismate synthase entC [Escherichia coli UMEA 3592-1]
 gb|EQZ45967.1| isochorismate synthase entC [Escherichia coli UMEA 3609-1]
 gb|EQZ70302.1| isochorismate synthase entC [Escherichia coli UMEA 3682-1]
 gb|ERA22353.1| isochorismate synthase entC [Escherichia coli UMEA 3889-1]
 gb|ERB04929.1| isochorismate synthase entC [Escherichia coli KOEGE 3 (4a)]
 gb|ERB15634.1| isochorismate synthase entC [Escherichia coli UMEA 3150-1]
 gb|ERB23848.1| isochorismate synthase entC [Escherichia coli UMEA 3151-1]
 gb|ERB32350.1| isochorismate synthase entC [Escherichia coli UMEA 3271-1]
 gb|ERB78275.1| isochorismate synthase entC [Escherichia coli B107]
 gb|ERB83645.1| isochorismate synthase entC [Escherichia coli 09BKT076207]
 gb|ERB88059.1| isochorismate synthase entC [Escherichia coli B102]
 gb|ERB91139.1| isochorismate synthase entC [Escherichia coli B26-1]
 gb|ERB94846.1| isochorismate synthase entC [Escherichia coli B26-2]
 gb|ERC05632.1| isochorismate synthase entC [Escherichia coli B28-2]
 gb|ERC06898.1| isochorismate synthase entC [Escherichia coli B28-1]
 gb|ERC13380.1| isochorismate synthase entC [Escherichia coli B29-1]
 gb|ERC22180.1| isochorismate synthase entC [Escherichia coli B29-2]
 gb|ERC24945.1| isochorismate synthase entC [Escherichia coli B36-1]
 gb|ERC28794.1| isochorismate synthase entC [Escherichia coli B36-2]
 gb|ERC36928.1| isochorismate synthase entC [Escherichia coli B7-1]
 gb|ERC45529.1| isochorismate synthase entC [Escherichia coli B7-2]
 gb|ERC46840.1| isochorismate synthase entC [Escherichia coli B93]
 gb|ERC52299.1| isochorismate synthase entC [Escherichia coli B94]
 gb|ERC60087.1| isochorismate synthase entC [Escherichia coli B95]
 gb|ERC71021.1| isochorismate synthase entC [Escherichia coli 08BKT055439]
 gb|ERC73230.1| isochorismate synthase entC [Escherichia coli Bd5610_99]
 gb|ERC76412.1| isochorismate synthase entC [Escherichia coli T1840_97]
 gb|ERC86192.1| isochorismate synthase entC [Escherichia coli T234_00]
 gb|ERC89508.1| isochorismate synthase entC [Escherichia coli T924_01]
 gb|ERC91069.1| isochorismate synthase entC [Escherichia coli 14A]
 gb|ERD04181.1| isochorismate synthase entC [Escherichia coli B104]
 gb|ERD06037.1| isochorismate synthase entC [Escherichia coli B103]
 gb|ERD06928.1| isochorismate synthase entC [Escherichia coli 2886-75]
 gb|ERD19441.1| isochorismate synthase entC [Escherichia coli B105]
 gb|ERD21161.1| isochorismate synthase entC [Escherichia coli B106]
 gb|ERD22056.1| isochorismate synthase entC [Escherichia coli B108]
 gb|ERD33834.1| isochorismate synthase entC [Escherichia coli B109]
 gb|ERD35811.1| isochorismate synthase entC [Escherichia coli B112]
 gb|ERD43063.1| isochorismate synthase entC [Escherichia coli B113]
 gb|ERD50709.1| isochorismate synthase entC [Escherichia coli B114]
 gb|ERD52797.1| isochorismate synthase entC [Escherichia coli B15]
 gb|ERD54663.1| isochorismate synthase entC [Escherichia coli B17]
 gb|ERD67591.1| isochorismate synthase entC [Escherichia coli B40-2]
 gb|ERD71153.1| isochorismate synthase entC [Escherichia coli B49-2]
 gb|ERD71697.1| isochorismate synthase entC [Escherichia coli B40-1]
 gb|ERD81628.1| isochorismate synthase entC [Escherichia coli B5-2]
 gb|ERD84943.1| isochorismate synthase entC [Escherichia coli B83]
 gb|ERD89697.1| isochorismate synthase entC [Escherichia coli B84]
 gb|ERD96217.1| isochorismate synthase entC [Escherichia coli B86]
 gb|ERD96464.1| isochorismate synthase entC [Escherichia coli B85]
 gb|ERE10454.1| isochorismate synthase entC [Escherichia coli 08BKT77219]
 gb|ERE20562.1| isochorismate synthase entC [Escherichia coli 09BKT024447]
 gb|ERE26270.1| isochorismate synthase entC [Escherichia coli T1282_01]
 gb|ERE34867.1| isochorismate synthase entC [Escherichia coli B89]
 gb|ERE37708.1| isochorismate synthase entC [Escherichia coli B90]
 gb|ERE40887.1| isochorismate synthase entC [Escherichia coli Tx1686]
 gb|ERE44705.1| isochorismate synthase entC [Escherichia coli Tx3800]
 gb|AGX32732.1| isochorismate synthase 1 [synthetic Escherichia coli C321.deltaA]
 gb|ESL25866.1| isochorismate synthase entC [Escherichia coli BIDMC 39]
 gb|ESP49461.1| isochorismate synthase entC [Escherichia coli UMEA 3148-1]
 emb|CDJ71054.1| isochorismate synthase 1 [Escherichia coli str. K-12 substr. 
MC4100]
 gb|ESS88956.1| Isochorismate synthase [enterobactin] siderophore [Escherichia 
coli CE549]
 gb|EST60498.1| isochorismate synthase [Escherichia coli ECC-Z]
 gb|EST81657.1| isochorismate synthase [Escherichia coli ECA-727]
 gb|ETJ80845.1| isochorismate synthase EntC [Escherichia coli ATCC BAA-2192]
 emb|CDK81378.1| Isochorismate synthase of siderophore biosynthesis [Escherichia 
coli IS25]
 gb|ETS24466.1| isochorismate synthase EntC [Escherichia coli O6:H16:CFA/II str. 
B2C]
 gb|EWC57075.1| isochorismate synthase EntC [Escherichia coli EC096/10]
 gb|AHM28580.1| isochorismate synthase [Escherichia coli]
 gb|AHM35507.1| isochorismate synthase [Escherichia coli]
 gb|AHM40104.1| isochorismate synthase [Escherichia coli]
 gb|EYB45880.1| isochorismate synthase [Escherichia coli]
 gb|EYD90375.1| isochorismate synthase entC [Escherichia coli 1-176-05_S1_C1]
 gb|EYE05098.1| isochorismate synthase entC [Escherichia coli 1-110-08_S4_C3]
 gb|EYE06114.1| isochorismate synthase entC [Escherichia coli 1-110-08_S4_C2]
 gb|EYE28036.1| isochorismate synthase entC [Escherichia coli 1-110-08_S1_C3]
 gb|EYE39731.1| isochorismate synthase entC [Escherichia coli 1-110-08_S1_C1]
 gb|EYV53122.1| isochorismate synthase [Escherichia coli O157:H7 str. 2009EL2109]
 gb|EYV53233.1| isochorismate synthase [Escherichia coli O157:H7 str. 2009EL2109]
 gb|EYV66238.1| isochorismate synthase [Escherichia coli O157:H7 str. 2009EL1705]
 gb|EYV72045.1| isochorismate synthase [Escherichia coli O157:H7 str. K5806]
 gb|EYV83956.1| isochorismate synthase [Escherichia coli O157:H7 str. K5806]
 gb|EYV89867.1| isochorismate synthase [Escherichia coli O6:H16 str. 99-3165]
 gb|EYV91630.1| isochorismate synthase [Escherichia coli O157:H7 str. F7350]
 gb|EYW02670.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2312]
 gb|EYW10330.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2288]
 gb|EYW12484.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2289]
 gb|EYW19326.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2287]
 gb|EYW20331.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2114]
 gb|EYW23530.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2286]
 gb|EYW37851.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2113]
 gb|EYW39547.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2112]
 gb|EYW40938.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2111]
 gb|EYW47468.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2109]
 gb|EYW51046.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2107]
 gb|EYW52289.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2108]
 gb|EYW58138.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2106]
 gb|EYW62482.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2105]
 gb|EYW69731.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2104]
 gb|EYW74166.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2103]
 gb|EYW79874.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2101]
 gb|EYW82379.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2099]
 gb|EYW95239.1| isochorismate synthase [Escherichia coli O157:H7 str. 08-4169]
 gb|EYX12610.1| isochorismate synthase [Escherichia coli O157:H7 str. 08-3037]
 gb|EYX13462.1| isochorismate synthase [Escherichia coli O157:H7 str. 08-3527]
 gb|EYX26348.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2098]
 gb|EYX29337.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2097]
 gb|EYX32139.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2096]
 gb|EYX37579.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2093]
 gb|EYX40116.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2094]
 gb|EYX47267.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2092]
 gb|EYX51652.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2091]
 gb|EYX59649.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2090]
 gb|EYX66604.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-1107]
 gb|EYY50955.1| isochorismate synthase [Escherichia coli O157:H7 str. 2010C-4979C1]
 gb|EYZ29606.1| isochorismate synthase [Escherichia coli O157:H7 str. 07-3391]
 gb|EYZ35748.1| isochorismate synthase [Escherichia coli O157:H7 str. 07-3091]
 gb|EYZ39107.1| isochorismate synthase [Escherichia coli O157:H7 str. 06-4039]
 gb|EYZ51850.1| isochorismate synthase [Escherichia coli O157:H7 str. 06-3745]
 gb|EYZ55777.1| isochorismate synthase [Escherichia coli O55:H7 str. 06-3555]
 gb|EZA32108.1| isochorismate synthase [Escherichia coli O103:H11 str. 04-3023]
 gb|EZA70635.1| isochorismate synthase [Escherichia coli O157:H16 str. 98-3133]
 gb|EZA73593.1| isochorismate synthase [Escherichia coli O6:H16 str. F5656C1]
 gb|EZA80741.1| isochorismate synthase [Escherichia coli O25:NM str. E2539C1]
 gb|EZA86256.1| isochorismate synthase [Escherichia coli O157:H7 str. F6142]
 gb|EZB03259.1| isochorismate synthase [Escherichia coli O157:H7 str. F6749]
 gb|EZB04637.1| isochorismate synthase [Escherichia coli O157:H7 str. F6750]
 gb|EZB08581.1| isochorismate synthase [Escherichia coli O157:H7 str. F6751]
 gb|EZB14050.1| isochorismate synthase [Escherichia coli O157:H7 str. F7377]
 gb|EZB16105.1| isochorismate synthase [Escherichia coli O157:H7 str. F7384]
 gb|EZB22910.1| isochorismate synthase [Escherichia coli O157:H7 str. F7410]
 gb|EZB31551.1| isochorismate synthase [Escherichia coli O157:H7 str. G5303]
 gb|EZB35752.1| isochorismate synthase [Escherichia coli O157:H7 str. H2495]
 gb|EZB40474.1| isochorismate synthase [Escherichia coli O157:H7 str. H2498]
 gb|EZB43790.1| isochorismate synthase [Escherichia coli O157:H7 str. K1420]
 gb|EZB56882.1| isochorismate synthase [Escherichia coli O157:H7 str. K1793]
 gb|EZB60723.1| isochorismate synthase [Escherichia coli O157:H7 str. K1792]
 gb|EZB68320.1| isochorismate synthase [Escherichia coli O157:H7 str. K1845]
 gb|EZB72648.1| isochorismate synthase [Escherichia coli O157:H7 str. K1795]
 gb|EZB76227.1| isochorismate synthase [Escherichia coli O157:H7 str. K1796]
 gb|EZB78044.1| isochorismate synthase [Escherichia coli O157:H7 str. K1927]
 gb|EZB86319.1| isochorismate synthase [Escherichia coli O157:H7 str. K1927]
 gb|EZB86922.1| isochorismate synthase [Escherichia coli O157:H7 str. K1921]
 gb|EZB89321.1| isochorismate synthase [Escherichia coli O157:H7 str. K2188]
 gb|EZB91579.1| isochorismate synthase [Escherichia coli O157:H7 str. K2188]
 gb|EZC01352.1| isochorismate synthase [Escherichia coli O157:H7 str. K2191]
 gb|EZC04823.1| isochorismate synthase [Escherichia coli O157:H7 str. K2324]
 gb|EZC07826.1| isochorismate synthase [Escherichia coli O157:H7 str. K2192]
 gb|EZC15116.1| isochorismate synthase [Escherichia coli O157:H7 str. K2581]
 gb|EZC16942.1| isochorismate synthase [Escherichia coli O157:H7 str. K2622]
 gb|EZC23306.1| isochorismate synthase [Escherichia coli O157:H7 str. K2845]
 gb|EZC30496.1| isochorismate synthase [Escherichia coli O157:H7 str. K2854]
 gb|EZC35302.1| isochorismate synthase [Escherichia coli O157:H7 str. K4396]
 gb|EZC38732.1| isochorismate synthase [Escherichia coli O157:H7 str. K4405]
 gb|EZC41590.1| isochorismate synthase [Escherichia coli O157:H7 str. K4406]
 gb|EZC46066.1| isochorismate synthase [Escherichia coli O157:H7 str. K4527]
 gb|EZC57617.1| isochorismate synthase [Escherichia coli O157:H7 str. K5418]
 gb|EZC67309.1| isochorismate synthase [Escherichia coli O157:H7 str. K5448]
 gb|EZC72011.1| isochorismate synthase [Escherichia coli O157:H7 str. K5453]
 gb|EZC73165.1| isochorismate synthase [Escherichia coli O157:H7 str. K5449]
 gb|EZC80741.1| isochorismate synthase [Escherichia coli O157:H7 str. K5460]
 gb|EZC88409.1| isochorismate synthase [Escherichia coli O157:H7 str. K5467]
 gb|EZC92092.1| isochorismate synthase [Escherichia coli O157:H7 str. K5602]
 gb|EZC94371.1| isochorismate synthase [Escherichia coli O157:H7 str. K5609]
 gb|EZC95549.1| isochorismate synthase [Escherichia coli O157:H7 str. K5607]
 gb|EZD05217.1| isochorismate synthase [Escherichia coli O157:H7 str. K5852]
 gb|EZD06373.1| isochorismate synthase [Escherichia coli O157:H7 str. K6590]
 gb|EZD11601.1| isochorismate synthase [Escherichia coli O157:H7 str. K6676]
 gb|EZD18221.1| isochorismate synthase [Escherichia coli O157:H7 str. K6687]
 gb|EZD74656.1| isochorismate synthase [Escherichia coli O157:H7 str. K7140]
 gb|EZD84984.1| isochorismate synthase [Escherichia coli O157:H7 str. 08-4529]
 gb|EZD91160.1| isochorismate synthase [Escherichia coli O157:NM str. 08-4540]
 gb|EZE58775.1| isochorismate synthase [Escherichia coli O157:H7 str. 2009C-4258]
 gb|EZE73541.1| isochorismate synthase [Escherichia coli O157:H7 str. 2009EL1449]
 gb|EZE83384.1| isochorismate synthase [Escherichia coli O157:H7 str. 2009EL1913]
 gb|EZF02500.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2313]
 gb|EZF07562.1| isochorismate synthase [Escherichia coli O157:H7 str. 2011EL-2290]
 gb|EZJ29374.1| isochorismate synthase entC [Escherichia coli 1-176-05_S4_C3]
 gb|EZJ44233.1| isochorismate synthase entC [Escherichia coli 1-250-04_S4_C2]
 gb|EZJ57133.1| isochorismate synthase entC [Escherichia coli 1-250-04_S4_C1]
 gb|EZJ74186.1| isochorismate synthase entC [Escherichia coli 1-176-05_S4_C1]
 gb|EZK09883.1| isochorismate synthase entC [Escherichia coli 1-176-05_S1_C3]
 gb|EZK23835.1| isochorismate synthase entC [Escherichia coli 1-176-05_S1_C2]
 gb|EZK25344.1| isochorismate synthase entC [Escherichia coli 2-011-08_S1_C2]
 gb|EZQ38547.1| isochorismate synthase [Escherichia coli O157: str. 2010EL-2045]
 gb|EZQ54146.1| isochorismate synthase [Escherichia coli O157: str. 2010EL-2044]
 gb|KDA80992.1| isochorismate synthase entC [Escherichia coli 2-011-08_S3_C2]
 gb|KDA86111.1| isochorismate synthase entC [Escherichia coli 2-011-08_S3_C3]
 gb|KDA91334.1| isochorismate synthase entC [Escherichia coli 1-176-05_S4_C2]
 emb|CDP72447.1| Isochorismate hydroxymutase 2 [Escherichia coli]
 emb|CDP67279.1| Isochorismate hydroxymutase 2 [Escherichia coli D6-113.11]
 emb|CDP77409.1| Isochorismate hydroxymutase 2 [Escherichia coli D6-117.29]
 gb|KDT03315.1| isochorismate synthase entC [Escherichia coli 2-011-08_S3_C1]
 gb|KDT08856.1| isochorismate synthase entC [Escherichia coli 2-011-08_S4_C1]
 gb|KDT22594.1| isochorismate synthase entC [Escherichia coli 2-052-05_S3_C1]
 gb|KDT23866.1| isochorismate synthase entC [Escherichia coli 2-011-08_S4_C3]
 gb|KDT36558.1| isochorismate synthase entC [Escherichia coli 3-105-05_S3_C1]
 gb|KDT48474.1| isochorismate synthase entC [Escherichia coli 3-105-05_S3_C2]
 gb|KDT61270.1| isochorismate synthase entC [Escherichia coli 3-267-03_S3_C1]
 gb|KDT69002.1| isochorismate synthase entC [Escherichia coli 3-373-03_S3_C1]
 gb|KDT72730.1| isochorismate synthase entC [Escherichia coli 3-373-03_S3_C3]
 gb|KDT77877.1| isochorismate synthase entC [Escherichia coli 3-373-03_S1_C2]
 gb|KDT83866.1| isochorismate synthase entC [Escherichia coli 3-475-03_S4_C1]
 gb|KDT89420.1| isochorismate synthase entC [Escherichia coli 3-475-03_S1_C1]
 gb|KDU07764.1| isochorismate synthase entC [Escherichia coli 3-105-05_S3_C3]
 gb|KDU08984.1| isochorismate synthase entC [Escherichia coli 3-373-03_S3_C2]
 gb|KDU29388.1| isochorismate synthase entC [Escherichia coli 3-373-03_S4_C2]
 gb|KDU36799.1| isochorismate synthase entC [Escherichia coli 3-373-03_S1_C3]
 gb|KDU37410.1| isochorismate synthase entC [Escherichia coli 3-073-06_S4_C1]
 gb|KDU38262.1| isochorismate synthase entC [Escherichia coli 3-073-06_S4_C1]
 gb|KDU44620.1| isochorismate synthase entC [Escherichia coli 3-373-03_S1_C1]
 gb|KDU51691.1| isochorismate synthase entC [Escherichia coli 3-373-03_S4_C1]
 gb|KDU60941.1| isochorismate synthase entC [Escherichia coli 4-203-08_S1_C1]
 gb|KDU66966.1| isochorismate synthase entC [Escherichia coli 4-203-08_S4_C3]
 gb|KDV88016.1| isochorismate synthase entC [Escherichia coli 2-052-05_S3_C3]
 gb|KDV91872.1| isochorismate synthase entC [Escherichia coli 2-052-05_S4_C3]
 gb|KDW26191.1| isochorismate synthase entC [Escherichia coli 2-156-04_S4_C1]
 gb|KDW49424.1| isochorismate synthase entC [Escherichia coli 2-210-07_S1_C3]
 gb|KDW77571.1| isochorismate synthase entC [Escherichia coli 2-005-03_S4_C1]
 gb|KDW93082.1| isochorismate synthase entC [Escherichia coli 2-210-07_S1_C2]
 gb|KDX20378.1| isochorismate synthase entC [Escherichia coli 2-210-07_S3_C3]
 gb|KDX44520.1| isochorismate synthase entC [Escherichia coli 2-156-04_S4_C3]
 gb|KDX55063.1| isochorismate synthase entC [Escherichia coli 2-210-07_S3_C1]
 gb|KDX60423.1| isochorismate synthase entC [Escherichia coli 2-210-07_S4_C2]
 gb|KDX68985.1| isochorismate synthase entC [Escherichia coli 2-210-07_S4_C3]
 gb|KDX86172.1| isochorismate synthase entC [Escherichia coli 2-222-05_S3_C3]
 gb|KDX93620.1| isochorismate synthase entC [Escherichia coli 2-316-03_S3_C1]
 gb|KDY14489.1| isochorismate synthase entC [Escherichia coli 2-316-03_S4_C2]
 gb|KDY38801.1| isochorismate synthase entC [Escherichia coli 2-460-02_S3_C1]
 gb|KDY50207.1| isochorismate synthase entC [Escherichia coli 2-460-02_S3_C1]
 gb|KDY57798.1| isochorismate synthase entC [Escherichia coli 2-460-02_S3_C2]
 gb|KDY58677.1| isochorismate synthase entC [Escherichia coli 2-460-02_S3_C3]
 gb|KDY68985.1| isochorismate synthase entC [Escherichia coli 2-460-02_S4_C2]
 gb|KDY72145.1| isochorismate synthase entC [Escherichia coli 2-474-04_S1_C1]
 gb|KDY74343.1| isochorismate synthase entC [Escherichia coli 2-460-02_S4_C3]
 gb|KDY74593.1| isochorismate synthase entC [Escherichia coli 2-474-04_S3_C1]
 gb|KDY79528.1| isochorismate synthase entC [Escherichia coli 2-474-04_S1_C1]
 gb|KDY89009.1| isochorismate synthase entC [Escherichia coli 2-474-04_S3_C1]
 gb|KDY97077.1| isochorismate synthase entC [Escherichia coli 2-474-04_S3_C2]
 gb|KDZ05862.1| isochorismate synthase entC [Escherichia coli 2-474-04_S4_C2]
 gb|KDZ12379.1| isochorismate synthase entC [Escherichia coli 2-474-04_S4_C3]
 gb|KDZ17325.1| isochorismate synthase entC [Escherichia coli 2-474-04_S3_C3]
 gb|KDZ21585.1| isochorismate synthase entC [Escherichia coli 3-020-07_S1_C1]
 gb|KDZ25836.1| isochorismate synthase entC [Escherichia coli 3-020-07_S1_C2]
 gb|KDZ31483.1| isochorismate synthase entC [Escherichia coli 3-020-07_S1_C3]
 gb|KDZ37310.1| isochorismate synthase entC [Escherichia coli 3-020-07_S3_C1]
 gb|KDZ61310.1| isochorismate synthase entC [Escherichia coli 3-073-06_S1_C2]
 gb|KDZ66975.1| isochorismate synthase entC [Escherichia coli 3-073-06_S3_C2]
 gb|KDZ67572.1| isochorismate synthase entC [Escherichia coli 3-073-06_S3_C1]
 gb|KDZ82786.1| isochorismate synthase entC [Escherichia coli 3-105-05_S1_C2]
 gb|KDZ84948.1| isochorismate synthase entC [Escherichia coli 3-073-06_S4_C3]
 gb|KEJ53379.1| isochorismate synthase entC [Escherichia coli 2-460-02_S4_C1]
 gb|KEJ70603.1| isochorismate synthase entC [Escherichia coli 3-020-07_S3_C2]
 gb|KEJ79959.1| isochorismate synthase entC [Escherichia coli 5-366-08_S1_C3]
 gb|KEK92494.1| isochorismate synthase entC [Escherichia coli 4-203-08_S1_C2]
 gb|KEK98041.1| isochorismate synthase entC [Escherichia coli 4-203-08_S1_C3]
 gb|KEL09690.1| isochorismate synthase entC [Escherichia coli 4-203-08_S4_C2]
 gb|KEL16872.1| isochorismate synthase entC [Escherichia coli 4-203-08_S3_C1]
 gb|KEL23291.1| isochorismate synthase entC [Escherichia coli 3-373-03_S4_C3]
 gb|KEL33847.1| isochorismate synthase entC [Escherichia coli 5-366-08_S4_C2]
 gb|KEL42680.1| isochorismate synthase entC [Escherichia coli 5-172-05_S3_C3]
 gb|KEL54254.1| isochorismate synthase entC [Escherichia coli 5-172-05_S3_C1]
 gb|KEL64502.1| isochorismate synthase entC [Escherichia coli 5-172-05_S1_C3]
 gb|KEL69264.1| isochorismate synthase entC [Escherichia coli 5-366-08_S1_C1]
 gb|KEM40076.1| isochorismate synthase entC [Escherichia coli 6-319-05_S4_C2]
 gb|KEM72252.1| isochorismate synthase entC [Escherichia coli 6-319-05_S4_C3]
 gb|KEM78052.1| isochorismate synthase entC [Escherichia coli 7-233-03_S3_C1]
 gb|KEM93802.1| isochorismate synthase entC [Escherichia coli 2-222-05_S4_C1]
 gb|KEN06750.1| isochorismate synthase entC [Escherichia coli 7-233-03_S1_C3]
 gb|KEN29517.1| isochorismate synthase entC [Escherichia coli 7-233-03_S3_C2]
 gb|KEN47383.1| isochorismate synthase entC [Escherichia coli 7-233-03_S4_C1]
 gb|KEN60127.1| isochorismate synthase entC [Escherichia coli 7-233-03_S4_C3]
 gb|KEN79648.1| isochorismate synthase entC [Escherichia coli 2-052-05_S3_C2]
 gb|KEN87521.1| isochorismate synthase entC [Escherichia coli 2-474-04_S4_C1]
 gb|KEN89630.1| isochorismate synthase entC [Escherichia coli 2-222-05_S3_C1]
 gb|KEN92151.1| isochorismate synthase entC [Escherichia coli 2-222-05_S3_C1]
 gb|KEO01238.1| isochorismate synthase entC [Escherichia coli 2-222-05_S3_C2]
 gb|KEO28053.1| isochorismate synthase entC [Escherichia coli 5-366-08_S4_C1]
 gb|KEP11545.1| isochorismate synthase [Escherichia coli]
 gb|AIF35964.1| isochorismate synthase [Escherichia coli KLY]
 emb|CDU34470.1| Isochorismate hydroxymutase 2 [Escherichia coli D6-113.11]
 emb|CDU39638.1| Isochorismate hydroxymutase 2 [Escherichia coli]
 gb|AIF92224.1| Isochorismate synthase [Escherichia coli O157:H7 str. SS17]
 gb|AIG66865.1| Isochorismate synthase of siderophore biosynthesis [Escherichia 
coli O157:H7 str. EDL933]
 gb|KFF40113.1| isochorismate synthase [Escherichia coli]
 gb|KFF52003.1| isochorismate synthase [Escherichia coli]
 gb|KFI00835.1| isochorismate synthase [Escherichia coli]
 emb|CEE06963.1| isochorismate synthase entC [Escherichia coli]
 gb|AIN31084.1| isochorismate synthase 1 [Escherichia coli BW25113]
 gb|KGA87395.1| isochorismate synthase [Escherichia coli]
 emb|CDY55922.1| isochorismate synthase 1 [Escherichia coli]
 emb|CDZ19461.1| isochorismate synthase 1 [Escherichia coli]
 gb|KGL67932.1| isochorismate synthase EntC [Escherichia coli NCTC 50110]
 gb|KGM68420.1| isochorismate synthase 1 [Escherichia coli]
 gb|KGM73074.1| isochorismate synthase 1 [Escherichia coli]
 gb|KGM77966.1| Isochorismate synthase [Escherichia coli]
 gb|KGM80675.1| Ferrienterobactin-binding periplasmic protein [Escherichia coli]
 gb|KGP09422.1| isochorismate synthase [Escherichia coli]
 gb|KGP12381.1| isochorismate synthase [Escherichia coli]
 gb|KGP21224.1| isochorismate synthase [Escherichia coli]
 gb|KGP40933.1| isochorismate synthase [Escherichia coli]
 gb|KGT07334.1| isochorismate synthase [Escherichia coli]
 gb|KGT12023.1| isochorismate synthase [Escherichia coli]
 gb|KGT20698.1| isochorismate synthase [Escherichia coli]
 gb|KGT23766.1| isochorismate synthase [Escherichia coli]
 gb|KGT26954.1| isochorismate synthase [Escherichia coli]
 gb|KGT29662.1| isochorismate synthase [Escherichia coli]
 gb|KHD39881.1| isochorismate synthase [Escherichia coli]
 gb|KHD47317.1| isochorismate synthase [Escherichia coli]
 gb|KHD57225.1| isochorismate synthase [Escherichia coli]
 gb|KHD59558.1| isochorismate synthase [Escherichia coli]
 gb|KHH47091.1| isochorismate synthase [Escherichia coli]
 gb|KHH56652.1| isochorismate synthase [Escherichia coli]
 gb|KHH83963.1| isochorismate synthase [Escherichia coli]
 gb|KHH92968.1| isochorismate synthase [Escherichia coli]
 gb|KHH93985.1| isochorismate synthase [Escherichia coli]
 gb|KHI13986.1| isochorismate synthase [Escherichia coli]
 gb|KHI18825.1| isochorismate synthase [Escherichia coli]
 gb|KHI43474.1| isochorismate synthase [Escherichia coli]
 gb|KHI54522.1| isochorismate synthase [Escherichia coli]
 gb|KHI87971.1| isochorismate synthase [Escherichia coli]
 gb|AIZ31115.1| isochorismate synthase 1 [Escherichia coli ER2796]
 gb|AIZ54440.1| isochorismate synthase 1 [Escherichia coli K-12]
 gb|AIZ92262.1| isochorismate synthase [Escherichia coli str. K-12 substr. MG1655]
 gb|AJA24578.1| Isochorismate synthase [Escherichia coli O157:H7 str. SS52]
 gb|AJB50758.1| isochorismate synthase [Escherichia coli]
 gb|KIG44314.1| isochorismate synthase [Escherichia coli]
 gb|KIG57260.1| isochorismate synthase [Escherichia coli]
 gb|KIG70187.1| isochorismate synthase [Escherichia coli]
 gb|KIG74765.1| isochorismate synthase [Escherichia coli]
 gb|KIG81233.1| isochorismate synthase [Escherichia coli]
 gb|KIH01336.1| isochorismate synthase [Escherichia coli]
 gb|KIH18363.1| isochorismate synthase [Escherichia coli]
 gb|AJF55334.1| isochorismate synthase 1 [Escherichia coli 1303]
 gb|KIY29540.1| isochorismate synthase [Escherichia coli]
 gb|KIZ08287.1| isochorismate synthase [Escherichia coli]
 gb|KIZ63366.1| isochorismate synthase [Escherichia coli]
 gb|KIZ67277.1| isochorismate synthase [Escherichia coli]
 gb|KIZ79925.1| isochorismate synthase [Escherichia coli]
 gb|KIZ85828.1| isochorismate synthase [Escherichia coli]
 gb|KIZ86700.1| isochorismate synthase [Escherichia coli]
 gb|KIZ94462.1| isochorismate synthase [Escherichia coli]
 gb|KIZ99959.1| isochorismate synthase [Escherichia coli]
 gb|KJA00250.1| isochorismate synthase [Escherichia coli]
 gb|KJA05559.1| isochorismate synthase [Escherichia coli]
 gb|KJD89965.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>gb|AAA18491.1| iron chelator protein [Escherichia coli]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001337908.1| isochorismate synthase EntC [Escherichia coli]
 gb|EGB75583.1| isochorismate synthase [Escherichia coli MS 57-2]
 gb|ELF69187.1| isochorismate synthase entC [Escherichia coli KTE45]
 gb|ELF99731.1| isochorismate synthase entC [Escherichia coli KTE46]
 gb|EQW74162.1| isochorismate synthase entC [Escherichia coli UMEA 3117-1]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001535886.1| isochorismate synthase entC [Escherichia coli]
 gb|ELC92659.1| isochorismate synthase entC [Escherichia coli KTE191]
 gb|ELI15729.1| isochorismate synthase entC [Escherichia coli KTE106]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMIAR  135



>gb|KHH67516.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001694650.1| isochorismate synthase entC [Escherichia coli]
 gb|ELW44204.1| isochorismate synthase entC [Escherichia coli 95.0083]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032234407.1| isochorismate synthase [Escherichia coli]
 gb|EYD92011.1| isochorismate synthase entC [Escherichia coli 1-176-05_S3_C1]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_024238608.1| isochorismate synthase [Escherichia coli]
 gb|KIG38068.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001619219.1| isochorismate synthase entC [Escherichia coli]
 gb|ELG96451.1| isochorismate synthase entC [Escherichia coli KTE154]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001572625.1| isochorismate synthase entC [Escherichia coli]
 gb|ELF22033.1| isochorismate synthase entC [Escherichia coli KTE156]
 gb|EOW62132.1| isochorismate synthase entC [Escherichia coli KTE155]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_044694323.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_042012964.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVTR  135



>ref|WP_032208731.1| isochorismate synthase, partial [Escherichia coli]
 gb|KDY06171.1| isochorismate synthase entC, partial [Escherichia coli 2-316-03_S4_C2]
 gb|KDY11942.1| isochorismate synthase entC, partial [Escherichia coli 2-316-03_S4_C2]
Length=388

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001405574.1| isochorismate synthase EntC [Escherichia coli]
 gb|EIG49641.1| isochorismate synthase entC [Escherichia coli H730]
 gb|ELI44811.1| isochorismate synthase entC [Escherichia coli KTE120]
 gb|EOV29321.1| isochorismate synthase entC [Escherichia coli KTE198]
 gb|EQX59777.1| isochorismate synthase entC [Escherichia coli UMEA 3174-1]
Length=391

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_042108504.1| isochorismate synthase, partial [Escherichia coli]
Length=353

 Score =   263 bits (671),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_021514949.1| isochorismate synthase entC [Escherichia coli]
 gb|EQN73699.1| isochorismate synthase entC [Escherichia coli HVH 19 (4-7154984)]
Length=391

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_038817186.1| isochorismate synthase, partial [Escherichia coli]
Length=390

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/135 (96%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>gb|EGC96072.1| EntC [Escherichia fergusonii ECD227]
Length=395

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = -3

Query  426  VEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  247
            +EDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK
Sbjct  1    MEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK  60

Query  246  LAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLN  67
            L ALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQ LN
Sbjct  61   LTALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQPLN  120

Query  66   VVERQAIPEQTTLNRWCPR  10
            VVERQAIPEQ T  +   R
Sbjct  121  VVERQAIPEQATFEQMVAR  139



>ref|WP_023281825.1| isochorismate synthase entC [Escherichia coli]
 gb|ESL43079.1| isochorismate synthase entC [Escherichia coli BIDMC 37]
Length=391

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQK+AAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKIAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_005116406.1| isochorismate synthase EntC [Shigella flexneri]
 gb|EIQ26560.1| isochorismate synthase entC [Shigella flexneri K-315]
Length=391

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK QGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKVQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPRRRT  1
            QAIPEQTT  +   R  T
Sbjct  121  QAIPEQTTFEQMVARAAT  138



>ref|WP_004980869.1| MULTISPECIES: isochorismate synthase EntC [Enterobacteriaceae]
 gb|ABB65158.1| isochorismate hydroxymutase 2, enterochelin biosynthesis [Shigella 
boydii Sb227]
 gb|EFW57860.1| isochorismate synthase [Shigella flexneri CDC 796-83]
 gb|EGJ03456.1| putative isochorismate synthase [Shigella boydii 3594-74]
 gb|EIQ16188.1| isochorismate synthase entC [Shigella flexneri CCH060]
 gb|EIQ46952.1| isochorismate synthase entC [Shigella boydii 4444-74]
 gb|EJZ68163.1| ENTC isochorismate synthase 1 [Shigella flexneri 1485-80]
 gb|KIZ67982.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK QGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKVQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032359848.1| isochorismate synthase [Escherichia coli]
 gb|EZA11250.1| isochorismate synthase [Escherichia coli O28ac:NM str. 02-3404]
Length=391

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032205789.1| isochorismate synthase [Escherichia coli]
 gb|EYY57400.1| isochorismate synthase [Escherichia coli O165:H25 str. 2010C-4874]
 gb|KHJ23106.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   263 bits (672),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001529596.1| isochorismate synthase entC [Escherichia coli]
 gb|END99381.1| isochorismate synthase entC [Escherichia coli P0301904.3]
 gb|ENF99504.1| isochorismate synthase entC [Escherichia coli P0305260.15]
 gb|KEM66686.1| isochorismate synthase entC [Escherichia coli 7-233-03_S1_C2]
 gb|KEN08166.1| isochorismate synthase entC [Escherichia coli 7-233-03_S3_C3]
Length=391

 Score =   263 bits (672),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFD+PAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDDPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001522524.1| isochorismate synthase entC [Escherichia coli]
 gb|ELC42970.1| isochorismate synthase entC [Escherichia coli KTE21]
 gb|EOU72496.1| isochorismate synthase entC [Escherichia coli KTE20]
 gb|EQO01992.1| isochorismate synthase entC [Escherichia coli HVH 25 (4-5851939)]
 gb|EQP42775.1| isochorismate synthase entC [Escherichia coli HVH 65 (4-2262045)]
 gb|EQW07362.1| isochorismate synthase entC [Escherichia coli KOEGE 77 (202a)]
 gb|ETY49991.1| isochorismate synthase entC [Escherichia coli BWH 40]
 gb|KDG37107.1| isochorismate synthase entC [Escherichia coli BIDMC 77]
 gb|KFH94571.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   263 bits (672),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPDQTTFEQMVAR  135



>ref|WP_001711554.1| isochorismate synthase entC [Escherichia coli]
 gb|EMV98180.1| isochorismate synthase entC [Escherichia coli 2860050]
Length=391

 Score =   263 bits (672),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032343549.1| isochorismate synthase [Escherichia coli]
 gb|KEL53334.1| isochorismate synthase entC [Escherichia coli 6-175-07_S1_C1]
Length=391

 Score =   263 bits (672),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFD+PAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDDPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_023278239.1| isochorismate synthase entC [Escherichia coli]
 gb|ESK41339.1| isochorismate synthase entC [Escherichia coli UMEA 3323-1]
Length=391

 Score =   263 bits (672),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPDQTTFEQMVAR  135



>ref|WP_016244378.1| isochorismate synthase entC [Escherichia coli]
 gb|EOW10168.1| isochorismate synthase entC [Escherichia coli KTE102]
Length=391

 Score =   263 bits (672),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001625041.1| isochorismate synthase entC [Escherichia coli]
 gb|ENH38267.1| isochorismate synthase entC [Escherichia coli P0304816.3]
Length=391

 Score =   263 bits (672),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>ref|WP_024240944.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   263 bits (671),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFA FDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFAHFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001351525.1| isochorismate synthase EntC [Escherichia coli]
 gb|EGC10583.1| chorismate binding enzyme [Escherichia coli E1167]
 gb|EKJ61647.1| isochorismate synthase EntC [Escherichia coli 0.1288]
 gb|ELC90931.1| isochorismate synthase entC [Escherichia coli KTE193]
 gb|ELF89619.1| isochorismate synthase entC [Escherichia coli KTE29]
 gb|ELG43818.1| isochorismate synthase entC [Escherichia coli KTE91]
 gb|ELH37314.1| isochorismate synthase entC [Escherichia coli KTE184]
 gb|ELI32680.1| isochorismate synthase entC [Escherichia coli KTE112]
 gb|ELI83475.1| isochorismate synthase entC [Escherichia coli KTE138]
 gb|ELJ84823.1| isochorismate synthase entC [Escherichia coli KTE90]
 gb|EMX10264.1| isochorismate synthase entC [Escherichia coli P0302308.1]
 gb|EMX60002.1| isochorismate synthase entC [Escherichia coli MP020940.1]
 gb|EMZ69039.1| isochorismate synthase entC [Escherichia coli 174900]
 gb|EMZ99614.1| isochorismate synthase entC [Escherichia coli P0304816.1]
 gb|ENA07871.1| isochorismate synthase entC [Escherichia coli P0299917.1]
 gb|END02437.1| isochorismate synthase entC [Escherichia coli P0302308.10]
 gb|END05495.1| isochorismate synthase entC [Escherichia coli P0302308.11]
 gb|END14673.1| isochorismate synthase entC [Escherichia coli P0302308.3]
 gb|END17265.1| isochorismate synthase entC [Escherichia coli P0302308.2]
 gb|END24489.1| isochorismate synthase entC [Escherichia coli P0302308.5]
 gb|END28401.1| isochorismate synthase entC [Escherichia coli P0302308.4]
 gb|ENF22742.1| isochorismate synthase entC [Escherichia coli P0304816.11]
 gb|ENF26392.1| isochorismate synthase entC [Escherichia coli P0304816.10]
 gb|ENF34609.1| isochorismate synthase entC [Escherichia coli P0304816.12]
 gb|ENF38169.1| isochorismate synthase entC [Escherichia coli P0304816.14]
 gb|ENF56223.1| isochorismate synthase entC [Escherichia coli P0304816.6]
 gb|ENF56379.1| isochorismate synthase entC [Escherichia coli P0304816.2]
 gb|ENF64060.1| isochorismate synthase entC [Escherichia coli P0304816.7]
 gb|ENF76220.1| isochorismate synthase entC [Escherichia coli P0304816.9]
 gb|ENH23946.1| isochorismate synthase entC [Escherichia coli P0302308.14]
 gb|ENH24314.1| isochorismate synthase entC [Escherichia coli P0302308.12]
 gb|ENH26089.1| isochorismate synthase entC [Escherichia coli P0302308.13]
 gb|ENH42740.1| isochorismate synthase entC [Escherichia coli P0304816.5]
 gb|EQS01347.1| isochorismate synthase entC [Escherichia coli HVH 139 (4-3192644)]
 gb|EQZ69740.1| isochorismate synthase entC [Escherichia coli UMEA 3671-1]
 gb|ERF90570.1| isochorismate synthase EntC [Escherichia coli O104:H21 str. CFSAN002236]
 gb|ERF96956.1| isochorismate synthase EntC [Escherichia coli O104:H21 str. CFSAN002237]
 gb|ESK09723.1| isochorismate synthase entC [Escherichia coli HVH 98 (4-5799287)]
 gb|EST66169.1| isochorismate synthase EntC [Escherichia coli P4-96]
 gb|EST70774.1| isochorismate synthase EntC [Escherichia coli P4-NR]
 gb|EYZ57667.1| isochorismate synthase [Escherichia coli O79:H7 str. 06-3501]
 gb|EZA64467.1| isochorismate synthase [Escherichia coli O104:H21 str. 94-3025]
 gb|KDG67602.1| isochorismate synthase entC [Escherichia coli MGH 57]
 gb|KDT97210.1| isochorismate synthase entC [Escherichia coli 3-267-03_S3_C2]
 gb|KDV88464.1| isochorismate synthase entC [Escherichia coli 2-052-05_S4_C2]
 gb|KDX65665.1| isochorismate synthase entC [Escherichia coli 2-222-05_S1_C1]
 gb|KDX74094.1| isochorismate synthase entC [Escherichia coli 2-222-05_S1_C2]
 gb|KDX82502.1| isochorismate synthase entC [Escherichia coli 2-222-05_S1_C3]
 gb|KHG88161.1| isochorismate synthase [Escherichia coli]
 gb|KHH13742.1| isochorismate synthase [Escherichia coli]
 gb|KHH27166.1| isochorismate synthase [Escherichia coli]
 gb|KHH28533.1| isochorismate synthase [Escherichia coli]
 gb|KHH37282.1| isochorismate synthase [Escherichia coli]
 gb|KHH42183.1| isochorismate synthase [Escherichia coli]
 gb|KHI33520.1| isochorismate synthase [Escherichia coli]
 gb|KHI65582.1| isochorismate synthase [Escherichia coli]
 gb|KHI72187.1| isochorismate synthase [Escherichia coli]
 gb|KHI99878.1| isochorismate synthase [Escherichia coli]
 gb|KHJ14278.1| isochorismate synthase [Escherichia coli]
 gb|AIZ86146.1| isochorismate synthase [Escherichia coli]
 gb|KHO57613.1| isochorismate synthase [Escherichia coli]
 gb|KII10509.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   263 bits (671),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>ref|WP_005024896.1| isochorismate synthase EntC [Shigella dysenteriae]
 gb|EFW51978.1| isochorismate hydroxymutase 2, enterochelin biosynthesis [Shigella 
dysenteriae CDC 74-1112]
 gb|EIQ63971.1| isochorismate synthase entC [Shigella dysenteriae 225-75]
Length=391

 Score =   263 bits (671),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK QGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKVQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032229675.1| isochorismate synthase [Escherichia coli]
 gb|EYE14688.1| isochorismate synthase entC [Escherichia coli 1-110-08_S3_C3]
 gb|EYE17820.1| isochorismate synthase entC [Escherichia coli 1-110-08_S3_C1]
 gb|EYE28870.1| isochorismate synthase entC [Escherichia coli 1-110-08_S3_C2]
 gb|EYE29964.1| isochorismate synthase entC [Escherichia coli 1-110-08_S3_C1]
Length=391

 Score =   263 bits (671),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            Q IPEQTT  +   R
Sbjct  121  QVIPEQTTFEQMVAR  135



>ref|WP_012421470.1| MULTISPECIES: isochorismate synthase EntC [Shigella]
 ref|YP_001879260.1| isochorismate synthase, entC [Shigella boydii CDC 3083-94]
 gb|ACD08635.1| isochorismate synthase, entC [Shigella boydii CDC 3083-94]
Length=391

 Score =   263 bits (671),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK QGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKVQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_033800941.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   263 bits (671),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001297274.1| isochorismate synthase EntC [Escherichia coli]
 gb|EDV62338.1| isochorismate synthase, entC [Escherichia coli B7A]
 gb|EMW28366.1| isochorismate synthase entC [Escherichia coli 2848050]
 gb|EST01434.1| isochorismate synthase [Escherichia coli CE418]
 emb|CDK60308.1| isochorismate synthase [Escherichia coli IS9]
 gb|AIF61576.1| isochorismate synthase [Escherichia coli B7A]
 gb|KIZ76014.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   263 bits (671),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_044188617.1| isochorismate synthase [Escherichia coli]
 gb|KFD76773.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>ref|WP_041328331.1| isochorismate synthase [Escherichia coli]
 gb|KHH75009.1| isochorismate synthase [Escherichia coli]
 gb|KHH77152.1| isochorismate synthase [Escherichia coli]
 gb|KIN86604.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001571088.1| isochorismate synthase entC [Escherichia coli]
 gb|ELF21896.1| isochorismate synthase entC [Escherichia coli KTE143]
 gb|EOU74872.1| isochorismate synthase entC [Escherichia coli KTE24]
 gb|EOU95122.1| isochorismate synthase entC [Escherichia coli KTE36]
 gb|EOU97801.1| isochorismate synthase entC [Escherichia coli KTE37]
 gb|EOV13332.1| isochorismate synthase entC [Escherichia coli KTE38]
 gb|EOV67514.1| isochorismate synthase entC [Escherichia coli KTE69]
 gb|EOV80476.1| isochorismate synthase entC [Escherichia coli KTE70]
 gb|EOV97306.1| isochorismate synthase entC [Escherichia coli KTE74]
 gb|EOV97613.1| isochorismate synthase entC [Escherichia coli KTE98]
 gb|EQQ15461.1| isochorismate synthase entC [Escherichia coli HVH 87 (4-5977630)]
 gb|EQX68391.1| isochorismate synthase entC [Escherichia coli UMEA 3190-1]
 gb|EQY76141.1| isochorismate synthase entC [Escherichia coli UMEA 3304-1]
Length=391

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_001466878.1| isochorismate synthase entC [Escherichia coli]
 gb|ENC27351.1| isochorismate synthase entC [Escherichia coli P0299438.8]
 gb|ENG73393.1| isochorismate synthase entC [Escherichia coli p0305293.8]
Length=391

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001465215.1| isochorismate synthase entC [Escherichia coli]
 gb|EMV94596.1| isochorismate synthase entC [Escherichia coli 2865200]
 gb|EMW11349.1| isochorismate synthase entC [Escherichia coli 2850750]
 gb|EMZ71821.1| isochorismate synthase entC [Escherichia coli 2735000]
 gb|ENC20822.1| isochorismate synthase entC [Escherichia coli P0299438.6]
Length=391

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001381853.1| isochorismate synthase entC [Escherichia coli]
 gb|EMU65220.1| isochorismate synthase entC [Escherichia coli MP021552.7]
 gb|ENA66626.1| isochorismate synthase entC [Escherichia coli 178900]
Length=391

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001448432.1| isochorismate synthase EntC [Escherichia coli]
 gb|EJE80655.1| isochorismate synthase EntC [Escherichia coli O26:H11 str. CVM10021]
 gb|EZH03566.1| isochorismate synthase [Escherichia coli O26:H11 str. 2011C-3506]
Length=391

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001378779.1| isochorismate synthase EntC [Escherichia coli]
 gb|EGW85650.1| putative isochorismate synthase [Escherichia coli STEC_94C]
Length=391

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001295313.1| isochorismate synthase EntC [Escherichia coli]
 ref|YP_002386049.1| isochorismate synthase 1 [Escherichia coli IAI1]
 ref|YP_002401701.1| isochorismate synthase 1 [Escherichia coli 55989]
 ref|YP_006780397.1| isochorismate synthase EntC [Escherichia coli O104:H4 str. 2011C-3493]
 gb|ABV18738.1| isochorismate synthase, entC [Escherichia coli O139:H28 str. 
E24377A]
 gb|EDU63675.1| isochorismate synthase EntC [Escherichia coli 53638]
 gb|EDV83532.1| isochorismate synthase, entC [Escherichia coli E22]
 gb|EDV88096.1| isochorismate synthase, entC [Escherichia coli E110019]
 gb|EDX30237.1| isochorismate synthase, entC [Escherichia coli B171]
 emb|CAU96458.1| isochorismate synthase 1 [Escherichia coli 55989]
 emb|CAQ97447.1| isochorismate synthase 1 [Escherichia coli IAI1]
 dbj|BAI23997.1| isochorismate synthase 1 [Escherichia coli O26:H11 str. 11368]
 dbj|BAI29465.1| isochorismate synthase 1 [Escherichia coli O103:H2 str. 12009]
 dbj|BAI34595.1| isochorismate synthase 1 [Escherichia coli O111:H- str. 11128]
 gb|EFE64648.1| isochorismate synthase entC [Escherichia coli B088]
 gb|EFJ84063.1| isochorismate synthase [Escherichia coli MS 84-1]
 gb|EFK70378.1| isochorismate synthase [Escherichia coli MS 124-1]
 gb|EFK72313.1| isochorismate synthase [Escherichia coli MS 78-1]
 gb|EFN37897.1| isochorismate synthase [Escherichia coli W]
 gb|ADT74176.1| isochorismate synthase 1 [Escherichia coli W]
 gb|EFW72882.1| isochorismate synthase [Escherichia coli EC4100B]
 gb|EFZ39937.1| putative isochorismate synthase [Escherichia coli EPECa14]
 gb|EFZ44867.1| putative isochorismate synthase [Escherichia coli E128010]
 gb|EFZ56366.1| putative isochorismate synthase [Escherichia coli LT-68]
 gb|EFZ65490.1| putative isochorismate synthase [Escherichia coli OK1180]
 gb|ADX51855.1| isochorismate synthase [Escherichia coli KO11FL]
 gb|EGI38051.1| isochorismate synthase EntC (Isochorismate mutase) [Escherichia 
coli TA271]
 gb|AEE55271.1| isochorismate mutase MenF [Escherichia coli UMNK88]
 gb|EGR64887.1| isochorismate synthase EntC [Escherichia coli O104:H4 str. 01-09591]
 gb|EGR75783.1| isochorismate synthase EntC [Escherichia coli O104:H4 str. LB226692]
 gb|EGT66732.1| hypothetical protein C22711_0760 [Escherichia coli O104:H4 str. 
C227-11]
 gb|EGW75877.1| putative isochorismate synthase [Escherichia coli STEC_B2F1]
 gb|EGW77171.1| putative isochorismate synthase [Escherichia coli 2534-86]
 gb|EGW92926.1| putative isochorismate synthase [Escherichia coli 3030-1]
 gb|EGX15453.1| putative isochorismate synthase [Escherichia coli STEC_H.1.8]
 gb|EGX24953.1| putative isochorismate synthase [Escherichia coli TX1999]
 gb|EHF18848.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 04-8351]
 gb|EHF18955.1| isochorismate synthase entC [Escherichia coli O104:H4 str. C227-11]
 gb|EHF24728.1| isochorismate synthase entC [Escherichia coli O104:H4 str. C236-11]
 gb|EHF37662.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 09-7901]
 gb|EHF39438.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-4404]
 gb|EHF43829.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-3677]
 gb|EHF45792.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-4522]
 gb|EHF48442.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-4623]
 gb|EHF61793.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-4632 
C1]
 gb|EHF64573.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-4632 
C2]
 gb|EHF67204.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-4632 
C3]
 gb|EHF77910.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-4632 
C5]
 gb|EHF81843.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-4632 
C4]
 gb|EHN82597.1| isochorismate synthase entC [Escherichia coli H494]
 gb|EHV81821.1| isochorismate synthase entC [Escherichia coli DEC7A]
 gb|EHV90648.1| ENTC isochorismate synthase 1 [Escherichia coli DEC7C]
 gb|EHV95124.1| ENTC isochorismate synthase 1 [Escherichia coli DEC7D]
 gb|EHW04924.1| isochorismate synthase entC [Escherichia coli DEC7E]
 gb|EHW14643.1| isochorismate synthase entC [Escherichia coli DEC8A]
 gb|EHW18843.1| ENTC isochorismate synthase 1 [Escherichia coli DEC8B]
 gb|EHW30231.1| ENTC isochorismate synthase 1 [Escherichia coli DEC8D]
 gb|EHW34962.1| ENTC isochorismate synthase 1 [Escherichia coli DEC8E]
 gb|EHW42857.1| ENTC isochorismate synthase 1 [Escherichia coli DEC9A]
 gb|EHW44082.1| ENTC isochorismate synthase 1 [Escherichia coli DEC9B]
 gb|EHW51546.1| ENTC isochorismate synthase 1 [Escherichia coli DEC9C]
 gb|EHW56121.1| ENTC isochorismate synthase 1 [Escherichia coli DEC9D]
 gb|EHW63083.1| ENTC isochorismate synthase 1 [Escherichia coli DEC9E]
 gb|EHW68561.1| ENTC isochorismate synthase 1 [Escherichia coli DEC10A]
 gb|EHW77168.1| ENTC isochorismate synthase 1 [Escherichia coli DEC10B]
 gb|EHW79857.1| ENTC isochorismate synthase 1 [Escherichia coli DEC10C]
 gb|EHW82748.1| ENTC isochorismate synthase 1 [Escherichia coli DEC10D]
 gb|EHW94439.1| ENTC isochorismate synthase 1 [Escherichia coli DEC10E]
 gb|EHW97323.1| ENTC isochorismate synthase 1 [Escherichia coli DEC11A]
 gb|EHX00119.1| ENTC isochorismate synthase 1 [Escherichia coli DEC10F]
 gb|EHX07443.1| ENTC isochorismate synthase 1 [Escherichia coli DEC11B]
 gb|EHX13682.1| isochorismate synthase entC [Escherichia coli DEC11D]
 gb|EHX17442.1| isochorismate synthase entC [Escherichia coli DEC11C]
 gb|EHX21811.1| isochorismate synthase entC [Escherichia coli DEC11E]
 gb|EHX35013.1| ENTC isochorismate synthase 1 [Escherichia coli DEC12B]
 gb|EHX35494.1| isochorismate synthase entC [Escherichia coli DEC12A]
 gb|EHX36912.1| isochorismate synthase entC [Escherichia coli DEC12C]
 gb|EHX50375.1| ENTC isochorismate synthase 1 [Escherichia coli DEC13A]
 gb|EHX50750.1| ENTC isochorismate synthase 1 [Escherichia coli DEC12D]
 gb|EHX54094.1| ENTC isochorismate synthase 1 [Escherichia coli DEC12E]
 gb|EHX64734.1| ENTC isochorismate synthase 1 [Escherichia coli DEC13B]
 gb|EHX68851.1| ENTC isochorismate synthase 1 [Escherichia coli DEC13D]
 gb|EHX69102.1| ENTC isochorismate synthase 1 [Escherichia coli DEC13C]
 gb|EHX80128.1| ENTC isochorismate synthase 1 [Escherichia coli DEC13E]
 gb|EHX82309.1| isochorismate synthase entC [Escherichia coli DEC14A]
 gb|EHX85636.1| ENTC isochorismate synthase 1 [Escherichia coli DEC14B]
 gb|EHX93384.1| ENTC isochorismate synthase 1 [Escherichia coli DEC14C]
 gb|EHX96649.1| ENTC isochorismate synthase 1 [Escherichia coli DEC14D]
 gb|EHY04735.1| ENTC isochorismate synthase 1 [Escherichia coli DEC15A]
 gb|EHY10548.1| ENTC isochorismate synthase 1 [Escherichia coli DEC15B]
 gb|EHY11472.1| ENTC isochorismate synthase 1 [Escherichia coli DEC15C]
 gb|EHY17259.1| ENTC isochorismate synthase 1 [Escherichia coli DEC15D]
 gb|EHY20898.1| ENTC isochorismate synthase 1 [Escherichia coli DEC15E]
 gb|AFH19104.1| isochorismate synthase EntC [Escherichia coli KO11FL]
 gb|AFH10312.1| isochorismate synthase EntC [Escherichia coli W]
 gb|EIE56041.1| isochorismate synthase [Escherichia coli AI27]
 gb|EIG44893.1| isochorismate synthase entC [Escherichia coli B799]
 gb|EIG90180.1| isochorismate synthase [Escherichia coli 97.0246]
 gb|EIH03508.1| isochorismate synthase [Escherichia coli 5.0588]
 gb|EIH25918.1| isochorismate synthase [Escherichia coli 1.2264]
 gb|EIH35991.1| isochorismate synthase [Escherichia coli 96.0497]
 gb|EIH43325.1| isochorismate synthase [Escherichia coli 99.0741]
 gb|EIH56386.1| isochorismate synthase [Escherichia coli 3.2608]
 gb|EIH68943.1| isochorismate synthase [Escherichia coli 93.0624]
 gb|EIH78895.1| isochorismate synthase [Escherichia coli 4.0522]
 gb|EIH90642.1| isochorismate synthase [Escherichia coli JB1-95]
 gb|EIH98678.1| isochorismate synthase [Escherichia coli 96.154]
 gb|EII10944.1| isochorismate synthase [Escherichia coli 5.0959]
 gb|EII19839.1| isochorismate synthase [Escherichia coli 9.0111]
 gb|EII33084.1| isochorismate synthase [Escherichia coli 4.0967]
 gb|EII56650.1| isochorismate synthase [Escherichia coli 3.3884]
 gb|EIJ17660.1| isochorismate synthase [Escherichia coli 900105 (10e)]
 gb|EIL08356.1| isochorismate synthase EntC [Escherichia coli O103:H25 str. CVM9340]
 gb|EIL09837.1| isochorismate synthase EntC [Escherichia coli O103:H2 str. CVM9450]
 gb|EIL24170.1| isochorismate synthase EntC [Escherichia coli O111:H8 str. CVM9574]
 gb|EIL42239.1| isochorismate synthase [Escherichia coli O26:H11 str. CVM10026]
 gb|EIL51600.1| isochorismate synthase [Escherichia coli 541-15]
 gb|EIL80521.1| isochorismate synthase [Escherichia coli CUMT8]
 gb|EIQ66988.1| isochorismate synthase entC [Escherichia coli EPECa12]
 gb|EIQ72280.1| ENTC isochorismate synthase 1 [Escherichia coli EPEC C342-62]
 gb|EJE68770.1| isochorismate synthase EntC [Escherichia coli O111:H8 str. CVM9602]
 gb|EJE70859.1| isochorismate synthase EntC [Escherichia coli O26:H11 str. CVM10224]
 gb|EJE75617.1| isochorismate synthase EntC [Escherichia coli O111:H8 str. CVM9634]
 gb|EJF03800.1| isochorismate synthase EntC [Escherichia coli O26:H11 str. CVM10030]
 gb|EJF05636.1| isochorismate synthase EntC [Escherichia coli O26:H11 str. CVM9952]
 gb|EJK97470.1| putative isochorismate synthase [Escherichia coli STEC_O31]
 gb|AFS58387.1| isochorismate synthase EntC [Escherichia coli O104:H4 str. 2009EL-2050]
 gb|AFS75596.1| isochorismate synthase EntC [Escherichia coli O104:H4 str. 2011C-3493]
 gb|AFS85103.1| isochorismate synthase EntC [Escherichia coli O104:H4 str. 2009EL-2071]
 gb|EKI42828.1| isochorismate synthase EntC [Escherichia coli 3006]
 gb|EKJ26739.1| isochorismate synthase EntC [Escherichia coli EC1865]
 gb|EKJ81741.1| isochorismate synthase [Escherichia coli AD30]
 emb|CCK45758.1| isochorismate hydroxymutase 2 [Escherichia coli chi7122]
 emb|CCJ43058.1| isochorismate hydroxymutase 2, enterochelin biosynthesis [Escherichia 
coli]
 gb|EKT98408.1| isochorismate synthase EntC [Escherichia coli O26:H11 str. CFSAN001629]
 gb|EKU03722.1| isochorismate synthase EntC [Escherichia coli O111:H8 str. CFSAN001632]
 gb|EKY88401.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-02030]
 gb|EKY88533.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-02033-1]
 gb|EKY89851.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-02092]
 gb|EKZ03656.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-02093]
 gb|EKZ04558.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-02281]
 gb|EKZ07027.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-02318]
 gb|EKZ19312.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-02913]
 gb|EKZ21535.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-03943]
 gb|EKZ22057.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-03439]
 gb|EKZ33644.1| isochorismate synthase entC [Escherichia coli O104:H4 str. 11-04080]
 gb|EKZ34993.1| isochorismate synthase entC [Escherichia coli O104:H4 str. Ec11-9450]
 gb|EKZ35075.1| isochorismate synthase entC [Escherichia coli O104:H4 str. Ec11-9990]
 gb|EKZ45804.1| isochorismate synthase entC [Escherichia coli O104:H4 str. Ec11-4984]
 gb|EKZ47879.1| isochorismate synthase entC [Escherichia coli O104:H4 str. Ec11-4986]
 gb|EKZ54555.1| isochorismate synthase entC [Escherichia coli O104:H4 str. Ec11-4987]
 gb|EKZ64111.1| isochorismate synthase entC [Escherichia coli O104:H4 str. Ec11-5603]
 gb|EKZ65620.1| isochorismate synthase entC [Escherichia coli O104:H4 str. Ec11-4988]
 gb|EKZ71717.1| isochorismate synthase entC [Escherichia coli O104:H4 str. Ec11-5604]
 gb|EKZ75352.1| isochorismate synthase entC [Escherichia coli O104:H4 str. Ec12-0465]
 gb|EKZ80785.1| isochorismate synthase entC [Escherichia coli O104:H4 str. Ec11-6006]
 gb|EKZ86314.1| isochorismate synthase entC [Escherichia coli O104:H4 str. Ec12-0466]
 gb|EKZ92479.1| isochorismate synthase entC [Escherichia coli O104:H4 str. Ec11-9941]
 gb|ELC11682.1| isochorismate synthase entC [Escherichia coli KTE10]
 gb|ELC23069.1| isochorismate synthase entC [Escherichia coli KTE12]
 gb|ELD24438.1| isochorismate synthase entC [Escherichia coli KTE210]
 gb|ELF15387.1| isochorismate synthase entC [Escherichia coli KTE142]
 gb|ELG01018.1| isochorismate synthase entC [Escherichia coli KTE48]
 gb|ELG43711.1| isochorismate synthase entC [Escherichia coli KTE101]
 gb|ELG64718.1| isochorismate synthase entC [Escherichia coli KTE135]
 gb|ELG71862.1| isochorismate synthase entC [Escherichia coli KTE136]
 gb|ELH53722.1| isochorismate synthase entC [Escherichia coli KTE203]
 gb|ELJ18571.1| isochorismate synthase entC [Escherichia coli KTE163]
 gb|ELJ29145.1| isochorismate synthase entC [Escherichia coli KTE166]
 gb|AGC86042.1| isochorismate synthase EntC [Escherichia coli APEC O78]
 gb|EMD12357.1| isochorismate synthase EntC [Escherichia coli O08]
 gb|EMS04729.1| isochorismate synthase 1 [Escherichia coli O104:H4 str. E92/11]
 gb|EMS08211.1| isochorismate synthase 1 [Escherichia coli O104:H4 str. E112/10]
 gb|EMU66921.1| isochorismate synthase entC [Escherichia coli MP021552.11]
 gb|EMU71794.1| isochorismate synthase entC [Escherichia coli MP021552.12]
 gb|EMU85849.1| isochorismate synthase entC [Escherichia coli MP021017.6]
 gb|EMU87942.1| isochorismate synthase entC [Escherichia coli MP021017.5]
 gb|EMV00596.1| isochorismate synthase entC [Escherichia coli MP021017.3]
 gb|EMV02226.1| isochorismate synthase entC [Escherichia coli MP021017.2]
 gb|EMV09788.1| isochorismate synthase entC [Escherichia coli MP021017.10]
 gb|EMV14012.1| isochorismate synthase entC [Escherichia coli MP021017.11]
 gb|EMV24090.1| isochorismate synthase entC [Escherichia coli C-34666]
 gb|EMV26246.1| isochorismate synthase entC [Escherichia coli BCE034_MS-14]
 gb|EMV29290.1| isochorismate synthase entC [Escherichia coli MP021017.12]
 gb|EMV35725.1| isochorismate synthase entC [Escherichia coli BCE002_MS12]
 gb|EMV42403.1| isochorismate synthase entC [Escherichia coli 2875000]
 gb|EMV48788.1| isochorismate synthase entC [Escherichia coli 2872800]
 gb|EMV62753.1| isochorismate synthase entC [Escherichia coli 2867750]
 gb|EMV78559.1| isochorismate synthase entC [Escherichia coli 2866450]
 gb|EMV80339.1| isochorismate synthase entC [Escherichia coli 2866750]
 gb|EMV89934.1| isochorismate synthase entC [Escherichia coli 2861200]
 gb|EMW07983.1| isochorismate synthase entC [Escherichia coli 2853500]
 gb|EMW08179.1| isochorismate synthase entC [Escherichia coli 2851500]
 gb|EMW24086.1| isochorismate synthase entC [Escherichia coli 2850400]
 gb|EMW52583.1| isochorismate synthase entC [Escherichia coli 2780750]
 gb|EMW56566.1| isochorismate synthase entC [Escherichia coli 2770900]
 gb|EMW64250.1| isochorismate synthase entC [Escherichia coli 2756500]
 gb|EMW84165.1| isochorismate synthase entC [Escherichia coli 180600]
 gb|EMX01435.1| isochorismate synthase entC [Escherichia coli ThroopD]
 gb|EMX04251.1| isochorismate synthase entC [Escherichia coli P0304777.1]
 gb|EMX11418.1| isochorismate synthase entC [Escherichia coli 174750]
 gb|EMX21868.1| isochorismate synthase entC [Escherichia coli P0301867.1]
 gb|EMX42011.1| isochorismate synthase entC [Escherichia coli MP021017.1]
 gb|EMX43542.1| isochorismate synthase entC [Escherichia coli MP021552.8]
 gb|EMX55175.1| isochorismate synthase entC [Escherichia coli MP020980.2]
 gb|EMX56115.1| isochorismate synthase entC [Escherichia coli Jurua 20/10]
 gb|EMX65646.1| isochorismate synthase entC [Escherichia coli Jurua 18/11]
 gb|EMX72148.1| isochorismate synthase entC [Escherichia coli Envira 10/1]
 gb|EMX77701.1| isochorismate synthase entC [Escherichia coli Envira 8/11]
 gb|EMX80594.1| isochorismate synthase entC [Escherichia coli 2726800]
 gb|EMX90192.1| isochorismate synthase entC [Escherichia coli 2719100]
 gb|EMX93409.1| isochorismate synthase entC [Escherichia coli BCE001_MS16]
 gb|EMX96269.1| isochorismate synthase entC [Escherichia coli 2720900]
 gb|EMZ87855.1| isochorismate synthase entC [Escherichia coli p0305293.1]
 gb|ENA18954.1| isochorismate synthase entC [Escherichia coli BCE008_MS-13]
 gb|ENA24899.1| isochorismate synthase entC [Escherichia coli 201600.1]
 gb|ENA47308.1| isochorismate synthase entC [Escherichia coli P0301867.2]
 gb|ENA55809.1| isochorismate synthase entC [Escherichia coli 2729250]
 gb|ENA69736.1| isochorismate synthase entC [Escherichia coli 179550]
 gb|ENA71488.1| isochorismate synthase entC [Escherichia coli 180200]
 gb|ENA87266.1| isochorismate synthase entC [Escherichia coli 2730350]
 gb|ENA99491.1| isochorismate synthase entC [Escherichia coli 2864350]
 gb|ENB00319.1| isochorismate synthase entC [Escherichia coli 2860650]
 gb|ENB10471.1| isochorismate synthase entC [Escherichia coli 2866350]
 gb|ENB20931.1| isochorismate synthase entC [Escherichia coli BCE008_MS-01]
 gb|ENB42696.1| isochorismate synthase entC [Escherichia coli MP021561.3]
 gb|ENB90103.1| isochorismate synthase entC [Escherichia coli P0299438.10]
 gb|ENB98450.1| isochorismate synthase entC [Escherichia coli P0299438.11]
 gb|ENC03634.1| isochorismate synthase entC [Escherichia coli P0299438.3]
 gb|ENC07399.1| isochorismate synthase entC [Escherichia coli P0299438.4]
 gb|ENC15268.1| isochorismate synthase entC [Escherichia coli P0299438.5]
 gb|ENC22836.1| isochorismate synthase entC [Escherichia coli P0299438.7]
 gb|ENC42208.1| isochorismate synthase entC [Escherichia coli P0299917.10]
 gb|ENC48786.1| isochorismate synthase entC [Escherichia coli P0299917.2]
 gb|ENC59406.1| isochorismate synthase entC [Escherichia coli P0299917.4]
 gb|ENC64371.1| isochorismate synthase entC [Escherichia coli P0299917.3]
 gb|ENC75515.1| isochorismate synthase entC [Escherichia coli P0299917.8]
 gb|ENC75745.1| isochorismate synthase entC [Escherichia coli P0299917.6]
 gb|ENC82561.1| isochorismate synthase entC [Escherichia coli P0299917.7]
 gb|ENC86058.1| isochorismate synthase entC [Escherichia coli P0299917.9]
 gb|END09976.1| isochorismate synthase entC [Escherichia coli P0301867.8]
 gb|END35130.1| isochorismate synthase entC [Escherichia coli 179100]
 gb|END44481.1| isochorismate synthase entC [Escherichia coli 2854350]
 gb|END72162.1| isochorismate synthase entC [Escherichia coli P0299483.1]
 gb|END82675.1| isochorismate synthase entC [Escherichia coli P0299483.2]
 gb|END85580.1| isochorismate synthase entC [Escherichia coli P0299483.3]
 gb|END95546.1| isochorismate synthase entC [Escherichia coli P0301867.13]
 gb|ENE14945.1| isochorismate synthase entC [Escherichia coli p0305293.14]
 gb|ENE50105.1| isochorismate synthase entC [Escherichia coli P0304777.10]
 gb|ENE69148.1| isochorismate synthase entC [Escherichia coli P0304777.12]
 gb|ENE71186.1| isochorismate synthase entC [Escherichia coli P0304777.13]
 gb|ENE75858.1| isochorismate synthase entC [Escherichia coli P0304777.14]
 gb|ENE81056.1| isochorismate synthase entC [Escherichia coli P0304777.15]
 gb|ENE85750.1| isochorismate synthase entC [Escherichia coli P0304777.2]
 gb|ENE89011.1| isochorismate synthase entC [Escherichia coli P0304777.3]
 gb|ENE95994.1| isochorismate synthase entC [Escherichia coli P0304777.4]
 gb|ENF02837.1| isochorismate synthase entC [Escherichia coli P0304777.7]
 gb|ENF06730.1| isochorismate synthase entC [Escherichia coli P0304777.5]
 gb|ENF13943.1| isochorismate synthase entC [Escherichia coli P0304777.8]
 gb|ENF15208.1| isochorismate synthase entC [Escherichia coli P0304777.9]
 gb|ENG46548.1| isochorismate synthase entC [Escherichia coli p0305293.12]
 gb|ENG47463.1| isochorismate synthase entC [Escherichia coli p0305293.11]
 gb|ENG55247.1| isochorismate synthase entC [Escherichia coli p0305293.15]
 gb|ENG65802.1| isochorismate synthase entC [Escherichia coli p0305293.3]
 gb|ENG68957.1| isochorismate synthase entC [Escherichia coli p0305293.4]
 gb|ENG79621.1| isochorismate synthase entC [Escherichia coli p0305293.9]
 gb|ENG88586.1| isochorismate synthase entC [Escherichia coli 178200]
 gb|ENG99707.1| isochorismate synthase entC [Escherichia coli P0301867.3]
 gb|ENH04589.1| isochorismate synthase entC [Escherichia coli P0301867.5]
 gb|ENH07298.1| isochorismate synthase entC [Escherichia coli 178850]
 gb|ENH10703.1| isochorismate synthase entC [Escherichia coli P0301867.7]
 gb|ENH47593.1| isochorismate synthase entC [Escherichia coli p0305293.5]
 gb|ENH54284.1| isochorismate synthase entC [Escherichia coli p0305293.7]
 gb|ENH58340.1| isochorismate synthase entC [Escherichia coli p0305293.6]
 gb|ENO08625.1| isochorismate synthase EntC [Escherichia coli O157:H43 str. T22]
 gb|EOU36505.1| isochorismate synthase entC [Escherichia coli KTE13]
 gb|EOV38670.1| isochorismate synthase entC [Escherichia coli KTE222]
 gb|EOV44098.1| isochorismate synthase entC [Escherichia coli KTE221]
 gb|EOW22719.1| isochorismate synthase entC [Escherichia coli KTE108]
 gb|EPH47811.1| isochorismate synthase [Escherichia coli E2265]
 gb|EQN71009.1| isochorismate synthase entC [Escherichia coli HVH 18 (4-8589585)]
 gb|EQO34999.1| isochorismate synthase entC [Escherichia coli HVH 33 (4-2174936)]
 gb|EQP85469.1| isochorismate synthase entC [Escherichia coli HVH 82 (4-2209276)]
 gb|EQR04786.1| isochorismate synthase entC [Escherichia coli HVH 115 (4-4465989)]
 gb|EQR09598.1| isochorismate synthase entC [Escherichia coli HVH 115 (4-4465997)]
 gb|EQR44519.1| isochorismate synthase entC [Escherichia coli HVH 121 (4-6877826)]
 gb|EQS36859.1| isochorismate synthase entC [Escherichia coli HVH 147 (4-5893887)]
 gb|EQS58337.1| isochorismate synthase entC [Escherichia coli HVH 150 (4-3258106)]
 gb|EQU00786.1| isochorismate synthase entC [Escherichia coli HVH 195 (3-7155360)]
 gb|EQU30542.1| isochorismate synthase entC [Escherichia coli HVH 200 (4-4449924)]
 gb|EQV49570.1| isochorismate synthase entC [Escherichia coli KOEGE 33 (68a)]
 gb|EQW15129.1| isochorismate synthase entC [Escherichia coli KOEGE 131 (358a)]
 gb|EQW37872.1| isochorismate synthase entC [Escherichia coli UMEA 3052-1]
 gb|EQW48196.1| isochorismate synthase entC [Escherichia coli UMEA 3065-1]
 gb|EQX59476.1| isochorismate synthase entC [Escherichia coli UMEA 3176-1]
 gb|EQY01658.1| isochorismate synthase entC [Escherichia coli UMEA 3201-1]
 gb|EQZ20073.1| isochorismate synthase entC [Escherichia coli UMEA 3355-1]
 gb|ERA09731.1| isochorismate synthase entC [Escherichia coli UMEA 3805-1]
 gb|ERA62145.1| isochorismate synthase EntC [Escherichia coli 95NR1]
 gb|ERB39002.1| isochorismate synthase entC [Escherichia coli UMEA 3292-1]
 gb|ERC62701.1| isochorismate synthase entC [Escherichia coli TW07509]
 gb|ERE04449.1| isochorismate synthase EntC [Escherichia coli 95JB1]
 gb|ESA27397.1| isochorismate synthase [Escherichia coli SCD1]
 gb|ESA63425.1| isochorismate synthase [Escherichia coli 113303]
 gb|ESA70584.1| isochorismate synthase [Escherichia coli 907357]
 gb|ESC92420.1| isochorismate synthase [Escherichia coli 113302]
 gb|ESD17731.1| isochorismate synthase [Escherichia coli 907710]
 gb|ESK09177.1| isochorismate synthase entC [Escherichia coli UMEA 3336-1]
 gb|ESK11907.1| isochorismate synthase entC [Escherichia coli HVH 50 (4-2593475)]
 gb|ESP10357.1| isochorismate synthase entC [Escherichia coli HVH 36 (4-5675286)]
 gb|ESS96309.1| isochorismate synthase [Escherichia coli CE516]
 gb|ESV03082.1| Isochorismate synthase of siderophore biosynthesis [Escherichia 
coli E1777]
 gb|ETD46901.1| isochorismate synthase EntC [Escherichia coli ATCC BAA-2215]
 gb|ETD64641.1| isochorismate synthase EntC [Escherichia coli ATCC BAA-2209]
 gb|ETI74214.1| isochorismate synthase EntC [Escherichia coli ATCC BAA-2196]
 gb|ETI74267.1| isochorismate synthase EntC [Escherichia coli ATCC BAA-2219]
 gb|ETJ56693.1| isochorismate synthase EntC [Escherichia coli ATCC BAA-2193]
 gb|EYB46778.1| isochorismate synthase [Escherichia coli]
 gb|EYE39858.1| isochorismate synthase entC [Escherichia coli 1-110-08_S1_C2]
 gb|EYU77139.1| isochorismate synthase [Escherichia coli O121:H19 str. 2010C-4254]
 gb|EYU77412.1| isochorismate synthase [Escherichia coli O111:NM str. 2010C-4221]
 gb|EYU83893.1| isochorismate synthase [Escherichia coli O26:NM str. 2010C-4347]
 gb|EYU91211.1| isochorismate synthase [Escherichia coli O111:NM str. 2010C-4086]
 gb|EYU93727.1| isochorismate synthase [Escherichia coli O45:H2 str. 2010C-3876]
 gb|EYU99151.1| isochorismate synthase [Escherichia coli O111:NM str. 2010C-3977]
 gb|EYV00702.1| isochorismate synthase [Escherichia coli O121:H19 str. 2010C-3840]
 gb|EYV11689.1| isochorismate synthase [Escherichia coli O121:H19 str. 2010C-3609]
 gb|EYV63302.1| isochorismate synthase [Escherichia coli O103:H11 str. 2010C-3214]
 gb|EYV75895.1| isochorismate synthase [Escherichia coli O121:H19 str. 2009C-4659]
 gb|EYV77328.1| isochorismate synthase [Escherichia coli O121:H19 str. 2009EL1412]
 gb|EYW91032.1| isochorismate synthase [Escherichia coli O111:NM str. 08-4487]
 gb|EYX04654.1| isochorismate synthase [Escherichia coli O118:H16 str. 08-3651]
 gb|EYX19307.1| isochorismate synthase [Escherichia coli O69:H11 str. 07-4281]
 gb|EYX68170.1| isochorismate synthase [Escherichia coli O104:H4 str. 2011EL-1675A]
 gb|EYX76688.1| isochorismate synthase [Escherichia coli O111:NM str. 2011C-3679]
 gb|EYX78145.1| isochorismate synthase [Escherichia coli O111:NM str. 2011C-3632]
 gb|EYX84265.1| isochorismate synthase [Escherichia coli O156:H25 str. 2011C-3602]
 gb|EYX89456.1| isochorismate synthase [Escherichia coli O103:H2 str. 2011C-3750]
 gb|EYX93026.1| isochorismate synthase [Escherichia coli O111:NM str. 2011C-3573]
 gb|EYX96791.1| isochorismate synthase [Escherichia coli O121:H19 str. 2011C-3537]
 gb|EYY02070.1| isochorismate synthase [Escherichia coli O121:H19 str. 2011C-3500]
 gb|EYY07808.1| isochorismate synthase [Escherichia coli O111:NM str. 2011C-3362]
 gb|EYY11919.1| isochorismate synthase [Escherichia coli O111:NM str. 2011C-3170]
 gb|EYY14090.1| isochorismate synthase [Escherichia coli O121:H19 str. 2011C-3216]
 gb|EYY22336.1| isochorismate synthase [Escherichia coli O121:H19 str. 2011C-3108]
 gb|EYY30425.1| isochorismate synthase [Escherichia coli O121:H19 str. 2011C-3072]
 gb|EYY31236.1| isochorismate synthase [Escherichia coli O121:H19 str. 2010EL1058]
 gb|EYY36299.1| isochorismate synthase [Escherichia coli O121:H19 str. 2010C-4989]
 gb|EYY42117.1| isochorismate synthase [Escherichia coli O153:H2 str. 2010C-5034]
 gb|EYY52059.1| isochorismate synthase [Escherichia coli O121:H19 str. 2010C-4966]
 gb|EYY59651.1| isochorismate synthase [Escherichia coli O121:H19 str. 2010C-4824]
 gb|EYY64787.1| isochorismate synthase [Escherichia coli O111:NM str. 2010C-4799]
 gb|EYY67166.1| isochorismate synthase [Escherichia coli O111:NM str. 2010C-4818]
 gb|EYY74042.1| isochorismate synthase [Escherichia coli O111:NM str. 2010C-4746]
 gb|EYY76386.1| isochorismate synthase [Escherichia coli O26:NM str. 2010C-4788]
 gb|EYY86577.1| isochorismate synthase [Escherichia coli O111:NM str. 2010C-4735]
 gb|EYY87225.1| isochorismate synthase [Escherichia coli O121:H19 str. 2010C-4732]
 gb|EYY97355.1| isochorismate synthase [Escherichia coli O111:NM str. 2010C-4715]
 gb|EYY99176.1| isochorismate synthase [Escherichia coli O111:NM str. 2010C-4622]
 gb|EYZ04228.1| isochorismate synthase [Escherichia coli O111:NM str. 2010C-4592]
 gb|EYZ07050.1| isochorismate synthase [Escherichia coli O177:NM str. 2010C-4558]
 gb|EYZ18776.1| isochorismate synthase [Escherichia coli O103:H2 str. 2010C-4433]
 gb|EYZ23095.1| isochorismate synthase [Escherichia coli O103:H25 str. 2010C-4529]
 gb|EYZ46209.1| isochorismate synthase [Escherichia coli O91:H14 str. 06-3691]
 gb|EYZ50733.1| isochorismate synthase [Escherichia coli O121:H19 str. 06-3822]
 gb|EYZ67723.1| isochorismate synthase [Escherichia coli O118:H16 str. 06-3612]
 gb|EYZ75191.1| isochorismate synthase [Escherichia coli O69:H11 str. 06-3325]
 gb|EYZ87255.1| isochorismate synthase [Escherichia coli O111:NM str. 04-3211]
 gb|EYZ89077.1| isochorismate synthase [Escherichia coli O121:H19 str. 06-3003]
 gb|EYZ92244.1| isochorismate synthase [Escherichia coli O118:H16 str. 06-3256]
 gb|EYZ99714.1| isochorismate synthase [Escherichia coli O174:H21 str. 03-3269]
 gb|EZA04651.1| isochorismate synthase [Escherichia coli O111:NM str. 03-3484]
 gb|EZA09306.1| isochorismate synthase [Escherichia coli O121:H19 str. 03-3227]
 gb|EZA23572.1| isochorismate synthase [Escherichia coli O113:H21 str. 07-4224]
 gb|EZA29151.1| isochorismate synthase [Escherichia coli O45:H2 str. 01-3147]
 gb|EZA43323.1| isochorismate synthase [Escherichia coli O26:H11 str. 05-3646]
 gb|EZA81367.1| isochorismate synthase [Escherichia coli O111:H8 str. F6627]
 gb|EZA95586.1| isochorismate synthase [Escherichia coli O121:H19 str. F6714]
 gb|EZC54996.1| isochorismate synthase [Escherichia coli O121:H19 str. K5198]
 gb|EZC58262.1| isochorismate synthase [Escherichia coli O121:H19 str. K5269]
 gb|EZD20952.1| isochorismate synthase [Escherichia coli O111:NM str. K6723]
 gb|EZD23840.1| isochorismate synthase [Escherichia coli O111:NM str. K6722]
 gb|EZD29365.1| isochorismate synthase [Escherichia coli O111:NM str. K6728]
 gb|EZD43047.1| isochorismate synthase [Escherichia coli O111:NM str. K6890]
 gb|EZD47716.1| isochorismate synthase [Escherichia coli O111:NM str. K6895]
 gb|EZD54173.1| isochorismate synthase [Escherichia coli O111:NM str. K6897]
 gb|EZD55226.1| isochorismate synthase [Escherichia coli O111:NM str. K6898]
 gb|EZD61572.1| isochorismate synthase [Escherichia coli O111:NM str. K6904]
 gb|EZD68285.1| isochorismate synthase [Escherichia coli O111:NM str. K6915]
 gb|EZD68695.1| isochorismate synthase [Escherichia coli O111:NM str. K6908]
 gb|EZD81277.1| isochorismate synthase [Escherichia coli O39:NM str. F8704-2]
 gb|EZD93834.1| isochorismate synthase [Escherichia coli O91:H14 str. 2009C-3227]
 gb|EZE00555.1| isochorismate synthase [Escherichia coli O103:H2 str. 2009C-3279]
 gb|EZE05529.1| isochorismate synthase [Escherichia coli O69:H11 str. 08-4661]
 gb|EZE09543.1| isochorismate synthase [Escherichia coli O121:H7 str. 2009C-3299]
 gb|EZE21059.1| isochorismate synthase [Escherichia coli O45:H2 str. 2009C-3686]
 gb|EZE25537.1| isochorismate synthase [Escherichia coli O123:H11 str. 2009C-3307]
 gb|EZE29437.1| isochorismate synthase [Escherichia coli O91:NM str. 2009C-3745]
 gb|EZE30575.1| isochorismate synthase [Escherichia coli O69:H11 str. 2009C-3601]
 gb|EZE38495.1| isochorismate synthase [Escherichia coli O111:NM str. 2009C-4006]
 gb|EZE41020.1| isochorismate synthase [Escherichia coli O121:H19 str. 2009C-4050]
 gb|EZE48617.1| isochorismate synthase [Escherichia coli O118:H16 str. 2009C-4446]
 gb|EZE50449.1| isochorismate synthase [Escherichia coli O111:NM str. 2009C-4052]
 gb|EZE63081.1| isochorismate synthase [Escherichia coli O45:H2 str. 2009C-4780]
 gb|EZE65947.1| isochorismate synthase [Escherichia coli O91:H21 str. 2009C-4646]
 gb|EZE72497.1| isochorismate synthase [Escherichia coli O121:H19 str. 2009C-4750]
 gb|EZE82816.1| isochorismate synthase [Escherichia coli O121:H19 str. 2009EL1302]
 gb|EZE96119.1| isochorismate synthase [Escherichia coli O121:H19 str. 2010C-3794]
 gb|EZG31233.1| isochorismate synthase [Escherichia coli E1728]
 gb|EZG50766.1| isochorismate synthase [Escherichia coli O26:H11 str. 03-3500]
 gb|EZG52223.1| isochorismate synthase [Escherichia coli O26:H11 str. 06-3464]
 gb|EZG58236.1| isochorismate synthase [Escherichia coli O26:H11 str. 2010C-4819]
 gb|EZG60737.1| isochorismate synthase [Escherichia coli O26:H11 str. 2010C-4430]
 gb|EZG74098.1| isochorismate synthase [Escherichia coli O26:H11 str. 2010C-4834]
 gb|EZG74218.1| isochorismate synthase [Escherichia coli O26:H11 str. 2010C-5028]
 gb|EZG84295.1| isochorismate synthase [Escherichia coli O26:H11 str. 2011C-3270]
 gb|EZG84349.1| isochorismate synthase [Escherichia coli O26:H11 str. 2010EL-1699]
 gb|EZG96796.1| isochorismate synthase [Escherichia coli O26:H11 str. 2011C-3387]
 gb|EZH04304.1| isochorismate synthase [Escherichia coli O26:H11 str. 2011C-3282]
 gb|EZH08747.1| isochorismate synthase [Escherichia coli O26:H11 str. 2009C-3689]
 gb|EZH10237.1| isochorismate synthase [Escherichia coli O26:H11 str. 2009C-3612]
 gb|EZH15710.1| isochorismate synthase [Escherichia coli O26:H11 str. 2011C-3655]
 gb|EZH24465.1| isochorismate synthase [Escherichia coli O26:H11 str. 2009C-4826]
 gb|EZH24905.1| isochorismate synthase [Escherichia coli O26:H11 str. 2009C-3996]
 gb|EZH27684.1| isochorismate synthase [Escherichia coli O26:H11 str. 2009C-4760]
 gb|EZH38291.1| isochorismate synthase [Escherichia coli O26:H11 str. 2010C-3051]
 gb|EZH43033.1| isochorismate synthase [Escherichia coli O26:H11 str. 2010C-3472]
 gb|EZH43160.1| isochorismate synthase [Escherichia coli O26:H11 str. 2010C-3871]
 gb|EZH55342.1| isochorismate synthase [Escherichia coli O26:H11 str. 2010C-3902]
 gb|EZH55915.1| isochorismate synthase [Escherichia coli O26:H11 str. 2010C-4244]
 gb|EZJ24491.1| isochorismate synthase entC [Escherichia coli 1-182-04_S4_C3]
 gb|EZJ31270.1| isochorismate synthase entC [Escherichia coli 1-392-07_S4_C2]
 gb|EZJ46525.1| isochorismate synthase entC [Escherichia coli 1-182-04_S4_C2]
 gb|EZJ63136.1| isochorismate synthase entC [Escherichia coli 1-182-04_S4_C1]
 gb|EZK18374.1| isochorismate synthase entC [Escherichia coli 2-005-03_S1_C3]
 gb|EZK32940.1| isochorismate synthase entC [Escherichia coli 1-182-04_S1_C1]
 gb|EZK52851.1| isochorismate synthase entC [Escherichia coli 2-005-03_S1_C1]
 gb|EZQ28790.1| isochorismate synthase [Escherichia coli O111:NM str. 2010C-3053]
 gb|EZQ29733.1| isochorismate synthase [Escherichia coli O111:H8 str. 2009EL-2169]
 gb|EZQ35223.1| isochorismate synthase [Escherichia coli O26:H1 str. 2009C-4747]
 gb|EZQ37788.1| isochorismate synthase [Escherichia coli O111:H8 str. 2009C-4126]
 gb|EZQ43054.1| isochorismate synthase [Escherichia coli O111:H8 str. 2011C-3453]
 gb|KDA65434.1| isochorismate synthase entC [Escherichia coli 2-052-05_S1_C1]
 gb|KDA70099.1| isochorismate synthase entC [Escherichia coli 1-182-04_S1_C2]
 gb|KDF71047.1| isochorismate synthase entC [Escherichia coli BIDMC 59]
 gb|KDG15471.1| isochorismate synthase entC [Escherichia coli BIDMC 74]
 gb|KDG60079.1| isochorismate synthase entC [Escherichia coli CHS 77]
 gb|KDG81205.1| isochorismate synthase entC [Escherichia coli UCI 53]
 gb|KDH01799.1| isochorismate synthase entC [Escherichia coli UCI 66]
 gb|KDM71200.1| isochorismate synthase [Escherichia coli]
 gb|KDM86839.1| isochorismate synthase [Escherichia coli]
 gb|KDP17256.1| isochorismate synthase [Escherichia coli]
 gb|KDT05618.1| isochorismate synthase entC [Escherichia coli 2-011-08_S1_C3]
 gb|KDT16702.1| isochorismate synthase entC [Escherichia coli 2-052-05_S1_C3]
 gb|KDV13998.1| isochorismate synthase [Escherichia coli O111:NM str. 01-3076]
 gb|KDV16598.1| isochorismate synthase [Escherichia coli O78:H12 str. 00-3279]
 gb|KDV35195.1| isochorismate synthase [Escherichia coli O69:H11 str. 07-3763]
 gb|KDV39100.1| isochorismate synthase [Escherichia coli O146:H21 str. 2010C-3325]
 gb|KDV46853.1| isochorismate synthase [Escherichia coli O91:H21 str. 2009C-3740]
 gb|KDV55297.1| isochorismate synthase [Escherichia coli O45:H2 str. 2010C-4211]
 gb|KDV56478.1| isochorismate synthase [Escherichia coli O121:H19 str. 2011C-3609]
 gb|KDV61346.1| isochorismate synthase [Escherichia coli O128:H2 str. 2011C-3317]
 gb|KDV72428.1| isochorismate synthase [Escherichia coli O118:H16 str. 07-4255]
 gb|KDV75761.1| isochorismate synthase [Escherichia coli O26:H11 str. 2011C-3274]
 gb|KDW09787.1| isochorismate synthase entC [Escherichia coli 2-156-04_S1_C3]
 gb|KDW11420.1| isochorismate synthase entC [Escherichia coli 2-156-04_S3_C3]
 gb|KDW21628.1| isochorismate synthase entC [Escherichia coli 2-177-06_S3_C1]
 gb|KDW24960.1| isochorismate synthase entC [Escherichia coli 2-177-06_S1_C1]
 gb|KDW36890.1| isochorismate synthase entC [Escherichia coli 2-177-06_S1_C2]
 gb|KDW44292.1| isochorismate synthase entC [Escherichia coli 2-177-06_S1_C3]
 gb|KDW65490.1| isochorismate synthase entC [Escherichia coli 2-005-03_S3_C3]
 gb|KDW97898.1| isochorismate synthase entC [Escherichia coli 2-210-07_S3_C2]
 gb|KDX36753.1| isochorismate synthase entC [Escherichia coli 2-156-04_S4_C2]
 gb|KDX44690.1| isochorismate synthase entC [Escherichia coli 2-177-06_S3_C2]
 gb|KDX93146.1| isochorismate synthase entC [Escherichia coli 2-316-03_S3_C2]
 gb|KDY00050.1| isochorismate synthase entC [Escherichia coli 2-316-03_S3_C2]
 gb|KDY04869.1| isochorismate synthase entC [Escherichia coli 2-316-03_S3_C3]
 gb|KDY25450.1| isochorismate synthase entC [Escherichia coli 2-427-07_S1_C2]
 gb|KDY31445.1| isochorismate synthase entC [Escherichia coli 2-427-07_S3_C1]
 gb|KDY32217.1| isochorismate synthase entC [Escherichia coli 2-427-07_S3_C3]
 gb|KDY84965.1| isochorismate synthase entC [Escherichia coli 2-427-07_S1_C3]
 gb|KDZ01138.1| isochorismate synthase entC [Escherichia coli 2-474-04_S1_C2]
 gb|KDZ94059.1| isochorismate synthase entC [Escherichia coli 2-427-07_S1_C1]
 gb|KEJ51450.1| isochorismate synthase entC [Escherichia coli 2-427-07_S4_C3]
 gb|KEJ65107.1| isochorismate synthase entC [Escherichia coli 3-267-03_S4_C1]
 gb|KEK87240.1| isochorismate synthase entC [Escherichia coli 3-475-03_S3_C2]
 gb|KEK99557.1| isochorismate synthase entC [Escherichia coli 4-203-08_S3_C3]
 gb|KEL12897.1| isochorismate synthase entC [Escherichia coli 4-203-08_S3_C2]
 gb|KEM43458.1| isochorismate synthase entC [Escherichia coli 6-537-08_S1_C1]
 gb|KEM79974.1| isochorismate synthase entC [Escherichia coli 6-537-08_S3_C1]
 gb|KEM85380.1| isochorismate synthase entC [Escherichia coli 6-537-08_S3_C3]
 gb|KEN21120.1| isochorismate synthase entC [Escherichia coli 6-537-08_S3_C2]
 gb|KEN28175.1| isochorismate synthase entC [Escherichia coli 8-415-05_S1_C1]
 gb|KEN52138.1| isochorismate synthase entC [Escherichia coli 6-537-08_S1_C2]
 gb|KEO15605.1| isochorismate synthase entC [Escherichia coli 2-177-06_S3_C3]
 gb|KEO34028.1| isochorismate synthase entC [Escherichia coli 2-460-02_S1_C1]
 gb|KEO94603.1| isochorismate synthase [Escherichia coli]
 gb|KEP83772.1| isochorismate synthase [Escherichia coli E1140]
 gb|KFH74825.1| isochorismate synthase [Escherichia coli]
 gb|KFV22604.1| isochorismate synthase [Escherichia coli]
 gb|KFV27346.1| isochorismate synthase [Escherichia coli]
 gb|KFV31907.1| isochorismate synthase [Escherichia coli]
 gb|KFV37834.1| isochorismate synthase [Escherichia coli]
 gb|KGI51194.1| Isochorismate synthase [Escherichia coli]
 gb|AIT33791.1| isochorismate synthase [Escherichia coli FAP1]
 gb|KGM59892.1| Isochorismate synthase [Escherichia coli G3/10]
 gb|KHG77323.1| isochorismate synthase [Escherichia coli]
 gb|KHG81267.1| isochorismate synthase [Escherichia coli]
 gb|KHG83188.1| isochorismate synthase [Escherichia coli]
 gb|KHG93477.1| isochorismate synthase [Escherichia coli]
 gb|KHH07846.1| isochorismate synthase [Escherichia coli]
 gb|KHH16120.1| isochorismate synthase [Escherichia coli]
 gb|KHH16726.1| isochorismate synthase [Escherichia coli]
 gb|KHH51522.1| isochorismate synthase [Escherichia coli]
 gb|KHH58891.1| isochorismate synthase [Escherichia coli]
 gb|KHH97099.1| isochorismate synthase [Escherichia coli]
 gb|KHI00255.1| isochorismate synthase [Escherichia coli]
 gb|KHI36065.1| isochorismate synthase [Escherichia coli]
 gb|KHI50296.1| isochorismate synthase [Escherichia coli]
 gb|KHI54375.1| isochorismate synthase [Escherichia coli]
 gb|KHI60491.1| isochorismate synthase [Escherichia coli]
 gb|KHI77870.1| isochorismate synthase [Escherichia coli]
 gb|KHI82223.1| isochorismate synthase [Escherichia coli]
 gb|KHI85427.1| isochorismate synthase [Escherichia coli]
 gb|KHI96490.1| isochorismate synthase [Escherichia coli]
 gb|KHJ07765.1| isochorismate synthase [Escherichia coli]
 gb|KHJ16887.1| isochorismate synthase [Escherichia coli]
 gb|KHJ28845.1| isochorismate synthase [Escherichia coli]
 gb|AIZ81627.1| isochorismate synthase [Escherichia coli]
 emb|CEK03646.1| isochorismate synthase 1 [Escherichia coli O26:H11]
 emb|CCQ27493.2| isochorismate synthase 1 [Escherichia coli]
 gb|KIG28240.1| isochorismate synthase [Escherichia coli C691-71 (14b)]
 gb|KIG29321.1| isochorismate synthase [Escherichia coli]
 gb|KIG43514.1| isochorismate synthase [Escherichia coli]
 gb|KIG63180.1| isochorismate synthase [Escherichia coli]
 gb|KIG65066.1| isochorismate synthase [Escherichia coli]
 gb|KIG90607.1| isochorismate synthase [Escherichia coli]
 gb|KIG92328.1| isochorismate synthase [Escherichia coli]
 gb|KIH06850.1| isochorismate synthase [Escherichia coli]
 gb|KIH07987.1| isochorismate synthase [Escherichia coli]
 gb|KIH14263.1| isochorismate synthase [Escherichia coli]
 gb|KIH24964.1| isochorismate synthase [Escherichia coli]
 gb|KIH25337.1| isochorismate synthase [Escherichia coli]
 gb|KIH32763.1| isochorismate synthase [Escherichia coli]
 gb|KIH34486.1| isochorismate synthase [Escherichia coli]
 gb|AJE54916.1| isochorismate synthase [Escherichia coli]
 gb|AJG07621.1| isochorismate synthase 1 [Escherichia coli ECC-1470]
 gb|KIO41785.1| isochorismate synthase [Escherichia coli O139:H28 str. E24377A]
 gb|KIO87362.1| isochorismate synthase [Escherichia coli 97.0264]
 gb|KIQ39285.1| isochorismate synthase [Escherichia coli]
 gb|KIQ44455.1| isochorismate synthase [Escherichia coli]
 gb|KJD61293.1| isochorismate synthase [Escherichia coli]
 gb|KJD66451.1| isochorismate synthase [Escherichia coli]
 gb|KJD73102.1| isochorismate synthase [Escherichia coli]
 gb|KJD74589.1| isochorismate synthase [Escherichia coli]
 gb|KJD82001.1| isochorismate synthase [Escherichia coli]
 gb|KJD88277.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_024247750.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_012602222.1| isochorismate synthase EntC [Escherichia coli]
 ref|YP_002406596.1| isochorismate synthase 1 [Escherichia coli IAI39]
 emb|CAR16707.1| isochorismate synthase 1 [Escherichia coli IAI39]
 gb|AEQ11432.1| isochorismate synthase 1 [Escherichia coli O7:K1 str. CE10]
 gb|EQO97665.1| isochorismate synthase entC [Escherichia coli HVH 53 (4-0631051)]
 gb|EQT56490.1| isochorismate synthase entC [Escherichia coli HVH 187 (4-4471660)]
 gb|ERA28509.1| isochorismate synthase entC [Escherichia coli UMEA 3899-1]
 gb|ERO95430.1| isochorismate synthase entC [Escherichia coli BIDMC 19C]
 gb|ETE13199.1| isochorismate synthase EntC [Escherichia coli LAU-EC8]
 gb|ETE39549.1| isochorismate synthase EntC [Escherichia coli LAU-EC9]
 emb|CDK54485.1| isochorismate synthase [Escherichia coli IS5]
 gb|ETX74706.1| isochorismate synthase entC [Escherichia coli BIDMC 43b]
 gb|ETX83851.1| isochorismate synthase entC [Escherichia coli BIDMC 43a]
 gb|ETY01254.1| isochorismate synthase entC [Escherichia coli BIDMC 19B]
 gb|ETY04420.1| isochorismate synthase entC [Escherichia coli BIDMC 19A]
 gb|ETY10597.1| isochorismate synthase entC [Escherichia coli BIDMC 17B]
 gb|ETY14586.1| isochorismate synthase entC [Escherichia coli BIDMC 17A]
 gb|ETY22420.1| isochorismate synthase entC [Escherichia coli BIDMC 15]
 gb|ETY27697.1| isochorismate synthase entC [Escherichia coli BIDMC 9]
 gb|ETY34298.1| isochorismate synthase entC [Escherichia coli BIDMC 3]
 gb|ETY40432.1| isochorismate synthase entC [Escherichia coli BIDMC 2B]
 gb|ETY63478.1| isochorismate synthase entC [Escherichia coli BIDMC 6]
 gb|EZQ67754.1| isochorismate synthase entC [Escherichia coli BIDMC 82]
 gb|KDG08788.1| isochorismate synthase entC [Escherichia coli BIDMC 71]
 gb|AIX62351.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_001444946.1| isochorismate synthase EntC [Escherichia coli]
 gb|EIL41024.1| isochorismate synthase EntC [Escherichia coli O26:H11 str. CVM9942]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001591663.1| isochorismate synthase entC [Escherichia coli]
 gb|ELG37833.1| isochorismate synthase entC [Escherichia coli KTE84]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQNTFEQMVAR  135



>ref|WP_001601850.1| isochorismate synthase entC [Escherichia coli]
 gb|ELG91165.1| isochorismate synthase entC [Escherichia coli KTE146]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_044687897.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032202769.1| isochorismate synthase [Escherichia coli]
 gb|KDY39541.1| isochorismate synthase entC [Escherichia coli 2-427-07_S4_C1]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001361270.1| isochorismate synthase EntC [Escherichia coli]
 gb|EHO04591.1| isochorismate synthase entC [Escherichia coli B093]
 gb|EMZ47799.1| isochorismate synthase entC [Escherichia coli SWW33]
 gb|EQT92994.1| isochorismate synthase entC [Escherichia coli HVH 193 (4-3331423)]
 gb|EWY55225.1| isochorismate synthase [Escherichia coli MP1]
 gb|EYT11398.1| isochorismate synthase entC [Escherichia coli K02]
 gb|EYV98486.1| isochorismate synthase [Escherichia coli O86:H34 str. 99-3124]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_042099633.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>ref|WP_001721171.1| isochorismate synthase entC [Escherichia coli]
 gb|EMW43647.1| isochorismate synthase entC [Escherichia coli 2788150]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQISARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001620485.1| isochorismate synthase entC [Escherichia coli]
 gb|ENF53588.1| isochorismate synthase entC [Escherichia coli P0304816.15]
 gb|ENF73563.1| isochorismate synthase entC [Escherichia coli P0304816.8]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>ref|WP_032277975.1| isochorismate synthase [Escherichia coli]
 gb|EZJ78962.1| isochorismate synthase entC [Escherichia coli 1-182-04_S3_C3]
 gb|EZJ90204.1| isochorismate synthase entC [Escherichia coli 1-182-04_S3_C2]
 gb|EZK03613.1| isochorismate synthase entC [Escherichia coli 1-182-04_S3_C1]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_024232038.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQT   +   R
Sbjct  121  QAIPEQTMFEQMVAR  135



>ref|WP_040062414.1| isochorismate synthase [Escherichia coli]
 gb|KHH65365.1| isochorismate synthase [Escherichia coli]
 gb|KIG55569.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>ref|WP_001479118.1| isochorismate synthase entC [Escherichia coli]
 gb|ENC64011.1| isochorismate synthase entC [Escherichia coli P0299917.5]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001501799.1| isochorismate synthase entC [Escherichia coli]
 gb|EMW71218.1| isochorismate synthase entC [Escherichia coli 2749250]
 gb|EMZ82744.1| isochorismate synthase entC [Escherichia coli 199900.1]
 gb|END54529.1| isochorismate synthase entC [Escherichia coli p0305293.13]
 gb|END55934.1| isochorismate synthase entC [Escherichia coli MP020980.1]
 gb|ENE16168.1| isochorismate synthase entC [Escherichia coli P0304799.3]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_012601363.1| isochorismate synthase EntC [Escherichia coli]
 ref|YP_002396631.1| isochorismate synthase 1 [Escherichia coli ED1a]
 emb|CAR06798.1| isochorismate synthase 1 [Escherichia coli ED1a]
 gb|EOX25932.1| isochorismate synthase entC [Escherichia coli KTE186]
 gb|EZA17287.1| isochorismate synthase [Escherichia coli O81:NM str. 02-3012]
 gb|EZJ45933.1| isochorismate synthase entC [Escherichia coli 2-005-03_S4_C3]
 gb|EZJ54583.1| isochorismate synthase entC [Escherichia coli 2-005-03_S4_C2]
 gb|KDT29646.1| isochorismate synthase entC [Escherichia coli 2-052-05_S4_C1]
Length=391

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQT   +   R
Sbjct  121  QAIPEQTMFEQMVAR  135



>ref|WP_042200307.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTT GCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTLGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001382923.1| isochorismate synthase EntC [Escherichia coli]
 gb|EGX09756.1| putative isochorismate synthase [Escherichia coli STEC_MHI813]
 gb|ESM40719.1| isochorismate synthase entC [Escherichia coli BWH 32]
 gb|KHI35582.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQ LNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQLLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_014639855.1| isochorismate synthase EntC [Escherichia coli]
 emb|CBJ00129.1| isochorismate synthase [Escherichia coli ETEC H10407]
Length=391

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPD PFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDCPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_042107748.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPE WQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPEYWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001550788.1| isochorismate synthase entC [Escherichia coli]
 gb|ELD84485.1| isochorismate synthase entC [Escherichia coli KTE236]
 gb|ELD90932.1| isochorismate synthase entC [Escherichia coli KTE237]
 gb|ELE62823.1| isochorismate synthase entC [Escherichia coli KTE76]
 gb|ELG54120.1| isochorismate synthase entC [Escherichia coli KTE115]
 gb|EOV17001.1| isochorismate synthase entC [Escherichia coli KTE199]
 gb|EOW23916.1| isochorismate synthase entC [Escherichia coli KTE121]
 gb|EQO72871.1| isochorismate synthase entC [Escherichia coli HVH 41 (4-2677849)]
 gb|EQW32487.1| isochorismate synthase entC [Escherichia coli UMEA 3033-1]
 gb|EQX36843.1| isochorismate synthase entC [Escherichia coli UMEA 3163-1]
 gb|ESA30814.1| Isochorismate synthase siderophore [Escherichia coli SCD2]
 gb|ETE25458.1| isochorismate synthase EntC [Escherichia coli LAU-EC10]
 emb|CDK49474.1| Isochorismate synthase [enterobactin] siderophore [Escherichia 
coli IS1]
 gb|EYE07348.1| isochorismate synthase entC [Escherichia coli 1-110-08_S4_C1]
 gb|KDH01624.1| isochorismate synthase entC [Escherichia coli UCI 65]
 gb|KDW72308.1| isochorismate synthase entC [Escherichia coli 1-392-07_S1_C1]
 gb|KDW81700.1| isochorismate synthase entC [Escherichia coli 1-392-07_S1_C2]
 gb|KEJ18244.1| isochorismate synthase entC [Escherichia coli 6-175-07_S1_C2]
 gb|KEM54729.1| isochorismate synthase entC [Escherichia coli 6-175-07_S1_C3]
Length=391

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKA+GIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAKGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPDQTTFEQMVAR  135



>ref|WP_001366512.1| isochorismate synthase EntC [Escherichia coli]
 gb|EGP26112.1| Isochorismate synthase entC [Escherichia coli PCN033]
 gb|EIH13741.1| isochorismate synthase [Escherichia coli 97.0259]
Length=391

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKA+GIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAKGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPDQTTFEQMVAR  135



>ref|WP_001561618.1| isochorismate synthase entC [Escherichia coli]
 gb|ELE57930.1| isochorismate synthase entC [Escherichia coli KTE75]
Length=391

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FA AKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FAGAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_044381867.1| isochorismate synthase, partial [Escherichia coli]
Length=344

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAI FDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAILFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001308469.1| isochorismate synthase EntC [Escherichia coli]
 gb|EFF14380.1| conserved hypothetical protein [Escherichia coli B354]
Length=391

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFD RQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDSRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001484389.1| isochorismate synthase entC [Escherichia coli]
 gb|EMV78126.1| isochorismate synthase entC [Escherichia coli 2866550]
 gb|EMW79947.1| isochorismate synthase entC [Escherichia coli 2747800]
 gb|ENC93287.1| isochorismate synthase entC [Escherichia coli P0301867.11]
 gb|ENE58716.1| isochorismate synthase entC [Escherichia coli P0304777.11]
 gb|KDT53530.1| isochorismate synthase entC [Escherichia coli 3-105-05_S4_C3]
 gb|KDW05574.1| isochorismate synthase entC [Escherichia coli 2-156-04_S3_C1]
 gb|KDW56556.1| isochorismate synthase entC [Escherichia coli 2-005-03_S3_C1]
 gb|KDX07947.1| isochorismate synthase entC [Escherichia coli 2-177-06_S4_C3]
 gb|KEL84699.1| isochorismate synthase entC [Escherichia coli 5-366-08_S3_C2]
 gb|KEM35089.1| isochorismate synthase entC [Escherichia coli 6-319-05_S1_C3]
 gb|KEM95001.1| isochorismate synthase entC [Escherichia coli 6-537-08_S4_C1]
 gb|KEO03538.1| isochorismate synthase entC [Escherichia coli 1-392-07_S4_C1]
Length=391

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQPSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032237441.1| isochorismate synthase [Escherichia coli]
 gb|EZJ76702.1| isochorismate synthase entC [Escherichia coli 1-392-07_S3_C3]
 gb|KDT33754.1| isochorismate synthase entC [Escherichia coli 3-105-05_S1_C1]
 gb|KDU56522.1| isochorismate synthase entC [Escherichia coli 3-475-03_S4_C2]
 gb|KDW60390.1| isochorismate synthase entC [Escherichia coli 1-392-07_S3_C2]
 gb|KDX04259.1| isochorismate synthase entC [Escherichia coli 1-392-07_S3_C1]
 gb|KDZ90315.1| isochorismate synthase entC [Escherichia coli 3-105-05_S1_C3]
Length=391

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSF RQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFFRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001532401.1| isochorismate synthase entC [Escherichia coli]
 gb|EMX17514.1| isochorismate synthase entC [Escherichia coli P0302293.2]
 gb|ENE02137.1| isochorismate synthase entC [Escherichia coli P0302293.7]
 gb|ENE24813.1| isochorismate synthase entC [Escherichia coli P0302293.3]
 gb|ENE28979.1| isochorismate synthase entC [Escherichia coli P0302293.10]
 gb|ENE32191.1| isochorismate synthase entC [Escherichia coli P0302293.4]
 gb|ENE38715.1| isochorismate synthase entC [Escherichia coli P0302293.6]
Length=391

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            F+DAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FSDAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001490901.1| isochorismate synthase EntC [Escherichia coli]
 gb|EKI54894.1| isochorismate synthase EntC [Escherichia coli N1]
 gb|KHG94641.1| isochorismate synthase [Escherichia coli]
 gb|KHJ56475.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP++TT  +   R
Sbjct  121  QAIPQKTTFEQMVAR  135



>ref|WP_042096337.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKA+GIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAKGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPDQTTFEQMVAR  135



>ref|WP_001471198.1| isochorismate synthase entC [Escherichia coli]
 gb|ENC37007.1| isochorismate synthase entC [Escherichia coli P02997067.6]
 gb|ENH37189.1| isochorismate synthase entC [Escherichia coli P0304816.4]
Length=391

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFD+PAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDDPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>ref|WP_001571368.1| isochorismate synthase entC [Escherichia coli]
 gb|ENE45235.1| isochorismate synthase entC [Escherichia coli P0302293.8]
 gb|ENE54720.1| isochorismate synthase entC [Escherichia coli P0302293.9]
Length=391

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            F+DAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FSDAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001427126.1| isochorismate synthase EntC [Escherichia coli]
 gb|EHW24347.1| ENTC isochorismate synthase 1 [Escherichia coli DEC8C]
 gb|EIL06285.1| isochorismate synthase EntC [Escherichia coli O111:H11 str. CVM9534]
 gb|EIL19058.1| isochorismate synthase EntC [Escherichia coli O111:H11 str. CVM9545]
 gb|EJE81966.1| isochorismate synthase EntC [Escherichia coli O111:H11 str. CVM9553]
 gb|EJE84119.1| isochorismate synthase EntC [Escherichia coli O111:H11 str. CVM9455]
 gb|EKU00976.1| isochorismate synthase EntC [Escherichia coli O111:H11 str. CFSAN001630]
Length=391

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEP VNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPGVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001684702.1| isochorismate synthase entC [Escherichia coli]
 gb|EMU84298.1| isochorismate synthase entC [Escherichia coli MP021017.9]
 gb|KEM50602.1| isochorismate synthase entC [Escherichia coli 6-175-07_S4_C3]
Length=391

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFD+PAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDDPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001317684.1| isochorismate synthase EntC [Escherichia coli]
 gb|EGI51867.1| isochorismate synthase EntC (Isochorismate mutase) [Escherichia 
coli H299]
 gb|ELF58194.1| isochorismate synthase entC [Escherichia coli KTE9]
 gb|EMD14546.1| isochorismate synthase EntC [Escherichia coli SEPT362]
 gb|EQP78268.1| isochorismate synthase entC [Escherichia coli HVH 79 (4-2512823)]
 gb|EQT63496.1| isochorismate synthase entC [Escherichia coli HVH 188 (4-2356988)]
 gb|EQW00123.1| isochorismate synthase entC [Escherichia coli KOEGE 118 (317a)]
 gb|EYZ96421.1| isochorismate synthase [Escherichia coli O119:H4 str. 03-3458]
 gb|KDX52603.1| isochorismate synthase entC [Escherichia coli 2-177-06_S4_C1]
Length=391

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_001379582.1| isochorismate synthase EntC [Escherichia coli]
 gb|EGW96809.1| putative isochorismate synthase [Escherichia coli STEC_DG131-3]
 gb|EZA36992.1| isochorismate synthase [Escherichia coli O174:H8 str. 04-3038]
Length=391

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCF RFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFVRFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_033817361.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            F DAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FVDAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>ref|WP_001345701.1| isochorismate synthase EntC [Escherichia coli]
 gb|EFZ70286.1| putative isochorismate synthase [Escherichia coli OK1357]
Length=391

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASA RFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASAHRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>ref|WP_021564064.1| isochorismate synthase entC [Escherichia coli]
 gb|EQX90352.1| isochorismate synthase entC [Escherichia coli UMEA 3200-1]
 gb|KEL75364.1| isochorismate synthase entC [Escherichia coli 5-366-08_S3_C3]
 gb|KEL93839.1| isochorismate synthase entC [Escherichia coli 5-366-08_S3_C1]
Length=391

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_032241550.1| isochorismate synthase [Escherichia coli]
 gb|KEK81407.1| isochorismate synthase entC [Escherichia coli 3-475-03_S1_C2]
Length=391

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPA+NGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAMNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001389896.1| isochorismate synthase EntC [Escherichia coli]
 emb|CBG33456.1| isochorismate synthase [Escherichia coli 042]
 gb|EHN83901.1| isochorismate synthase entC [Escherichia coli TA124]
 gb|EIL55942.1| isochorismate synthase [Escherichia coli KD2]
 gb|ELE45261.1| isochorismate synthase entC [Escherichia coli KTE66]
 gb|ELG05898.1| isochorismate synthase entC [Escherichia coli KTE50]
 gb|ELG29146.1| isochorismate synthase entC [Escherichia coli KTE78]
 gb|ELG32187.1| isochorismate synthase entC [Escherichia coli KTE79]
 gb|ELH57951.1| isochorismate synthase entC [Escherichia coli KTE202]
 gb|ELI58888.1| isochorismate synthase entC [Escherichia coli KTE125]
 gb|EQN32793.1| isochorismate synthase entC [Escherichia coli HVH 6 (3-8296502)]
 gb|EQO62090.1| isochorismate synthase entC [Escherichia coli HVH 43 (4-2173468)]
 gb|EQO74039.1| isochorismate synthase entC [Escherichia coli HVH 44 (4-2298570)]
 gb|EQT43079.1| isochorismate synthase entC [Escherichia coli HVH 182 (4-0985554)]
 gb|ERB19516.1| isochorismate synthase entC [Escherichia coli UMEA 3144-1]
 gb|ESP21518.1| isochorismate synthase entC [Escherichia coli HVH 136 (4-5970458)]
 gb|ETJ24836.1| Isochorismate synthase entC [Escherichia coli DORA_A_5_14_21]
 gb|EZB64056.1| isochorismate synthase [Escherichia coli O15:H18 str. K1516]
 gb|EZK01552.1| isochorismate synthase entC [Escherichia coli 1-250-04_S1_C3]
 gb|KDU00352.1| isochorismate synthase entC [Escherichia coli 3-267-03_S1_C2]
 gb|KDX27658.1| isochorismate synthase entC [Escherichia coli 1-250-04_S1_C1]
 gb|KHI22909.1| isochorismate synthase [Escherichia coli]
 gb|KIE80988.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_021573741.1| isochorismate synthase entC [Escherichia coli]
 gb|EQZ53475.1| isochorismate synthase entC [Escherichia coli UMEA 3656-1]
Length=391

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARF EPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFVEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_025491956.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_044688479.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_024212089.1| isochorismate synthase [Escherichia sp. TW15838]
Length=391

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            F DAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FTDAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_002431411.1| MULTISPECIES: isochorismate synthase EntC [Escherichia]
 gb|EGC08695.1| chorismate binding enzyme [Escherichia fergusonii B253]
 gb|KDA59426.1| isochorismate synthase entC [Escherichia coli 2-011-08_S1_C1]
 gb|KDW34060.1| isochorismate synthase entC [Escherichia coli 2-156-04_S3_C2]
Length=391

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKL AL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLTAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032292717.1| isochorismate synthase [Escherichia coli]
 gb|KEN35489.1| isochorismate synthase entC [Escherichia coli 8-415-05_S3_C3]
Length=391

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFD+PAV GDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDDPAVKGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001648551.1| isochorismate synthase entC [Escherichia coli]
 gb|ENG17537.1| isochorismate synthase entC [Escherichia coli P0305260.5]
Length=391

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSP RSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPSRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_024211635.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_001512249.1| isochorismate synthase entC [Escherichia coli]
 gb|EKW97577.1| isochorismate synthase entC [Escherichia coli 99.0672]
Length=391

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIP DPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPCDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032170888.1| isochorismate synthase [Escherichia coli]
 gb|KDG88304.1| isochorismate synthase entC [Escherichia coli UCI 57]
 gb|KDG91843.1| isochorismate synthase entC [Escherichia coli UCI 58]
Length=391

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPA NGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAANGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_024226873.1| isochorismate synthase [Escherichia coli]
 gb|EZD98984.1| isochorismate synthase [Escherichia coli O145:H28 str. 2009C-3292]
 gb|KDV35833.1| isochorismate synthase [Escherichia coli O145:H25 str. 07-3858]
Length=391

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRF RSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFIRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001552555.1| isochorismate synthase entC [Escherichia coli]
 gb|ELD92871.1| isochorismate synthase entC [Escherichia coli KTE47]
 gb|EOW39035.1| isochorismate synthase entC [Escherichia coli KTE126]
Length=391

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARF EPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFVEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_044806139.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPS LYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSLLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001704865.1| isochorismate synthase entC [Escherichia coli]
 gb|EMV64204.1| isochorismate synthase entC [Escherichia coli 2872000]
Length=391

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/135 (95%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSP RSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPSRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001487018.1| isochorismate synthase entC [Escherichia coli]
 gb|ENA41404.1| isochorismate synthase entC [Escherichia coli P0301867.4]
Length=391

 Score =   260 bits (665),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAV GDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVTGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001307665.1| isochorismate synthase EntC [Escherichia coli]
 gb|EFF06922.1| isochorismate synthase [Escherichia coli B185]
 gb|EHO02329.1| isochorismate synthase entC [Escherichia coli E101]
 gb|ERA09893.1| isochorismate synthase entC [Escherichia coli UMEA 3718-1]
 gb|EZJ89443.1| isochorismate synthase entC [Escherichia coli 1-250-04_S3_C1]
 gb|KEO37884.1| isochorismate synthase entC [Escherichia coli 1-250-04_S3_C2]
Length=391

 Score =   260 bits (665),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQ LNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQLLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001446422.1| isochorismate synthase EntC [Escherichia coli]
 gb|EIL64816.1| isochorismate synthase [Escherichia coli 541-1]
 gb|KDZ43342.1| isochorismate synthase entC [Escherichia coli 3-020-07_S4_C2]
 gb|KDZ48808.1| isochorismate synthase entC [Escherichia coli 3-020-07_S4_C3]
Length=391

 Score =   260 bits (664),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSR EKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRLEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001616613.1| isochorismate synthase entC [Escherichia coli]
 gb|ENF42556.1| isochorismate synthase entC [Escherichia coli P0304816.13]
Length=391

 Score =   260 bits (664),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE QQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEGQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>ref|WP_021036428.1| isochorismate synthase EntC [Escherichia coli]
 gb|AGW08004.1| isochorismate synthase EntC [Escherichia coli LY180]
Length=391

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAI EQTT  +   R
Sbjct  121  QAISEQTTFEQMVAR  135



>ref|WP_001309338.1| MULTISPECIES: isochorismate synthase EntC [Escherichia]
 ref|YP_002411447.1| isochorismate synthase 1 [Escherichia coli UMN026]
 emb|CAR11901.1| isochorismate synthase 1 [Escherichia coli UMN026]
 gb|EFF01468.1| conserved hypothetical protein [Escherichia coli FVEC1412]
 gb|EFI20840.1| isochorismate synthase entC [Escherichia coli FVEC1302]
 gb|EFJ71320.1| isochorismate synthase [Escherichia coli MS 198-1]
 gb|EGW73325.1| putative isochorismate synthase [Escherichia coli STEC_C165-02]
 gb|EIL61749.1| isochorismate synthase [Escherichia coli 576-1]
 gb|ELC02093.1| isochorismate synthase entC [Escherichia coli KTE2]
 gb|ELC49062.1| isochorismate synthase entC [Escherichia coli KTE26]
 gb|ELC77286.1| isochorismate synthase entC [Escherichia coli KTE181]
 gb|ELD07976.1| isochorismate synthase entC [Escherichia coli KTE204]
 gb|ELD23689.1| isochorismate synthase entC [Escherichia coli KTE208]
 gb|ELD55061.1| isochorismate synthase entC [Escherichia coli KTE228]
 gb|ELD80663.1| isochorismate synthase entC [Escherichia coli KTE235]
 gb|ELE73878.1| isochorismate synthase entC [Escherichia coli KTE80]
 gb|ELE84470.1| isochorismate synthase entC [Escherichia coli KTE83]
 gb|ELF02445.1| isochorismate synthase entC [Escherichia coli KTE116]
 gb|ELG07972.1| isochorismate synthase entC [Escherichia coli KTE54]
 gb|ELH01704.1| isochorismate synthase entC [Escherichia coli KTE158]
 gb|ELH25252.1| isochorismate synthase entC [Escherichia coli KTE190]
 gb|ELI12848.1| isochorismate synthase entC [Escherichia coli KTE105]
 gb|ELI47861.1| isochorismate synthase entC [Escherichia coli KTE122]
 gb|ELI61436.1| isochorismate synthase entC [Escherichia coli KTE128]
 gb|ELJ47117.1| isochorismate synthase entC [Escherichia coli KTE177]
 gb|ELJ74052.1| isochorismate synthase entC [Escherichia coli KTE82]
 gb|EOU53130.1| isochorismate synthase entC [Escherichia coli KTE231]
 gb|EOV25678.1| isochorismate synthase entC [Escherichia coli KTE200]
 gb|EOV66530.1| isochorismate synthase entC [Escherichia coli KTE68]
 gb|EOW39982.1| isochorismate synthase entC [Escherichia coli KTE127]
 gb|EOW52953.1| isochorismate synthase entC [Escherichia coli KTE134]
 gb|EOW69104.1| isochorismate synthase entC [Escherichia sp. KTE172]
 gb|EOW71026.1| isochorismate synthase entC [Escherichia coli KTE170]
 gb|EOW96193.1| isochorismate synthase entC [Escherichia coli KTE1]
 gb|EOX09963.1| isochorismate synthase entC [Escherichia coli KTE225]
 gb|EQN39526.1| isochorismate synthase entC [Escherichia coli HVH 10 (4-6832164)]
 gb|EQN80252.1| isochorismate synthase entC [Escherichia coli HVH 22 (4-2258986)]
 gb|EQO08435.1| isochorismate synthase entC [Escherichia coli HVH 29 (4-3418073)]
 gb|EQO81597.1| isochorismate synthase entC [Escherichia coli HVH 45 (4-3129918)]
 gb|EQP26173.1| isochorismate synthase entC [Escherichia coli HVH 63 (4-2542528)]
 gb|EQP37180.1| isochorismate synthase entC [Escherichia coli HVH 69 (4-2837072)]
 gb|EQP95136.1| isochorismate synthase entC [Escherichia coli HVH 85 (4-0792144)]
 gb|EQQ07222.1| isochorismate synthase entC [Escherichia coli HVH 88 (4-5854636)]
 gb|EQQ60186.1| isochorismate synthase entC [Escherichia coli HVH 106 (4-6881831)]
 gb|EQQ67940.1| isochorismate synthase entC [Escherichia coli HVH 110 (4-6978754)]
 gb|EQQ95807.1| isochorismate synthase entC [Escherichia coli HVH 113 (4-7535473)]
 gb|EQR23585.1| isochorismate synthase entC [Escherichia coli HVH 119 (4-6879578)]
 gb|EQR36031.1| isochorismate synthase entC [Escherichia coli HVH 122 (4-6851606)]
 gb|EQR69215.1| isochorismate synthase entC [Escherichia coli HVH 130 (4-7036876)]
 gb|EQR71912.1| isochorismate synthase entC [Escherichia coli HVH 134 (4-6073441)]
 gb|EQR75125.1| isochorismate synthase entC [Escherichia coli HVH 133 (4-4466519)]
 gb|EQR76797.1| isochorismate synthase entC [Escherichia coli HVH 135 (4-4449320)]
 gb|EQS07001.1| isochorismate synthase entC [Escherichia coli HVH 140 (4-5894387)]
 gb|EQS23498.1| isochorismate synthase entC [Escherichia coli HVH 145 (4-5672112)]
 gb|EQS50378.1| isochorismate synthase entC [Escherichia coli HVH 151 (4-5755573)]
 gb|EQS73881.1| isochorismate synthase entC [Escherichia coli HVH 163 (4-4697553)]
 gb|EQS90415.1| isochorismate synthase entC [Escherichia coli HVH 167 (4-6073565)]
 gb|EQT13265.1| isochorismate synthase entC [Escherichia coli HVH 173 (3-9175482)]
 gb|EQT39822.1| isochorismate synthase entC [Escherichia coli HVH 183 (4-3205932)]
 gb|EQT79147.1| isochorismate synthase entC [Escherichia coli HVH 189 (4-3220125)]
 gb|EQU49750.1| isochorismate synthase entC [Escherichia coli HVH 206 (4-3128229)]
 gb|EQU62808.1| isochorismate synthase entC [Escherichia coli HVH 208 (4-3112292)]
 gb|EQU86429.1| isochorismate synthase entC [Escherichia coli HVH 215 (4-3008371)]
 gb|EQV25297.1| isochorismate synthase entC [Escherichia coli HVH 223 (4-2976528)]
 gb|EQV82205.1| isochorismate synthase entC [Escherichia coli KOEGE 68 (182a)]
 gb|EQV85548.1| isochorismate synthase entC [Escherichia coli KOEGE 62 (175a)]
 gb|EQV92349.1| isochorismate synthase entC [Escherichia coli KOEGE 73 (195a)]
 gb|ERA68661.1| isochorismate synthase entC [Escherichia coli HVH 155 (4-4509048)]
 gb|ESD47777.1| isochorismate synthase [Escherichia coli 908521]
 gb|ESD52586.1| isochorismate synthase [Escherichia coli 908522]
 gb|ESD82517.1| isochorismate synthase [Escherichia coli 908616]
 gb|AHM42793.1| isochorismate synthase [Escherichia coli]
 gb|AHM47424.1| isochorismate synthase [Escherichia coli]
 gb|AHM51965.1| isochorismate synthase [Escherichia coli]
 gb|EYB38871.1| isochorismate synthase [Escherichia coli]
 gb|KDA75223.1| isochorismate synthase entC [Escherichia coli 2-005-03_S3_C2]
 gb|KDG65552.1| isochorismate synthase entC [Escherichia coli MGH 58]
 gb|KEJ32121.1| isochorismate synthase entC [Escherichia coli 2-316-03_S1_C1]
 gb|KEJ32583.1| isochorismate synthase entC [Escherichia coli 2-316-03_S1_C2]
 gb|KEP20040.1| isochorismate synthase [Escherichia coli]
 gb|KFH84077.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLA L
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAEL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPDQTTFEQMVAR  135



>ref|WP_001666377.1| isochorismate synthase entC [Escherichia coli]
 gb|ENG59917.1| isochorismate synthase entC [Escherichia coli p0305293.2]
Length=391

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE QQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEGQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001657880.1| isochorismate synthase entC [Escherichia coli]
 gb|EMW24415.1| isochorismate synthase entC [Escherichia coli 2845650]
 gb|ENG35468.1| isochorismate synthase entC [Escherichia coli p0305293.10]
 gb|EZB27713.1| isochorismate synthase [Escherichia coli O169:H41 str. F9792]
Length=391

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQT   +   R
Sbjct  121  QAIPEQTPFEQMVAR  135



>gb|AHE58774.1| isochorismate synthase, entC [Escherichia albertii KF1]
Length=395

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/137 (91%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  420  DDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLA  241
            DDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLA
Sbjct  3    DDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLA  62

Query  240  ALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVV  61
            ALFADAK+QGIKNP++VGAIPFDPRQPSSLYIPESWQ FSR+EKQ SARRFTRSQSLNVV
Sbjct  63   ALFADAKSQGIKNPLLVGAIPFDPRQPSSLYIPESWQPFSRKEKQTSARRFTRSQSLNVV  122

Query  60   ERQAIPEQTTLNRWCPR  10
            ERQAIPEQTT  +   R
Sbjct  123  ERQAIPEQTTFEQMVAR  139



>ref|WP_042039409.1| isochorismate synthase [Escherichia coli]
Length=392

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 130/136 (96%), Gaps = 1/136 (1%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSP-DSPFQQKLAA  238
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSP DSPFQQKLAA
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPPDSPFQQKLAA  60

Query  237  LFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVE  58
            LFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVE
Sbjct  61   LFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVE  120

Query  57   RQAIPEQTTLNRWCPR  10
            RQAIPEQTT  +   R
Sbjct  121  RQAIPEQTTFEQMVAR  136



>ref|WP_032221983.1| isochorismate synthase [Escherichia coli]
 gb|EZJ98819.1| isochorismate synthase entC [Escherichia coli 1-182-04_S1_C3]
 gb|EZK36196.1| isochorismate synthase entC [Escherichia coli 2-005-03_S1_C2]
 gb|KDT63597.1| isochorismate synthase entC [Escherichia coli 3-267-03_S1_C3]
 gb|KDU19752.1| isochorismate synthase entC [Escherichia coli 3-267-03_S1_C1]
 gb|KDZ72936.1| isochorismate synthase entC [Escherichia coli 3-073-06_S4_C2]
 gb|KEK77203.1| isochorismate synthase entC [Escherichia coli 3-475-03_S3_C1]
 gb|KEM16797.1| isochorismate synthase entC [Escherichia coli 6-319-05_S1_C2]
 gb|KEN73426.1| isochorismate synthase entC [Escherichia coli 1-392-07_S4_C3]
Length=391

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSF RQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFPRQEKQPSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032352401.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/131 (95%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCF+RFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFSRFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKA+GIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAKGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNR  22
            QAIP+QTT  +
Sbjct  121  QAIPDQTTFEQ  131



>ref|WP_001544326.1| isochorismate synthase entC [Escherichia coli]
 gb|ELD37176.1| isochorismate synthase entC [Escherichia coli KTE213]
 gb|ELG75062.1| isochorismate synthase entC [Escherichia coli KTE140]
 gb|ELJ89473.1| isochorismate synthase entC [Escherichia coli KTE95]
 gb|KDY09632.1| isochorismate synthase entC [Escherichia coli 2-316-03_S4_C1]
Length=391

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSL+VVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLSVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_039021064.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKL AL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLTAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_033868134.1| isochorismate synthase [Escherichia coli]
 gb|KDX30279.1| isochorismate synthase entC [Escherichia coli 1-250-04_S1_C2]
Length=391

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAV GDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVTGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ+SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQSSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_010352083.1| MULTISPECIES: isochorismate synthase EntC [Escherichia]
 gb|EOU45194.1| isochorismate synthase entC [Escherichia sp. KTE114]
Length=391

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQ FSRQEKQASARRFTRSQ+LNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQPFSRQEKQASARRFTRSQALNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_001401287.1| isochorismate synthase EntC [Escherichia coli]
 gb|ETJ67698.1| isochorismate synthase EntC [Escherichia coli ATCC 35150]
 gb|AHG13246.1| Isochorismate synthase [enterobactin] siderophore [Escherichia 
coli O145:H28 str. RM13516]
 gb|AHG07314.1| Isochorismate synthase [enterobactin] siderophore [Escherichia 
coli O145:H28 str. RM13514]
 gb|EYV14578.1| isochorismate synthase [Escherichia coli O145:NM str. 2010C-3526]
 gb|EYV20462.1| isochorismate synthase [Escherichia coli O145:NM str. 2010C-3521]
 gb|EYV26543.1| isochorismate synthase [Escherichia coli O145:NM str. 2010C-3517]
 gb|EYV30016.1| isochorismate synthase [Escherichia coli O145:NM str. 2010C-3518]
 gb|EYV32960.1| isochorismate synthase [Escherichia coli O145:NM str. 2010C-3516]
 gb|EYV40967.1| isochorismate synthase [Escherichia coli O145:NM str. 2010C-3511]
 gb|EYV42812.1| isochorismate synthase [Escherichia coli O145:NM str. 2010C-3510]
 gb|EYV48089.1| isochorismate synthase [Escherichia coli O145:NM str. 2010C-3509]
 gb|EYV48974.1| isochorismate synthase [Escherichia coli O145:NM str. 2010C-3507]
 gb|EYW91681.1| isochorismate synthase [Escherichia coli O145:NM str. 08-4270]
 gb|EYZ16256.1| isochorismate synthase [Escherichia coli O145:NM str. 2010C-4557C2]
 gb|EYZ72055.1| isochorismate synthase [Escherichia coli O145:NM str. 06-3484]
 gb|EZE93644.1| isochorismate synthase [Escherichia coli O145:NM str. 2010C-3508]
 gb|AHY63587.1| Isochorismate synthase [enterobactin] siderophore [Escherichia 
coli O145:H28 str. RM12761]
 gb|AHY69141.1| Isochorismate synthase [enterobactin] siderophore [Escherichia 
coli O145:H28 str. RM12581]
 gb|KDM73656.1| isochorismate synthase [Escherichia coli O145:H28 str. 4865/96]
 gb|KDM81321.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQ LNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQLLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>ref|WP_001354841.1| isochorismate synthase EntC [Escherichia coli]
 gb|EGB62957.1| chorismate binding enzyme [Escherichia coli M863]
 gb|EGE65898.1| putative isochorismate synthase [Escherichia coli STEC_7v]
 gb|EIG79618.1| isochorismate synthase [Escherichia coli 1.2741]
Length=391

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKL AL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLTAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQ FSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQLFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_024257730.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   258 bits (660),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPE WQSFSRQEKQ SARRFTRSQ LNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPECWQSFSRQEKQTSARRFTRSQLLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_012565048.1| isochorismate synthase EntC [Escherichia coli]
 dbj|BAG76184.1| isochorismate synthase [Escherichia coli SE11]
Length=391

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPES QSFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESCQSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>ref|WP_001301140.1| isochorismate synthase EntC [Escherichia coli]
 gb|EDX39631.1| isochorismate synthase, entC [Escherichia coli 101-1]
 emb|CAQ31066.1| isochorismate synthase 1 [Escherichia coli BL21(DE3)]
 gb|ACT30068.1| isochorismate synthase [Escherichia coli 'BL21-Gold(DE3)pLysS 
AG']
 gb|ACT38246.1| isochorismate synthase [Escherichia coli B str. REL606]
 gb|ACT42439.1| isochorismate synthase [Escherichia coli BL21(DE3)]
 gb|EFK24154.1| isochorismate synthase [Escherichia coli MS 187-1]
 gb|EGB58730.1| chorismate binding enzyme [Escherichia coli H489]
 emb|CCQ00711.1| Isochorismate synthase [Escherichia coli O5:K4(L):H4 str. ATCC 
23502]
 gb|ENA22155.1| isochorismate synthase entC [Escherichia coli P0298942.1]
 gb|ENB02572.1| isochorismate synthase entC [Escherichia coli 2862600]
 gb|ENB45011.1| isochorismate synthase entC [Escherichia coli P0298942.10]
 gb|ENB51054.1| isochorismate synthase entC [Escherichia coli P0298942.11]
 gb|ENB66297.1| isochorismate synthase entC [Escherichia coli P0298942.15]
 gb|ENB66739.1| isochorismate synthase entC [Escherichia coli P0298942.6]
 gb|ENB70055.1| isochorismate synthase entC [Escherichia coli P0298942.2]
 gb|ENB83420.1| isochorismate synthase entC [Escherichia coli P0298942.8]
 gb|ENB87466.1| isochorismate synthase entC [Escherichia coli P0298942.9]
 gb|END46537.1| isochorismate synthase entC [Escherichia coli 2733950]
 gb|END74597.1| isochorismate synthase entC [Escherichia coli P0298942.4]
 gb|ENG91865.1| isochorismate synthase entC [Escherichia coli P0298942.14]
 gb|EQV45955.1| isochorismate synthase entC [Escherichia coli KOEGE 40 (102a)]
 gb|ERB09533.1| isochorismate synthase entC [Escherichia coli KOEGE 7 (16a)]
 gb|ESP47826.1| isochorismate synthase entC [Escherichia coli HVH 152 (4-3447545)]
 emb|CDK78861.1| Isochorismate synthase [enterobactin] siderophore [Klebsiella 
pneumoniae IS22]
 gb|KDX85213.1| isochorismate synthase entC [Escherichia coli 2-222-05_S4_C2]
 gb|KEO19593.1| isochorismate synthase entC [Escherichia coli 2-222-05_S4_C3]
 gb|AJF75931.1| isochorismate synthase [Escherichia coli]
 gb|AJH09487.1| isochorismate synthase [Escherichia coli]
Length=391

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQ IKNPV+VGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQSIKNPVIVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_012311984.1| isochorismate synthase EntC [Escherichia coli]
 gb|ACB20022.1| isochorismate synthase, entC [Escherichia coli SMS-3-5]
Length=391

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESW SFSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWLSFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+Q T  +   R
Sbjct  121  QAIPQQATFEQMVAR  135



>ref|WP_001353366.1| MULTISPECIES: isochorismate synthase EntC [Escherichia]
 gb|EGB71513.1| chorismate binding enzyme [Escherichia coli TW10509]
Length=391

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSR EKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRLEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_001509658.1| isochorismate synthase entC [Escherichia coli]
 gb|END74766.1| isochorismate synthase entC [Escherichia coli P0298942.3]
Length=391

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQ IKNPV+VGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQSIKNPVIVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001719822.1| isochorismate synthase entC [Escherichia coli]
 gb|EMW37087.1| isochorismate synthase entC [Escherichia coli 2845350]
Length=391

 Score =   258 bits (659),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQ IKNPV+VGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQSIKNPVIVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_001427091.1| isochorismate synthase entC [Escherichia coli]
 gb|ENG87647.1| isochorismate synthase entC [Escherichia coli P0298942.12]
Length=391

 Score =   258 bits (658),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQ IKNPV+VGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQSIKNPVIVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_010355437.1| isochorismate synthase EntC [Escherichia sp. TW09231]
Length=391

 Score =   258 bits (658),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQ FSR+EKQASARRFTRSQ+LNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQPFSRKEKQASARRFTRSQALNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_005141144.1| isochorismate synthase EntC [Shigella sonnei]
 gb|AAZ87312.1| isochorismate hydroxymutase 2 [Shigella sonnei Ss046]
 gb|EFZ49844.1| putative isochorismate synthase [Shigella sonnei 53G]
 gb|EIQ47434.1| isochorismate synthase entC [Shigella sonnei 3226-85]
 gb|EIQ47911.1| isochorismate synthase entC [Shigella sonnei 3233-85]
 gb|EIQ54607.1| ENTC isochorismate synthase 1 [Shigella sonnei 4822-66]
 gb|EJL19459.1| ENTC isochorismate synthase 1 [Shigella sonnei str. Moseley]
 gb|KGY96105.1| isochorismate synthase [Shigella sonnei]
Length=391

 Score =   258 bits (658),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SA  FTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSAHCFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_016159117.1| MULTISPECIES: isochorismate synthase entC [Escherichia]
 gb|EOQ57153.1| isochorismate synthase entC [Escherichia coli KTE33]
 gb|EOU83223.1| isochorismate synthase entC [Escherichia sp. KTE31]
 gb|EQV94751.1| isochorismate synthase entC [Escherichia coli KOEGE 71 (186a)]
Length=391

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQ FSR+EKQASARRFTRSQ+LNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQPFSRKEKQASARRFTRSQALNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_010346610.1| MULTISPECIES: isochorismate synthase EntC [Escherichia]
Length=391

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQ FSR+EKQASARRFTRSQ+LNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQPFSRKEKQASARRFTRSQALNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_001688499.1| isochorismate synthase entC [Escherichia coli]
 gb|EMU98869.1| isochorismate synthase entC [Escherichia coli MP021017.4]
Length=391

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPE WQSF RQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPEPWQSFPRQEKQPSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_015953598.1| isochorismate synthase EntC [Escherichia fergusonii]
 ref|YP_002383610.1| isochorismate synthase 1 [Escherichia fergusonii ATCC 35469]
 emb|CAQ89997.1| isochorismate synthase 1 [Escherichia fergusonii ATCC 35469]
Length=391

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKL AL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLTAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSR EKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRLEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_024256922.1| isochorismate synthase [Escherichia fergusonii]
Length=391

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKL AL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLTAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQ LNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQPLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_032224891.1| isochorismate synthase, partial [Escherichia coli]
 gb|EYD80193.1| isochorismate synthase entC, partial [Escherichia coli 1-176-05_S3_C2]
 gb|EYD87441.1| isochorismate synthase entC, partial [Escherichia coli 1-176-05_S3_C2]
Length=352

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQ F R+EKQASARRFTRSQ+LNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQPFPRKEKQASARRFTRSQALNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_032220434.1| isochorismate synthase [Escherichia coli]
 gb|KEM11645.1| isochorismate synthase entC [Escherichia coli 6-175-07_S4_C2]
 gb|KEN59501.1| isochorismate synthase entC [Escherichia coli 6-537-08_S1_C3]
 gb|KEN66984.1| isochorismate synthase entC [Escherichia coli 6-537-08_S4_C2]
Length=391

 Score =   256 bits (654),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/135 (93%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQS  RQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSSPRQEKQPSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032216629.1| isochorismate synthase [Escherichia coli]
 gb|KEN09766.1| isochorismate synthase entC [Escherichia coli 6-319-05_S1_C1]
Length=391

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFD+PAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDDPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESW  FSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWALFSRQEKQPSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032254782.1| isochorismate synthase [Escherichia coli]
 gb|KDW43940.1| isochorismate synthase entC [Escherichia coli 2-177-06_S4_C2]
Length=391

 Score =   255 bits (652),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQS SRQ+KQA ARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSSSRQKKQAPARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPQQTTFEQMVAR  135



>ref|WP_001455965.1| isochorismate synthase entC [Escherichia coli]
 gb|ENB81499.1| isochorismate synthase entC [Escherichia coli P0298942.7]
Length=391

 Score =   255 bits (652),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQ IKNPV+VGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQSIKNPVIVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQT   +   R
Sbjct  121  QAIPEQTPFEQMVAR  135



>ref|WP_032224902.1| isochorismate synthase [Escherichia coli]
 gb|EYD87067.1| isochorismate synthase entC [Escherichia coli 1-176-05_S3_C2]
Length=391

 Score =   255 bits (651),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQ F R+EKQASARRFTRSQ+LNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQPFPRKEKQASARRFTRSQALNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_025237418.1| isochorismate synthase [Escherichia albertii]
Length=391

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGIKNP++VGAIPFDPRQPSSLYIPESWQ FSR+EKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKSQGIKNPLLVGAIPFDPRQPSSLYIPESWQPFSRKEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_032293942.1| isochorismate synthase [Escherichia coli]
 gb|KEN15515.1| isochorismate synthase entC [Escherichia coli 7-233-03_S4_C2]
Length=391

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/135 (93%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFD+PAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDDPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQS  RQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSSPRQEKQPSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_033556039.1| isochorismate synthase [Escherichia coli]
Length=390

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDS  SPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDS-XSPFQQKLAAL  59

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER
Sbjct  60   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  119

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  120  QAIPEQTTFEQMVAR  134



>ref|WP_010380682.1| isochorismate synthase EntC [Escherichia sp. TW09308]
Length=391

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQ+L AL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQRLTAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FA+AK+QGIKNPVMVGAIPFDPRQPSSLYIPESWQ FSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FANAKSQGIKNPVMVGAIPFDPRQPSSLYIPESWQPFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIP+QTT  +   R
Sbjct  121  QAIPDQTTFEQMVAR  135



>ref|WP_016248453.1| MULTISPECIES: isochorismate synthase entC [Escherichia]
 gb|EOV43247.1| isochorismate synthase entC [Escherichia sp. KTE52]
 gb|EOW67299.1| isochorismate synthase entC [Escherichia sp. KTE159]
Length=391

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQ+L AL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQRLTAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FA+AK+QGIKNPVMVGAIPFDPRQPSSLYIPESWQ FSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FANAKSQGIKNPVMVGAIPFDPRQPSSLYIPESWQPFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_001404775.1| isochorismate synthase entC [Escherichia coli]
 gb|ENB15641.1| isochorismate synthase entC [Escherichia coli 2875150]
Length=391

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSF TSGCFARFD+PAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFPTSGCFARFDDPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQ IKNPV+VGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQSIKNPVIVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_010333946.1| isochorismate synthase EntC [Escherichia albertii]
Length=391

 Score =   253 bits (646),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGIKNP++VGAIPFDPRQPSSLYIPESWQ FSR+EKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKSQGIKNPLLVGAIPFDPRQPSSLYIPESWQPFSRKEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_032252249.1| isochorismate synthase [Escherichia coli]
 gb|KDU25004.1| isochorismate synthase entC [Escherichia coli 3-267-03_S4_C2]
Length=391

 Score =   253 bits (646),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFD+PAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDDPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQS  RQ+KQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSSPRQKKQPSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>ref|WP_002430226.1| isochorismate synthase EntC [Escherichia albertii]
 gb|EDS92114.1| isochorismate synthase, entC [Escherichia albertii TW07627]
 dbj|GAL53931.1| isochorismate synthase EntC [Escherichia albertii NBRC 107761]
Length=391

 Score =   253 bits (645),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGIKNP++VGAIPFDPRQPSSLYIPESWQ FSR+EKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKSQGIKNPLLVGAIPFDPRQPSSLYIPESWQPFSRKEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_032203496.1| isochorismate synthase, partial [Escherichia coli]
 gb|KDY87378.1| isochorismate synthase entC domain protein, partial [Escherichia 
coli 2-427-07_S1_C3]
Length=120

 Score =   243 bits (619),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/120 (99%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQSLNVVER  120



>ref|WP_001515951.1| MULTISPECIES: isochorismate synthase entC [Escherichia]
 gb|ELC22019.1| isochorismate synthase entC [Escherichia sp. KTE11]
 gb|EOV90900.1| isochorismate synthase entC [Escherichia sp. KTE96]
Length=391

 Score =   250 bits (639),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDS DSPFQQ+L AL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSLDSPFQQRLTAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FA+AK+QGIKNPVMVGAIPFDPRQPSSLYIPESWQ FSRQEKQASARRFTRSQSLNVVER
Sbjct  61   FANAKSQGIKNPVMVGAIPFDPRQPSSLYIPESWQPFSRQEKQASARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_010342363.1| isochorismate synthase EntC [Escherichia albertii]
Length=391

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSG FARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGFFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGIKNP++VGAIPFDPRQPSSLYIPESWQ FSR+EKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKSQGIKNPLLVGAIPFDPRQPSSLYIPESWQPFSRKEKQTSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQ T  +   R
Sbjct  121  QAIPEQATFEQMVAR  135



>ref|WP_032222609.1| isochorismate synthase [Escherichia coli]
 gb|KEM13287.1| isochorismate synthase entC [Escherichia coli 6-175-07_S4_C1]
Length=391

 Score =   248 bits (632),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIP+  QS  RQEKQ SARRFTRSQSLNVVER
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPKPGQSSPRQEKQPSARRFTRSQSLNVVER  120

Query  54   QAIPEQTTLNRWCPR  10
            QAIPEQTT  +   R
Sbjct  121  QAIPEQTTFEQMVAR  135



>gb|EQP28380.1| isochorismate synthase entC [Escherichia coli HVH 59 (4-1119338)]
 gb|EQV17035.1| isochorismate synthase entC [Escherichia coli HVH 222 (4-2977443)]
 gb|EQW94501.1| isochorismate synthase entC [Escherichia coli UMEA 3140-1]
 gb|ESP32613.1| isochorismate synthase entC [Escherichia coli HVH 148 (4-3192490)]
Length=379

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/123 (95%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = -3

Query  378  MATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAALFADAKAQGIKNP  199
            MATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAALFADAKAQGIKNP
Sbjct  1    MATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAALFADAKAQGIKNP  60

Query  198  VMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVERQAIPEQTTLNRW  19
            VMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVERQAIPEQTT  + 
Sbjct  61   VMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVERQAIPEQTTFEQM  120

Query  18   CPR  10
              R
Sbjct  121  VAR  123



>ref|WP_023565082.1| isochorismate synthase, partial [Escherichia coli]
 gb|EST74459.1| isochorismate synthase, partial [Escherichia coli ECA-0157]
Length=110

 Score =   225 bits (574),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/110 (100%), Positives = 110/110 (100%), Gaps = 0/110 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFT  85
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFT
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFT  110



>ref|WP_001456947.1| isochorismate synthase entC domain protein, partial [Escherichia 
coli]
 gb|ENB72473.1| isochorismate synthase entC domain protein, partial [Escherichia 
coli P0298942.7]
Length=113

 Score =   225 bits (573),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQ  76
            FADAKAQ IKNPV+VGAIPFDPRQPSSLYIPESWQSFSRQEKQ SARRFTRSQ
Sbjct  61   FADAKAQSIKNPVIVGAIPFDPRQPSSLYIPESWQSFSRQEKQTSARRFTRSQ  113



>gb|EFW53349.1| isochorismate synthase [Shigella boydii ATCC 9905]
Length=108

 Score =   223 bits (569),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/107 (100%), Positives = 107/107 (100%), Gaps = 0/107 (0%)
 Frame = -3

Query  438  LYHFVEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSP  259
            LYHFVEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSP
Sbjct  2    LYHFVEDDMDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSP  61

Query  258  FQQKLAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSR  118
            FQQKLAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSR
Sbjct  62   FQQKLAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSR  108



>ref|WP_042286202.1| isochorismate synthase [Citrobacter sedlakii]
Length=391

 Score =   227 bits (579),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAP+RFFFMSPYRSFTTSGCFARF+EPAVNGDSPDSPFQQKL  L
Sbjct  1    MDTSLAEEVQQTMATLAPDRFFFMSPYRSFTTSGCFARFNEPAVNGDSPDSPFQQKLHNL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGI NP+MVGAIPFD RQPS+L+IPE+W++FSRQEKQ ++R FT  QSLNV ER
Sbjct  61   FADAKAQGIANPIMVGAIPFDTRQPSALFIPEAWETFSRQEKQQASRYFTGHQSLNVTER  120

Query  54   QAIPEQTTLNRWCPR  10
            +AIPEQ T      R
Sbjct  121  RAIPEQDTFESMVAR  135



>ref|WP_044266421.1| isochorismate synthase [Citrobacter amalonaticus]
 gb|KEY47850.1| isochorismate synthase [Citrobacter amalonaticus]
Length=391

 Score =   227 bits (579),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAP RFFFMSPYRSFTTSGCFARFDEPA+NGDSPDSPFQQKL AL
Sbjct  1    MDTSLAEEVQQTMATLAPQRFFFMSPYRSFTTSGCFARFDEPAINGDSPDSPFQQKLHAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            F DAKAQGI NPVMVGAIPFD RQPSSL+IP+SWQ+FSRQEKQ S+R FT  Q+LNV  R
Sbjct  61   FTDAKAQGIANPVMVGAIPFDTRQPSSLFIPQSWQTFSRQEKQRSSRYFTDHQTLNVTAR  120

Query  54   QAIPEQTTLNRWCPR  10
             AIPEQ T      R
Sbjct  121  NAIPEQETFEAMVAR  135



>ref|WP_042320784.1| isochorismate synthase [Citrobacter farmeri]
 dbj|GAL49481.1| isochorismate synthase EntC [Citrobacter farmeri GTC 1319]
Length=391

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAP+RFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKL  +
Sbjct  1    MDTSLAEEVQQTMATLAPHRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLQKM  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGI NPVMVGAIPFD RQPSSL+IP+SWQ+FSRQEKQ S+  FT  Q+LNV  R
Sbjct  61   FADAKAQGIANPVMVGAIPFDTRQPSSLFIPQSWQTFSRQEKQRSSCYFTDHQALNVTAR  120

Query  54   QAIPEQTTLNRWCPR  10
            +AIPEQ T      R
Sbjct  121  KAIPEQETFEEMVAR  135



>gb|EGK62685.1| isochorismate synthase [Enterobacter hormaechei ATCC 49162]
Length=444

 Score =   226 bits (575),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 127/188 (68%), Gaps = 0/188 (0%)
 Frame = -3

Query  573  MLLIFMVTTTRCNPELQIALPQELT*CAFAFRLATENINDNHY*SLYHFVEDDMDTSLAE  394
            MLLIFMV    C       + + LT      RLA ENINDNHY   YHF EDDMDTSLAE
Sbjct  1    MLLIFMVAGKGCKRLSHKLIARWLTAGRCGIRLADENINDNHYCFFYHFKEDDMDTSLAE  60

Query  393  EVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAALFADAKAQ  214
            EVQ T  TL  + FFFMSPYRSFTTSGCFARF EPAV GD P  PFQQKLA  F  AKA 
Sbjct  61   EVQHTATTLQSDSFFFMSPYRSFTTSGCFARFSEPAVGGDDPAGPFQQKLAQAFRKAKAS  120

Query  213  GIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVERQAIPEQT  34
            GI +PVMVGAIPFD R+PSSLYIP+ WQ+FSR  +Q SAR  + +Q+LNV +R  IP Q 
Sbjct  121  GIAHPVMVGAIPFDTRKPSSLYIPQRWQTFSRPARQQSARYASGAQTLNVQQRTEIPPQP  180

Query  33   TLNRWCPR  10
                   R
Sbjct  181  VFEEMVAR  188



>ref|WP_043001459.1| isochorismate synthase [Citrobacter sp. MGH 55]
 gb|KDF04623.1| isochorismate synthase entC [Citrobacter sp. MGH 55]
Length=391

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAP RFFFMSPYRSFTTSGCFARFDEPA+NGDSPDSPFQQKL AL
Sbjct  1    MDTSLAEEVQQTMATLAPQRFFFMSPYRSFTTSGCFARFDEPAINGDSPDSPFQQKLHAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            F DAKAQGI NPVMVG+IPFD RQPSSL+IP+ WQ+FSRQEKQ S+R FT  Q+LNV  R
Sbjct  61   FTDAKAQGIANPVMVGSIPFDTRQPSSLFIPQRWQTFSRQEKQRSSRYFTDHQTLNVTAR  120

Query  54   QAIPEQTTLNRWCPR  10
             AIPEQ T      R
Sbjct  121  NAIPEQETFEAMVAR  135



>ref|WP_044256627.1| MULTISPECIES: isochorismate synthase [Citrobacter]
Length=391

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAP RFFFMSPYRSFTTSGCFARFDEPA+NGDSPDSPFQQKL  L
Sbjct  1    MDTSLAEEVQQTMATLAPQRFFFMSPYRSFTTSGCFARFDEPAINGDSPDSPFQQKLHTL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            F DAKAQGI NPVMVGAIPFD RQPSSL+IP+ WQ+FSRQEKQ S+R FT  Q+LNV  R
Sbjct  61   FTDAKAQGIANPVMVGAIPFDTRQPSSLFIPQRWQTFSRQEKQRSSRYFTDHQTLNVTAR  120

Query  54   QAIPEQTTLNRWCPR  10
             AIPEQ T      R
Sbjct  121  NAIPEQETFEAMVAR  135



>ref|WP_001503543.1| isochorismate synthase entC domain protein, partial [Escherichia 
coli]
 gb|END28595.1| isochorismate synthase entC domain protein, partial [Escherichia 
coli p0305293.13]
Length=103

 Score =   213 bits (541),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%), Gaps = 0/103 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ  106
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQ  103



>emb|CDL37973.1| Isochorismate synthase [enterobactin] siderophore [Escherichia 
coli ISC11]
Length=129

 Score =   209 bits (531),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    MDTSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMNAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NPVMVGAIPFD RQPSSL+IP+SWQSFSR  KQ S+R FT  QSLNVVER
Sbjct  61   FADAKSQGIANPVMVGAIPFDTRQPSSLFIPQSWQSFSRTAKQQSSRYFTAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>gb|EGI99305.1| entC [Shigella boydii 5216-82]
Length=99

 Score =   204 bits (520),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/99 (100%), Positives = 99/99 (100%), Gaps = 0/99 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSR  118
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSR
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSR  99



>ref|WP_003022040.1| MULTISPECIES: isochorismate synthase EntC [Citrobacter]
 gb|EJF24253.1| isochorismate synthase entC [Citrobacter sp. A1]
 gb|EKU36644.1| isochorismate synthase entc [Citrobacter sp. L17]
 gb|EOD61902.1| isochorismate synthase EntC [Citrobacter freundii GTC 09629]
Length=391

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    MDTSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMNAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NPVMVGAIPFD RQPSSL+IP+SWQSFSR EKQ S+R FT  QSLNVVER
Sbjct  61   FADAKSQGIANPVMVGAIPFDTRQPSSLFIPQSWQSFSRTEKQQSSRYFTAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>ref|WP_012133396.1| isochorismate synthase EntC [Citrobacter koseri]
 ref|YP_001454113.1| hypothetical protein CKO_02568 [Citrobacter koseri ATCC BAA-895]
 gb|ABV13677.1| hypothetical protein CKO_02568 [Citrobacter koseri ATCC BAA-895]
Length=391

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQ MATL P+RFFFMSPYRSFTTSGCFARF EPAV+GDS DSPFQQKL   
Sbjct  1    MDTSLAEEVQQKMATLTPDRFFFMSPYRSFTTSGCFARFAEPAVDGDSLDSPFQQKLQQA  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADA+AQGI NPVMVGAIPFD RQPSSL+IPESWQ+FSR  KQ S+R FT  Q+LNVV+R
Sbjct  61   FADARAQGIANPVMVGAIPFDTRQPSSLFIPESWQTFSRPAKQQSSRYFTGHQALNVVDR  120

Query  54   QAIPEQTTLNRWCPR  10
            ++IPEQ T      R
Sbjct  121  KSIPEQETFEAMVAR  135



>ref|WP_012904941.1| isochorismate synthase EntC [Citrobacter rodentium]
 emb|CBG87377.1| isochorismate synthase [Citrobacter rodentium ICC168]
 gb|KIQ50443.1| isochorismate synthase [Citrobacter rodentium]
Length=391

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAE+VQQTMATLAP+RFFFMSPYRSFTTSGCFARFDEPAVNGDSPDS FQ+KL  L
Sbjct  1    MDTSLAEDVQQTMATLAPDRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSSFQKKLHTL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADA+A GI  PV+VGAIPFD RQPS+L+IPE+ +SFSR +KQ ++R FT  QSLNV+ER
Sbjct  61   FADARAAGIDKPVVVGAIPFDTRQPSALFIPEARESFSRPQKQHASRSFTAHQSLNVIER  120

Query  54   QAIPEQTTLNRWCPR  10
            +AIPEQ T      R
Sbjct  121  KAIPEQKTFETMVAR  135



>gb|KGY17236.1| isochorismate synthase [Citrobacter koseri]
Length=391

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQ MATL P+RFFFMSPYRSFTTSGCFARF EPAV+GDS DSPFQQKL   
Sbjct  1    MDTSLAEEVQQKMATLTPDRFFFMSPYRSFTTSGCFARFAEPAVDGDSLDSPFQQKLQQA  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADA+AQGI NPVMVGAIPFD RQPSSL+IPESWQ+FSR  KQ S+R FT  Q+LNVV+R
Sbjct  61   FADARAQGIANPVMVGAIPFDTRQPSSLFIPESWQTFSRPAKQQSSRYFTGHQALNVVDR  120

Query  54   QAIPEQTTLNRWCPR  10
            ++IPEQ T      R
Sbjct  121  KSIPEQETFEAMVAR  135



>emb|CDZ84261.1| isochorismate synthase [Citrobacter koseri]
Length=391

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQ MATL P+RFFFMSPYRSFTTSGCFARF EPAV+GDS DSPFQQKL   
Sbjct  1    MDTSLAEEVQQKMATLTPDRFFFMSPYRSFTTSGCFARFAEPAVDGDSLDSPFQQKLQQA  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADA+AQGI NPVMVGAIPFD RQPSSL+IPESWQ+FSR  KQ S+R FT  Q+LNVV+R
Sbjct  61   FADARAQGIANPVMVGAIPFDTRQPSSLFIPESWQTFSRPAKQQSSRYFTGHQALNVVDR  120

Query  54   QAIPEQTTLNRWCPR  10
            ++IPEQ T      R
Sbjct  121  KSIPEQETFEAMVAR  135



>ref|WP_032948772.1| isochorismate synthase [Citrobacter freundii]
 gb|ETX72666.1| isochorismate synthase entC [Citrobacter freundii UCI 31]
 gb|KGY84614.1| isochorismate synthase [Citrobacter freundii]
Length=391

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    MDTSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMNAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NPVMVGAIPFD RQPSSL+IP+SWQSFSR  KQ S+R FT  QSLNVVER
Sbjct  61   FADAKSQGIANPVMVGAIPFDTRQPSSLFIPQSWQSFSRTAKQQSSRYFTAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>ref|WP_044699498.1| isochorismate synthase [Citrobacter freundii]
 gb|KJC13327.1| isochorismate synthase [Citrobacter freundii]
Length=391

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    MDTSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMNAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NPVMVGAIPFD RQPSSL+IP+SWQSFSR  KQ S+R FT  QSLNVVER
Sbjct  61   FADAKSQGIANPVMVGAIPFDTRQPSSLFIPQSWQSFSRTAKQQSSRYFTAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>ref|WP_044712743.1| isochorismate synthase [Citrobacter freundii]
 gb|KJC08475.1| isochorismate synthase [Citrobacter freundii]
Length=391

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    MDTSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMNAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NPVMVGAIPFD RQPSSL+IP+SWQSFSR  KQ S+R FT  QSLNVVER
Sbjct  61   FADAKSQGIANPVMVGAIPFDTRQPSSLFIPQSWQSFSRTAKQQSSRYFTAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>ref|WP_003831195.1| isochorismate synthase EntC [Citrobacter freundii]
 gb|EHL83373.1| isochorismate synthase entC [Citrobacter freundii 4_7_47CFAA]
Length=391

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    MDTSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMNAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NPVMVGAIPFD RQPSSL+IP+SWQSFSR  KQ S+R FT  QSLNVVER
Sbjct  61   FADAKSQGITNPVMVGAIPFDTRQPSSLFIPQSWQSFSRTAKQQSSRYFTAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>ref|WP_008784058.1| isochorismate synthase EntC [Citrobacter sp. 30_2]
 gb|EEH92030.1| isochorismate synthase entC [Citrobacter sp. 30_2]
Length=391

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    MDTSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMNAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NPVMVGAIPFD RQPSSL+IP+SWQSFSR  KQ S+R FT  QSLNVVER
Sbjct  61   FADAKSQGIANPVMVGAIPFDTRQPSSLFIPQSWQSFSRAAKQQSSRYFTAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>ref|WP_032942659.1| isochorismate synthase [Citrobacter freundii]
 gb|ETX65113.1| isochorismate synthase entC [Citrobacter freundii UCI 32]
Length=391

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    MDTSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMNAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NPVMVGAIPFD RQPSSL+IP+SWQSFSR  KQ S+R FT  QSLNVVER
Sbjct  61   FADAKSQGIVNPVMVGAIPFDTRQPSSLFIPQSWQSFSRTAKQQSSRYFTAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>ref|WP_003835641.1| isochorismate synthase EntC [Citrobacter freundii]
 gb|EKS58684.1| isochorismate synthase EntC [Citrobacter freundii ATCC 8090 = 
MTCC 1658]
 gb|EXF29526.1| isochorismate synthase EntC [Citrobacter freundii RLS1]
 gb|KFC00818.1| isochorismate synthase [Citrobacter freundii ATCC 8090 = MTCC 
1658]
 dbj|GAL39071.1| isochorismate synthase EntC [Citrobacter freundii NBRC 12681]
Length=391

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    MDTSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMNAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NPVMVGAIPFD RQPSSL+IP+SWQ+FSR  KQ S+R FT  QSLNVVER
Sbjct  61   FADAKSQGIANPVMVGAIPFDTRQPSSLFIPQSWQNFSRTAKQQSSRYFTAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>ref|WP_003847433.1| MULTISPECIES: isochorismate synthase EntC [Citrobacter]
 gb|EMF20818.1| isochorismate synthase EntC [Citrobacter freundii GTC 09479]
 gb|EOQ25373.1| isochorismate synthase entC [Citrobacter sp. KTE30]
Length=391

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+  L
Sbjct  1    MDTSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMNTL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NPVMVGAIPFD RQPSSL+IP+SWQSFSR  KQ S+R FT  QSLNVVER
Sbjct  61   FADAKSQGIANPVMVGAIPFDTRQPSSLFIPQSWQSFSRTAKQQSSRYFTAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>ref|WP_032936903.1| isochorismate synthase [Escherichia coli]
 gb|KEL80287.1| isochorismate synthase entC [Escherichia coli 5-172-05_S1_C1]
Length=391

 Score =   209 bits (531),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+  L
Sbjct  1    MDTSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMNTL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NPVMVGAIPFD RQPSSL+IP+SWQSFSR  KQ S+R FT  QSLNVVER
Sbjct  61   FADAKSQGIANPVMVGAIPFDTRQPSSLFIPQSWQSFSRTAKQRSSRYFTAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>gb|KGZ33017.1| isochorismate synthase [Citrobacter freundii]
Length=391

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    MDTSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMHAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NP+MVGAIPFD RQPSSL+IP SWQ+FSR  KQ S+R F   QSLNVVER
Sbjct  61   FADAKSQGIANPIMVGAIPFDTRQPSSLFIPRSWQTFSRTAKQQSSRYFNAHQSLNVVER  120

Query  54   QAIPEQ  37
            Q+IPEQ
Sbjct  121  QSIPEQ  126



>gb|AHO21866.1| isochorismate synthase [Salmonella enterica subsp. enterica serovar 
Enteritidis str. EC20121180]
Length=237

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MD SLAE+ Q+TMATLAP+RFFFMSPYRSFTTSGCFAR+ EPAV GDSPDSPFQQKL   
Sbjct  1    MDMSLAEDAQETMATLAPDRFFFMSPYRSFTTSGCFARYTEPAVAGDSPDSPFQQKLRQQ  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FA+AK+QGI NP++VGAIPFD RQPSSL+IP +WQSFSRQ+KQ +AR FT  QSL V  R
Sbjct  61   FAEAKSQGIANPILVGAIPFDTRQPSSLFIPMAWQSFSRQQKQRTARYFTDHQSLTVTAR  120

Query  54   QAIPEQTTLNRWCPR  10
            +AIPEQ        R
Sbjct  121  KAIPEQDAFEAMVAR  135



>gb|KHE09718.1| isochorismate synthase [Citrobacter braakii]
Length=391

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            M+TSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    METSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMHAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGI NP+MVGAIPFD RQPSSL+IP+SWQ+FSR  KQ S+R F   QSLNVVER
Sbjct  61   FADAKAQGIANPIMVGAIPFDTRQPSSLFIPQSWQTFSRTAKQQSSRYFNAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>gb|KHE06577.1| isochorismate synthase [Citrobacter braakii]
Length=391

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            M+TSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    METSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMHAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGI NP+MVGAIPFD RQPSSL+IP+SWQ+FSR  KQ S+R F   QSLNVVER
Sbjct  61   FADAKAQGIANPIMVGAIPFDTRQPSSLFIPQSWQTFSRTAKQQSSRYFNAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>ref|WP_016152197.1| MULTISPECIES: isochorismate synthase entC [Citrobacter]
 gb|EOQ50233.1| isochorismate synthase entC [Citrobacter sp. KTE151]
Length=391

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            M+TSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    METSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMHAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGI NP+MVGAIPFD RQPSSL+IP+SWQ+FSR  KQ S+R F   QSLNVVER
Sbjct  61   FADAKAQGIANPIMVGAIPFDTRQPSSLFIPQSWQTFSRTAKQQSSRYFNAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>ref|WP_016155945.1| isochorismate synthase entC [Citrobacter sp. KTE32]
 gb|EOQ32502.1| isochorismate synthase entC [Citrobacter sp. KTE32]
Length=391

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            M+TSLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    METSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMHAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAKAQGI NP+MVGAIPFD RQPSSL+IP+SWQ+FSR  KQ S+R F   QSLNVVER
Sbjct  61   FADAKAQGIANPIMVGAIPFDTRQPSSLFIPQSWQTFSRTAKQQSSRYFNAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>ref|WP_042309868.1| isochorismate synthase [Citrobacter werkmanii]
 dbj|GAL44973.1| isochorismate synthase EntC [Citrobacter werkmanii NBRC 105721]
Length=391

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MD SLAEE  QTM TLAP+ FFFMSPYRSFTTSGCF R+ EPA++GDSPDSPFQ K+ AL
Sbjct  1    MDMSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFTRYAEPAIDGDSPDSPFQHKMHAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NP+MVGAIPFD RQPSSL+IP+SWQSFSR  KQ S+R F R QSLNVVER
Sbjct  61   FADAKSQGIANPIMVGAIPFDTRQPSSLFIPQSWQSFSRTAKQQSSRYFNRHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>ref|WP_043015537.1| isochorismate synthase [Citrobacter freundii]
 gb|KDF20982.1| isochorismate synthase entC [Citrobacter freundii MGH 56]
Length=391

 Score =   206 bits (524),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MD SLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQK+ AL
Sbjct  1    MDMSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQKMHAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NP+MVGAIPFD RQPSSL+IP SWQ+FSR  KQ S+R F   QSLNVVER
Sbjct  61   FADAKSQGIANPIMVGAIPFDTRQPSSLFIPRSWQTFSRTAKQQSSRYFNAHQSLNVVER  120

Query  54   QAIPEQ  37
            Q+IPEQ
Sbjct  121  QSIPEQ  126



>ref|WP_038638631.1| isochorismate synthase [Citrobacter freundii]
 gb|AHY12413.1| isochorismate synthase [Citrobacter freundii CFNIH1]
Length=391

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MD SLAEE  QTM TLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQ K+ AL
Sbjct  1    MDMSLAEEKTQTMPTLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQHKMHAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NP+MVGAIPFD RQPSSL+IP+SWQSFSR  KQ S+R F R QSLNVVER
Sbjct  61   FADAKSQGIANPIMVGAIPFDTRQPSSLFIPQSWQSFSRTAKQQSSRYFNRHQSLNVVER  120

Query  54   QAIPEQ  37
             +IP+Q
Sbjct  121  NSIPQQ  126



>ref|WP_040232589.1| isochorismate synthase [Citrobacter sp. CIP 55.13]
 emb|CEJ66063.1| Isochorismate synthase [enterobactin] siderophore [Citrobacter 
sp. CIP 55.13]
Length=391

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MD SLAEE  QTMATLAP+ FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQ K+  L
Sbjct  1    MDMSLAEEKTQTMATLAPDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQLKMHTL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FA AK+QGI NP+MVGAIPFD RQPSSL+IP+SWQSFSR  KQ SAR FT  QSLNVVER
Sbjct  61   FAQAKSQGIANPIMVGAIPFDTRQPSSLFIPQSWQSFSRTAKQQSARYFTAHQSLNVVER  120

Query  54   QAIPEQ  37
            ++IPEQ
Sbjct  121  KSIPEQ  126



>ref|WP_031610105.1| isochorismate synthase, partial [Salmonella enterica]
Length=141

 Score =   196 bits (499),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = -3

Query  405  SLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAALFAD  226
            SLAE+ Q+TMATLAP+RFFFMSPYRSFTTSGCFAR+ EPAV GDSPDSPFQQKL   FA+
Sbjct  2    SLAEDAQETMATLAPDRFFFMSPYRSFTTSGCFARYTEPAVAGDSPDSPFQQKLRQQFAE  61

Query  225  AKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVERQAI  46
            AK+QGI NP++VGAIPFD RQPSSL+IP +WQSFSRQ+KQ +AR FT  QSL V  R+AI
Sbjct  62   AKSQGIANPILVGAIPFDTRQPSSLFIPMAWQSFSRQQKQRTARYFTDHQSLTVTARKAI  121

Query  45   PEQTTLNRWCPR  10
            PEQ        R
Sbjct  122  PEQDAFEAMVAR  133



>ref|WP_023196646.1| isochorismate synthase EntC [Salmonella enterica]
 gb|ESE94283.1| isochorismate synthase EntC [Salmonella enterica subsp. enterica 
serovar Virchow str. ATCC 51955]
Length=244

 Score =   199 bits (506),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MD SLAE+ Q+TMATLAP+RFFFMSPYRSFTTSGCFAR+ EPAV GDSPDSPFQQKL   
Sbjct  1    MDMSLAEDAQETMATLAPDRFFFMSPYRSFTTSGCFARYTEPAVAGDSPDSPFQQKLRQQ  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FA+AK+QGI NP++VGAIPFD RQPSSL+IP +WQSFSRQ+KQ +AR FT  Q L V  R
Sbjct  61   FAEAKSQGIANPILVGAIPFDTRQPSSLFIPMAWQSFSRQQKQRTARYFTDHQPLTVTAR  120

Query  54   QAIPEQTTLNRWCPR  10
            +AIPEQ        R
Sbjct  121  KAIPEQDAFEAMVAR  135



>ref|WP_006685580.1| isochorismate synthase EntC [Citrobacter youngae]
 gb|EFE08368.1| isochorismate synthase [Citrobacter youngae ATCC 29220]
Length=391

 Score =   203 bits (517),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEE  QTM TLA + FFFMSPYRSFTTSGCFAR+ EPA++GDSPDSPFQQ + AL
Sbjct  1    MDTSLAEEKTQTMPTLASDSFFFMSPYRSFTTSGCFARYAEPAIDGDSPDSPFQQNMHAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FADAK+QGI NP+MVGAIPFD RQPSSL+IP+SWQSFSR  KQ S+R F   Q+LNVVER
Sbjct  61   FADAKSQGIANPIMVGAIPFDTRQPSSLFIPQSWQSFSRTAKQQSSRYFDGHQALNVVER  120

Query  54   QAIPEQ  37
            +AIPEQ
Sbjct  121  KAIPEQ  126



>ref|WP_038447527.1| isochorismate synthase, partial [Salmonella enterica]
 gb|AHP63674.1| isochorismate synthase, partial [Salmonella enterica subsp. enterica 
serovar Enteritidis str. SA20084384]
Length=356

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MD SLAE+ Q+TMATLAP+RFFFMSPYRSFTTSGCFAR+ EPAV GDSPDSPFQQKL   
Sbjct  1    MDMSLAEDAQETMATLAPDRFFFMSPYRSFTTSGCFARYTEPAVAGDSPDSPFQQKLRQQ  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FA+AK+QGI NP++VGAIPFD RQPSSL+IP +WQSFSRQ+KQ +AR FT  QSL V  R
Sbjct  61   FAEAKSQGIANPILVGAIPFDTRQPSSLFIPMAWQSFSRQQKQRTARYFTDHQSLTVTAR  120

Query  54   QAIPEQTTLNRWCPR  10
            +AIPEQ        R
Sbjct  121  KAIPEQDAFEAMVAR  135



>ref|WP_038448666.1| isochorismate synthase, partial [Salmonella enterica]
Length=364

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MD SLAE+ Q+TMATLAP+RFFFMSPYRSFTTSGCFAR+ EPAV GDSPDSPFQQKL   
Sbjct  1    MDMSLAEDAQETMATLAPDRFFFMSPYRSFTTSGCFARYTEPAVAGDSPDSPFQQKLRQQ  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FA+AK+QGI NP++VGAIPFD RQPSSL+IP +WQSFSRQ+KQ +AR FT  QSL V  R
Sbjct  61   FAEAKSQGIANPILVGAIPFDTRQPSSLFIPMAWQSFSRQQKQRTARYFTDHQSLTVTAR  120

Query  54   QAIPEQTTLNRWCPR  10
            +AIPEQ        R
Sbjct  121  KAIPEQDAFEAMVAR  135



>ref|WP_023182908.1| isochorismate synthase EntC [Salmonella enterica]
 gb|ESE87745.1| isochorismate synthase EntC [Salmonella enterica subsp. indica 
serovar 6,14,25:z10:1,(2),7 str. 1121]
Length=391

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MD SLAE+ Q+TMATLAP+RFFFMSPYRSFTTSGCFAR+ EPAV GDSPDSPFQQKL   
Sbjct  1    MDMSLAEDAQETMATLAPDRFFFMSPYRSFTTSGCFARYTEPAVAGDSPDSPFQQKLRQQ  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FA+AK+QGI NP++VGAIPFD RQPSSL+IP  WQSFSRQEKQ +AR FT  Q+L V  R
Sbjct  61   FAEAKSQGIANPILVGAIPFDTRQPSSLFIPMEWQSFSRQEKQHTARYFTDHQALTVTAR  120

Query  54   QAIPEQTTLNRWCPR  10
            +AIPEQ        R
Sbjct  121  KAIPEQDAFEAMVAR  135



>ref|WP_000381300.1| hypothetical protein [Shigella flexneri]
 gb|AAA26516.1| EntC [Shigella flexneri]
 gb|EFS11503.1| entC [Shigella flexneri 2a str. 2457T]
 gb|EGJ91451.1| entC [Shigella flexneri 2747-71]
 gb|EGJ94118.1| entC [Shigella flexneri K-671]
 gb|EGJ98287.1| ENTC isochorismate synthase 1 domain protein [Shigella flexneri 
2930-71]
 gb|EGK40763.1| entC [Shigella flexneri K-304]
 gb|EIQ32167.1| isochorismate synthase entC domain protein [Shigella flexneri 
K-404]
 gb|EIQ77149.1| isochorismate synthase entC domain protein [Shigella flexneri 
1235-66]
 gb|EJL17269.1| ENTC isochorismate synthase 1 domain protein [Shigella flexneri 
6603-63]
 gb|AIL34462.1| isochorismate synthase [Shigella flexneri 2003036]
 gb|AIL39380.1| isochorismate synthase [Shigella flexneri Shi06HN006]
 gb|KGA00041.1| isochorismate synthase entC [Shigella flexneri]
 emb|CDX05801.1| isochorismate synthase, entC,Isochorismate synthase entC,isochorismate 
synthase EntC [Shigella flexneri]
Length=93

 Score =   192 bits (488),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/93 (100%), Positives = 93/93 (100%), Gaps = 0/93 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL
Sbjct  1    MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPES  136
            FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPES
Sbjct  61   FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPES  93



>ref|WP_038388995.1| isochorismate synthase [Salmonella enterica]
 gb|AHR83468.1| isochorismate synthase [Salmonella enterica subsp. enterica serovar 
Enteritidis str. EC20120213]
Length=391

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MD SLAE+ Q+TMATLAP+RFFFMSPYRSFTTSGCFAR+ EPAV GDSPDSPFQQKL   
Sbjct  1    MDMSLAEDAQETMATLAPDRFFFMSPYRSFTTSGCFARYTEPAVAGDSPDSPFQQKLRQQ  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FA+AK+QGI NP++VGAIPFD RQPSSL+IP +WQSFSRQ+KQ +AR FT  QSL V  R
Sbjct  61   FAEAKSQGIANPILVGAIPFDTRQPSSLFIPMAWQSFSRQQKQRTARYFTDHQSLTVTAR  120

Query  54   QAIPEQTTLNRWCPR  10
            +AIPEQ        R
Sbjct  121  KAIPEQDAFEAMVAR  135



>ref|WP_038422538.1| isochorismate synthase, partial [Salmonella enterica]
Length=383

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MD SLAE+ Q+TMATLAP+RFFFMSPYRSFTTSGCFAR+ EPAV GDSPDSPFQQKL   
Sbjct  1    MDMSLAEDAQETMATLAPDRFFFMSPYRSFTTSGCFARYTEPAVAGDSPDSPFQQKLRQQ  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FA+AK+QGI NP++VGAIPFD RQPSSL+IP +WQSFSRQ+KQ +AR FT  QSL V  R
Sbjct  61   FAEAKSQGIANPILVGAIPFDTRQPSSLFIPMAWQSFSRQQKQRTARYFTDHQSLTVTAR  120

Query  54   QAIPEQTTLNRWCPR  10
            +AIPEQ        R
Sbjct  121  KAIPEQDAFEAMVAR  135



>ref|WP_038425772.1| isochorismate synthase, partial [Salmonella enterica]
Length=384

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  414  MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVNGDSPDSPFQQKLAAL  235
            MD SLAE+ Q+TMATLAP+RFFFMSPYRSFTTSGCFAR+ EPAV GDSPDSPFQQKL   
Sbjct  1    MDMSLAEDAQETMATLAPDRFFFMSPYRSFTTSGCFARYTEPAVAGDSPDSPFQQKLRQQ  60

Query  234  FADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQASARRFTRSQSLNVVER  55
            FA+AK+QGI NP++VGAIPFD RQPSSL+IP +WQSFSRQ+KQ +AR FT  QSL V  R
Sbjct  61   FAEAKSQGIANPILVGAIPFDTRQPSSLFIPMAWQSFSRQQKQRTARYFTDHQSLTVTAR  120

Query  54   QAIPEQTTLNRWCPR  10
            +AIPEQ        R
Sbjct  121  KAIPEQDAFEAMVAR  135



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520